ELF@4%X4 ( @@%x)I3P zHP tHP pHP lH_HyHP `HP THP ZHP THP PHP LHP HHP DHP @HP HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P HP ? HP @ |HP A xHP B tHP C pHP D lHP E hHP F dHP G `HP H \HP I XHP J THP K PHP L LHP M HHP N DHP O @HP P HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P ;8;;;;; ;(;0H )@`  > !  > ;8!7 > 0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >  9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->  %)>  %"+/> -> +cP> I `" #t@> [#;x ;"`;" @X@shҊ@@2 @ 0P -@ @ @"P/> P->  %)>  %"+/> -> +cP> I `" #t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Xt x ``-`؁ @X tx ρ )>!4@! P->  %)>  %"+/> -> +cP> I `" #t@;x;;>!<!@ ;`#h#l;;;;@J``htx ;`#h#l;;;;@``htxn )>* @)>* P -@ @ @"P/> P->  %)>  %"+/> -> +cP ;`@;h#t;x;;;;;`@;`htx( /> -> +cPۜP -@ @ @"P/> P->  %)>  %"+/> -> +cP ;`@;h#t;x;;;`;;@;`htx၌ -?P -@-P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P;x> I $`" $@;,/,;@ ;`,)>  ;h %)> `# #pH  p@  "`@ x  +?P`-@-?P- %0P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P;x> I $`" $@;,/,;@ ;`,)>  ;h %)> `##pH  p@  "`@  @@zi`x' P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P> I $`" $?P * * ;`@;h09P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P> I $`" $?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@V`h ?P `*  P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P> I $`" $?p " ?P "  ;`@;h@z`h ?p " q @/>  @̀->  $)>  %-> +cP-> , ZP @ H ,@`#> c$` (08 @̀=)> #0+0;"+2+0 `# @ 05-" % >&u 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> %- +cP ;`@;h #t;x;`;;;;@];`htx -> & 0Ȧ! H,@` !`hpxX (08@HP @̀H,@`%>  $!> #`8 (0 @̀@ @̀  H ,@`#> c$` (08@̀2??@ @̀='> 0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> c $`!> #`8 (0@̀ -> ,  @uP-> "/> b4͐  ! H,@` !X (08@HP @̀>  `?* `"" * `@"> +  * `@&* *  ֊@* "``'1@'0@ )>+>%@#' $P(   c     c  mt@ >   >  @@   >  @@ #>%> b `P@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@> "# *> "#!`> "#ćH(  /  >  ==> H > "#> n > ba@"@!> $"H``> "b  !>%#!>'"$ $ >&  2> " > " > "!> "!@>#"">#"">#"#D>#"#l>$""$>$""L>$"">$"">*" >*"!0>+""܁@ej@td#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%> > > "  "> >@ >  #>&c# #>&c# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >  >@ *>  >' @" > " > "   > 4``6 > c >   !!`> 8 @0> "`""> I (`" ( > ߈ > > !⬁`2$j0>'@{!x>'@{!>'@{ !switch rqswitch wchanswitch SRUN> > : H> " (o!⬁`j>  H> :">*T"2J "2 J    "2 J  J " > ߚb+  @ #@"   *@ * lH1 > "#( `!⬀"I"j > #Ē`"#ĝj ` *@  ( !> !` (08 2㿠@> c` Ъ@@>`€"Т@: H" H*/  h`>   > >(" " " ?" ?> > >(" " > > >(" " > > >(" " > ؀ > >(" "" > > >(" 2" > > >(" 2" > > >(" *" > >(`" `2 `2`2" > >(`" `2*`22`2"" @>(`" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*> c>)` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >*T "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a> `L """"""""""""""""@2?# * 2  `Lc  @ `L> ?HH @ 3 >  c@  Њb@&""""  > <b(@ @> b ``44: " longjmp botch@" `&"`㿠>+@vh#6 0|D8hDL| 8999::H3t33344 4<::4X4t444:677888|86:::::::::6x6::::::::::::::86x6l6`6T6H9:::::::::6<<<<<;;<<<;;;;;;<<<<<;;<<<<<<<;J<= =4D<DE(EEF FHFpFFFGG8G`GGGH LLHHHIII`IIJKlLLLLLLKKLlLx!=>5 cp.!=B  !  €* 2 aS 2  ؐ`€ * 2 ` 2  ؐ`€ * 2  "   `@  7@'$ @2  6 6 6  @ &  ؐ`    /     6 6 6! 6!  6 6!6 6!  `@ ` : ` ">5 0  >5  @ >5  #x#>5## ؐ`   ؐ`!  ؐ`   ؐ`(  ؐ`  ) ` ܒ <.   ">5 "c  d ܀ . >5#  >5#2>5>5#Ȧ#  `v€a id+ &>6@2"+ @>5>5$#@>5>5$ # @>5>5$# @9ϖ   >63  @9Ɩ        av€a  ̀id+ '>6@#+ @>5>5$# @>5>5$#  @>5>5$# >63  @9~ x  ؐ` ܟ€  `*`>,  €>6(@9g >6  ( @>6  ( H>6  < P>6  <  X>6  < `>6  < h. .   `v€! >6 @9;p *@$  ` € * 2``2   >6 @9  $ <.  *@$ *`"   @ +.    >!>!`" @   `  1 d !   "  ؒ B    `   d !     ؒ @   ؐ`  ` ##>6 d?<    €`0    `€  "  0 `€      ؐ`   ؐ`   % @ː d ؐ`    5  `( `€ * 2 `  !  `€  * 2 `  ؒ @`€ * 2 ` @  .   0   /(    @  `@   `" @  / f #` d? X>6 ؐ`€* 2   7@$ J  @7/b <)!777777@$| 耢.7" @/"?#@! )!@"  >6#`#\@7Ȓ 0 `$   "    /#( 3``$ &!d`$ 6!^6!`77`$ @$.7  !`>6"@7  77@$ 耢@>6Ŕ0   &  * >6& H@7{ @ 77@# !    ` ` 477@#  7@# @ 2  ` ꀥ   %6 6 6 6 6 6 >6  !`>6!>6!  #\  #`#d@72 "D@  * *`     2 >62 @7  ؐ`€  >6ؐ@7   怢>6 耢     @6  7@# 5>66 *` @62@$ǐ  @ >68!=  .!=`       `  & @6Ò 0& 㿘@%x     2 @%m  @0@㿀  ܀   2   2 @2     `. 27 ` 7 `  7 7  @#7 67@2` `72 7@" 耤 57@2`2` `@ 722   7@"ڔ 耢 3>6@3`2 23`#\P   `@6;  37 `7 7@" 耤 >6 ` @6' 0j 17`7 7@" 耢]@]     2!z@R !z !x @777777@" = !t6!D!v!77777@"u 耤@+ J6!@ !@?6!B 7耢 7 7 ?  7ꀤ @"U 耢>6@5 !=  .!=㿀.`*  ܐ *  07.`  7 @"2 @>6Ж  71@5 9>6,*  2``c  2   `.`,  8@77ꀌ 77  2 * @7 `2`#\#` "@5e@! ' 8@7777@!ݔ 耢$*  72    977 7 7@! @2  , *  @2  !=2 != *  `@.!=!=!=  `@.!=0` 㾰'D ܈'@'$@D 0"@2` `$ @J `D  $` /  ?# @3DD@  * *`   @ 7@@!D22 `2?# @31 * 2 '@ 1 >6D'$8 @4$$$1  *`  1  >6D'$h@4 $ 1 `  1 `>6D'$@4 $ 1  `) D  ) 1  /2DD    1   @   D @ 0 @  1 @D  /D @ ` 1 @`  D D  1 DD  *  *`  '( 8 77'$77@  $D  `/ ) Dؐ `  '$D ؐ ` D  ؐ `!Dؐ` $D  ?p }?x zxx/`'d|*`t'Tp2 7 '`'/``|d2'P'lPx|*T3 p'D'@t'\+@',D*`3 2 'L x@ , 3 '<    37`x7 '4  3'h7 7`x x7 7`  'X'H'8'0 1 o>6) _) O) ) ) 7) ) ) ) ) ) ) t|#\<) ? ) w) ) D@3'$ $D>6 '$@3$? *@1 D!av @ax>7ataz1 (1 $ 1 & @1 2 D1 *1 01 ,1 .1 41 6D @3i'$  $@ ) )( (`2    0?# @2 *`@0D2    0?# @2 *`@0D2    0?# @2 *`@0D 2    0?# @2 *`@0   ) ) (  ((  0 * D 2    0?# @2 *`@0   ) ) ( ( * D`2    0 ?# @2 *`@0 D`2   " 0"?# @2 *`@0"D2   $ 0$?# @2 *`@0$D2   & ??# @2 *`@?#0&(  D 2   3 @2 *`@3 ?#0  D`2   3 @2 *`@3 D`2   8 08?# @2 *`@08 : ;) ;) :(: ;(;D2   < 0<?# @2 *`@0<D2   @ 0@?# @2 *`@0@ B C) C) B(B C(CD 2  " D D?# @2 *`@0D ` 7 77 (7D7777@ @D7!@!@7!B7!D!=  /!=!= `` /!=㿈 ܒ c7! 7   7` 77@7@ ?  5 @@ *  `@.@ ܐ (? (㿈 ܐ d7.`# 7`7 777@_ @`?@( 㿈.` j7耦  7`7 @A @3   3 3 *`*-5,`4      5`-    -4,  -`,  6    `ܨ 'l`;'p-B9>75>7@<'dd@Il 2  @d@ l2`@ `d @1U l d2 l@2   @7 @/l   #dl>  2`  ` >5#\@*  #`'d@. l3 d p *`  l*  (#8+ l *` l*  (@``@2@l` @2@`l@2@@2 @  @2@$$ p@p ?'@l 'p'd@- dl `/`l'``?`` ?``2 "@" @@" @@ ?@ ?  ?  '@@`'@l  @,'p  >,8* >7 >7 >7!>7! >7 !(>7 !8>7!@>7!H>7!`'D '2     ?2`   2`  @D Ѱ?@ 0g` "@ 0("° ? ((  ` @*<  '!D '$@,f$ @h$ `@  !   2     ! ' '*(', @* *` (`( w?'0"@*` *  *  *  : ?'|`W'  @S, 'M, ` 2`D'$ `ڔ $, 'T'd'D'l  ?h'L't?Ht?pT'\?Pd'<l?`6 D--`tL?@  6 @ *h H\+?Xd@0D. 0`@* <(@ ?8l@L..`  @* *`X@<+8*`2 d +D + @ \<@ +2@@\@@@@.  @  @ 0  3@4@* *`   2* 2& 2" 2 @2` `2|`!2 >4D'$ @- $ /'`?`8`  q2`D'$ ` $$ q7  *`D7'$7@i70>4$*` ** $* :  @,D$ ?o! og`T?0" * *  *  *  : ' ~) '43 R`~ o7` *`7'$D74@#7 /'`g$?@` 2>, X*` €+ &0'>4&* +  + +    D'$x; @,l $ !` ) >4'$D @,] $!'  ~`~2 ) Dh'$  $>4 PD@,D $@ /'`  >4 D'$@,2 $* *`   >4  02  !-,`+`(  5   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @#9   @0#* *  *  *    !: 'D'$@) '$D'$@+ $>5 ?! 3 D'$ @+ $ q7 *7D747@  /'`U$, *  (@ ?  0(" 'D @2        ~H@ D@@ pe'@ ('@@⥒+ '@̖ * * `( '` @D'' r ? @2   *  @ bD? @2     @  ? 'D'+  @2   ?@2   @ 'u`>7Dh@* ? +`(,`  5-   6`.   @-5`-   .`-`    ? +`(  ,`5-  6`. @  -5`- .`-`    ? @ 02  @'@ * *`  ' /  8' '`(!) `**@ *`@ `(*"`( * `@* ) * @ ( " ( ' ''8@+  * @`@ ` @'`8>4*` *  ` w@(*  @n! @ j@ ) , ,@#\#`'D@*  (*` ** @ @*`@ "`,*`)+  *@ ( "( *` * @  `  :"(,*  @9>4+  *  @2   2D "@'@)Ԗ* *@ ( ?"( ( $ ( ۨ   @~'6+  * @ ,>4 )xD'@) e`8+ @ *`     @`8@ @`@@2`@2 '>7D'@) >'0*` * @* )@* ** @ +  :`0* * @ :(* * @ @  ( @ # (,* * @ `D# (# ,' @' '*  (@ :$@?ؒ"@*` *  *  *    2   @ < 'D @'o@r    @ 0&'@㿈@ @ ";  2`  2@ p""@@28?``>, *` €>7!>7!>7!>7!>7 ">7 " >7@@e >7H@(Β ?@2`  ?2`   ? @` p$ @а  ( p#@ @ 'l@'hl "0@@ `!q#4 @ !c 2`4 4 4 4 4 4 $ h 2  @  @@?# @2 *`@3 2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2  "  ?# ? ** @2@ 2@ #  2  "  ?# ?*  *@2@ 2@ #  n7 ! 7 @@7 'l'h777l  h@2`   p" @@2   ԰? @ `((@  @ +` +` +` +` +` +` +` 2    *`?# @2 *`@*`2`@3` 2  "  ?# @2 *`@* 2  3` `+`  '+` `'+`  +`  +  -  2` `  @` `   ` `" >5>7'lX `@'>#\l U@`?`?''''x''tx 'l@ހ'h<*+`  t''t *`* @ @ '@h l  `7Ȓ@ ` !h7@ ! a2 2` 777'77҄@ ' ? @ 2 *`@3 2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2  "  ?c ? **` 2 2 #  2  "  ? ? **` 2 2 #  7 n 7`@  @ 7`'l'h777l  h@2`   p" @@2    @ !!/@ /` /` /` /` /` /` 2  /` ?# @ 2 *`@ *`2`@ 2  7`   ?c @ 2 *`@* 2  7` `'|/`  |/` /` /` +  `  @ >5` `>7'l#\'hz`` `+``(`,`` ` `5-   6`.   @-5`-   .``-`    ? 'l@'h 7l  @`  7 `@ ,!!2 7 7 7 7 7 h  2 '  @  3 2    3 ?c @ 2 *`@3  2    3 ? @2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2  "  ? ? **` 2 2 #  2  "  ?# ? **` 2 2 #  7 n 7`@  @ 7`'l'h777l  h@2`  j p"g @@2   a @ !!/@ /` /` /` /` /` /` 2  /` ?# @ 2 *`@ *`2`@ 2  7`   ?c @ 2 *`@* 2  7`  |/` /` /` /` +@    `  @>5` `>7'l#\'hh @$Fl@2   Eh[?` `+``(`,`` ` `5-    6`.  @  -5`- .`-``    ?t @ ( 7'x'l'h@"P hlt `$x 2 @>7'lp@# l@ 0$ @H ܐ@4 <  7@  a4 @ "!2 4 4 4 4 4 ` !4   ` 2 4 4  @  ?# @2 *`@?#0    2   2 @2 *`@2? 2    ??# @2 *`@?#0    2  2 @ 2 *`@2? n  77 @@7 777@ @>7@#` @ *@ & & , `2   a=2   >7@#G   `  ,4 2   >7 Ȑ@#0 n  ``n `2   `   } U& , O2`  }J 2`    & ,2 2 h0 e( & $ o"2`4  2! h2`  2 h2`  2`  - 2  h /(`- h*  (  2 2 >7@"Ò @ & , e a= "`@`ؠ `€4a@a@4?aB4?*al  4? @  77>7 a=  `       @?# a=2  : ݐ@˒ @   -`,4 , ,`2  " ,,  , ,  ,  ,  ,  , `2  " ?  **` 2 2 $ `2   , , ,  , `2   4 @2 *`@4 `2   4 @2 *`@4 `2  4  @2 *`@4 `2  4  @2 *`@4   $   * ? # '? ?   `2  "@ @ *  *@ 2 @ 2 @ `2   @@ *  *@ 2 @ 2 @#$?ؚ``ؐ`` 4aB a=*@2   a=* *`  `,a= `4a@a@6aB6*al  6 @  77>7`@@ @ , `   ,   ,, ` "    2  J`   d`ܔ̑-*  h"    4   d, ` "`    4  `  4 , }  @'#* `4   4` aJ   ah "   *@`22ah ?*"@0`쀢" 4aJ >7P$`ؖ`@`g" `.`쀢@*ah* &"@8@   & , f& , >7J@h $  g 2   #` @@ #\`ؐ``4aBa> 4a>㿈 >, * €>7@  ?  7耊`7 `7 7    7 7 != 2* != *  `@.!=@  @2ΰ?>7@  ư ?# :..`@  777@  @2?>7 @ g!= *2!= *  `@.!=      !h*@ * +  2 >8@ ; {?  2 ` `7  `.`7777.`  7.* @ 777; @R  L D > <8 "3?/ "*?&   b7 @ d@?    @ N  ?x  . Z?.!!=`B 2.>!!< !L2@    <  `€4  `!^ " @   & @< != .!= >8.02@x   2`@  . 2` @@2" !=2   2 !=2   #.`>825 `@R  ؐ! €!* 2    `@ ؐ`  0Y  / `€!!D* 2`  7>8!D@$  !D7   02.   8* ؠ  ؐ`€! ت`€!* 2 -`2 @ #$ ؀@  `@>8@ 0`€!-`2@ 6!F2H ؀ 2E   /(  d ؐ`€! ت` ` €-`2@'   / `€  ش`€ .!.``B >!,`>8#\ؗ23  @4  6!F `@ ؐ`  !H 4  6!H ?# *  !p  ?2` 7` ` ``" 2   @.`.`.` ..`.`.`. 2  "` `? *` * 2 2  2  &`` @2 *`@ 2  6` ` @2 *`@ 2  6 ` ` @2 *`@ 2  6 `` @2 *`@ 2  6`` @2 *`@ 2  6`` @2 *`@ 2  6 ``?  **` 2 2 &   *   * .X 2   x@/y`/x`/{` /z@/x`/y`/z`/{z  *z  ?2  c|`* @2 *`@3@ z z|*2@z  z|, @ @ :z, z!: *6!:А@֖ " !Fǐ2   @.`.`.` ..`.`.`. 2  "` `? *` * 2 2  2  &`` @2 *`@ 2  6` ` @2 *`@ 2  6 ` ` @2 *`@ 2  6 `` @2 *`@ 2  6`` @2 *`@ 2  6`` @2 *`@ 2  6 ``?  **` 2 2 &   *   * 5>5P#\@ڒ  %>8!>4@Β  /'>4%>4 `  @Ys  @2` @ @/@ @  - >8 @b ؀ >8(@  >8@@  >8P@  >8h@    2@ʒ @>8 @j) ؀  (!h *  ?`"* @Ӯ @  >8@M   ؘ >8@B  ؐ`!02 ` *2 @!h* "@  $`,` !=2` `$``!=*  .!= $`, "  "  6  @" ,`X>8@`, 2  `X 2  $`,  >$`( " `X 2"`, 2 $`, `4   "J>8`   d ܔ̑* *  @ " ` != d  !=  .!=->8@2 $`( , "$`($`( @>8 `X 2`$""`$`, 2 $`, `4 Đ  6 >8`$@ @"`$  (,`X $`,`, 2 `$>80@n  $`,`$ $`(X@e `, 2`$ $`,`$ "     2 0`, 2 `X ( @" `X `6   W 0  . ?` ( 8 >5 2 `$0#\`( #` `X #d#h`,#l@!> "-!>?6!>-" @i @@ -`2   `! ؐ`€ !86!@@&6!8 6!D6!H, `!(B@>!( , 㿀    2 '  ` €* 2 '.`4 >8 @@Ö?ߐ#@`?>, ؓ*` €!= 2*  != *  `@.!= @ @ @  @ ?>8)>8& ؐ`€ >8А@ 0v>8@ 0o>8@z >8=8>8H>8p@m   `€@h!>8d0.`D>8@@.`>8@P   *# * "  1"@<    " * # * ">8А@'   *@"  " * ">82@ != 2* != *  `@.!='!#'!N '!'!'!'I >9 @!0`B  >!0  `€ 2`  ܐ "  pa"!= .!= @  @2     쀢  !h*@ " " , &!h>9(@ !=  ܔ.!= "  pa"1 !=  ܔ.!= "  p"  !=  ܔ.!= "  p" != `` .!= |" @  ܐ pbo" @ | @  ?  "@^!=   ܔ.!=  ?" ܐ @#>9P@7 Y  `€=.`2 `,>, ē*` €>9h>9@ # >9>9@  @] @ ! @W Z?>9@  >9@   @E!= ` ܒ`.!= ?" @ 0!"@>904 @ߒ 䀊!-   :   `€.`4 ``` `$!:%>9@m @H !:&6!:! `B >! 㿘`>,!ؓ*` €>9h@  !(`B >!( @ "  >92  a@  ` `+>,"T*` €` b2  >9``2 ` @d ,    &,*` 2` 2  >9#\  >9``2 ` >9H " /H * *` 2 *` !OH>9"0` J 2 * *` 2 *` "OH>9"@` J 2 * *` 2 *` $OH>9"P` J 2 * *` 2 *` (OH>9"`` J 2 * *` 2 *` @OH>9"p` J 2 * *` 2 *` @OH>9"` J 2 * *` 2 *` @OH>9"` J 2 * *` 2 *OH>9"` J 2 * *` 2 *` OH>9"` J 2 * *` 2 *` OH>9"` J 2 * *` 2 *` OH>9"Ѐ` J 2 * *` 2 *` OH>9"؀` J 2 * *` 2 *` OH>9"耢` J 2 * *` 2 *` OH>9"` J 2 * *` 2 *` @OH>9#` J 2 * *` 2 *` OH>9#` J 2 * *` 2 *>9( @ >9``2 `0 #\ >9 X 2   @{  !=2  d  !=*  .!=,` &, >9  2   @\  !=2  d  !=*  .!=,` >9  2   @@  ` @", `*  ܑ* @`(  !"`(, Ґ &,`>9 &(``2 `h  >9``2 `^  >:``2 `T  >:``2 `@J  >:``2 `p@  >:``2 `6  >:``2 `,  >:``2 `"  >:``2 `(  >:``2 `P  >:``2 `p  >:``2 ` @ O, >:``2 `  >:``2 `  ``2 $ (, >5`#8`#\>:">:"#`͐,&( >5``2 `  >5``3` ` >5``2 `8 >:(@P , >:``2 `PX #\@A  (.X&, >5``2 `x  >:``2 `z  >:  3`   `@   "(, `$ ܘ `?ȑ*` *  *@ 2  `* *  @ "  != d  !=  .!=, "&,0 >:  3`   `@   ", `$ ܘ `?đ*` *  *@ 2  `* *  @ "  != d  !=  .!=c, >:``3` ` `@ V,` (  >: (@   >: H@  @2    b788@ʔ !=  ܔ.!= pb" @Ҕ ,`) '&, >: h@s ,  &, >: @f ,   &,>:` @Z ,  &,㿘.`6``= 쀦@ !h.` ?` **>:2@8 0'2  + 2 !h* "@`$&`(  .`X  2!> "!0!>?6!>!0B@5>!0㿈!\   = !L@" 6!^5? `@ ؐ`  !\ !d  0 0!` 76!`7 !P2!``6!`7!\&!d!^ 7?6!^@ 㿘 > #`> !,@ ,  2  ? ,  `  `? `  !L -- `2`45`` 2 6!\.!<!= .!=  `@׹#p > #` > !, ^@  >=6@&8 -   ``2  ?  `  ? !L  >=6@P@: 0   +- `@@4@4  `6!\.!<!=  .!=`@!^   < ,` 2 "@*`" * *  @Ԓ֟Ҁ  ֐;!=2   0!!!=2  2 !=2  )>4!\`@ݒ 0"&  '>4%> ֐ @.[  `"耢`# !=>4 .!=!\& @ !=2  != .!=0   *" @ 2@  `} { >  `> !-  `2 @>=h@O> @`@1 4`@ "R ``DE>=@G`@=>=@". ``@`@/>=@` @!'>=)>=' $>=" >= >= >= >=  >= !>=! (@N  >=8@' 㿈  i 7 @ *  @$㿘!=    < @,`x!= !=* ` *@  .!= .`*   ܑ* ??c#   ->= 2` 2` @ >=$ ` @͘l`  2` (7 $ 8'䀊 ^ 87 ?!a @4  @7@7@2 7 2 * @7 ? * (@4  2#\#` @   $ '.`,` 7 䀢  !=2 !=@ *  `@.!=`2,  *@ * .`$ @4 ' @``  *  2` 2`  `!=!=  `@.!=0` p a.`* * " ܑ*  I $!    k$, 4 4 , , ,  ! <  4<  !4?* 4 @  @    @& ` #&  " >=   @     : !>=   @   :   : .`*   ܑ* @@` @* @ *@*  $@  <*$* $@!   4`,`,` 4`,` ,`   *` `  "` `  @21@@  @2(@ %7  @@  $@`* @2  *@ * $@ 2  * * @$@@!>53` #\ ` #` ` # #d ` 3`#h@>52 #lp ` @] @>53` #\@3`2` `#``3`#d`#h  @G `???ì#c !)>5 4  $ , 4 4  ` ? )  # `2  2    ` 2 `  ? : @2       * 0 *   , $ , #\ 2  #` #d " @ 㿘!=2   >=@ݒ   2 " !=2   !=  0.!=!=2   >= @  6!>5 ,`2   (!h *  ? 2`"  $ 쀢@!h* "@ $ " $ (  2 $$ ( $ ,@ `*` 2  Ϣ 㾘 ` !       @  `!S@2  P=` 2  2j?>=@@X >=X@P [?  @T `    @ ` >=h@/ :?>=@% 0? `   @@ !  @    ` @@   @ @9 㿘 ؒ   *  ؐ`  "  `  `@` 2  2 ` f 8`?`f a `&&6* 2 <    ؠ    ؔ`    ؔ   <<6 *`6 ؒ  ֐  ؐ`€   6ɐ  ؐ`   < ؐ`  Ҷ ?# @ `*`2 @6㿀`  ܑ2 ` @ ` * * $@ (2 ``2 * * @$@`?,` `c,` `,` ` @ * @ @$@   2`  4 ` @ $   @  $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!>5`*@ 4`` * @3`$@ `#\ ` #0#` ` 3`#d ` >5#h@p2 #l ` @  @3` #\@3`2` `#``3`#d`>5#h  ` @ Π %>5` 2  * * @$ `, ` `*` 0 $ `,    `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d 0@ f  <2*  *  @$ , 4 ``` 㿀.`*   ܑ* 2` `**` $ ( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>5#` #d #0#h3`2 #l>5p ` @ >53` #\3`2` `#`3`#d#h  `@  ( />5  `+  2  * * @$ `) *` `+   *  p@" `* `*`4  " !4  `$4  h4 `   4 `   4 ` @  4 ` 2     4  4 #\ 2  #` #d 0@  <2*  *  @$ , 4 ` ``p 㿀.`*   ܑ* 2` `**` $ ( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>5#` #d #0#h3`2 #l>5p ` @ p>53` #\3`2` `#`3`#d#h  `@ Z ( />5  `+  2  * * @$ `) *` `+   *  p@" `* `*`4  " !4  `$4  h4 `   4 `   4 ` @  4 ` 2     4  4 #\ 2  #` #d 0@ Ә <2*  *  @$ , 4 ` ``p 㿈` `+``(`,`` ` `5-   @  6. @-5`- .-``    `ܒ >= '@ 6   @ ? `  /E<?` `+`` (`",``! `# `$ 5-  @ 6`.   @-5`- .`-``%     >= '@ 96    @ #?@ ?   @   $@2  ?  @2    $@"  ?   @"/`   $@)     2`2  <?#?  ?    2`   2`2` @  ? ` >=` *` `+ `@ ` #\'@ є` ` * @7 `$2`` ` * @7 `/ `/ `(2``/ `@2``/ `7 0@ 2?0(2 ` * `*  +     +     +    +   0` 2?0(2 0` 2?0(2 ` * `!*! 0`" 2"?0(2" 0`$ 2$?0(2$ 0`& 2&?0(2& 0`( 2(?0(2( 0`* 2*?0(2* 0`, 2,?0(2, 0`. 2.?0(2. 0`0 20?0(20 0`2 22?0(22 `4*4 `5*5 0`6 26?0(26 0`8 28?0(28 0`: 2:?0(2: 0`< 2<?0(2< 0`> 2>?0(2> 0`@ 2@?0(2@ 0`B 2B?0(2B 0`D 2D?0(2D 0`F 2F?0(2F 0`H 2H?0(2H 0`J 2J?0(2J 0`L 2L?0(2L 0`N 2N?0(2N 0`P 2P?0(2P 0`R 2R?0(2R 0`T?0(2TDD$4DDDDDĝ㿐!=>   0>`.!=bܖ &  0& &  \$`$`$`  ! 4 4`  >`# ``& !)4` ܒ 4`  4` *@6  2  X\ """ `  2 2$ `22 ̒  *@6   "B 'H /d * %    & & H 0 毒     2    '栐 ?` &  & H 0 B˙!g!>˔ !H /d * %    & & H 0  &%"`*' g 2$ @2`  22`   U 2 N 2  2  C 2`  2 2`  4  ?` &  & H 0 4`!>!l@-F     `(!l@-9 㿘 <?#@@& <@ ]㿘   >  T`H>a  d# B# 2 (`*   ܑ*  @`4 : .>  T`< ?#  a `;# `?Ȗ*`2 (* @ @ " 2  !=  !=*  `@+!=* 3@㿐 >b ch@) `   $,6 H /d * % `  $`$`H 0  a=2   4K``ؐ`  χ a=2   & `  ``   ``   `?` $``$`H 0  $, e a= `  0,a=` ``   ``   ` =  $,`   $``$`H 0  2`@` ` "$``"$`$`?` $``$`H 0 >=@ǒ   !2` /`$`@` `` *` ? $`w$``$`H 0 0mD f"0` g e"U T` h"9 N`  h@n#> ? @( $a>` 67`a>>=$`a>@p -`>= `  @$`@d ` "$``"$`$ >>   @Sh>dc@(Ŕ>   @(Ő $`?` $``$`H 0 㿐Ր f  g e 0 h 0   `, 2  &`,   "`5 "  ` ؐ@  C` 2 9#蠄?2 ؀`2 ` 2  ! "`,`,   &`,㿘 @  *&    @( h *@&  @>> ` (@’  * & @;Ð `  $ >>P@ @@  H /d * % `  $`$`H 0   ` 6 ah*@ * * 2  "`  >> p@p`?`$``$`H 0 0@ >> @X`?`y$``$`H 0 0o & `ؐ@ } ` >> @0 @*@-& @- Y $` >>` >> @ "  `쀢8 ah* "@ *  & ,& "`>>@  @*  & @Ւ#> Ǧ @'e h  & `ؐ`€`4a@a@4?aB4?*al  4?@ @  77" `?`$``$`H 0 0 & @ @    4 , , $` , `2  " ,, , , , , , ,`2  "  ?# ? ** @2@ 2@ $`2   , ,, , `2    4 ?# @2 *`@4 `2    4 ?# @2 *`@4 `2    4?# @2 *`@4`2    4?# @2 *`@4    $   * ?# ?1?`   `2  "  *  *` 2  2 #`2     *  *` 2  2  $`?؆`ؐ``4aB `/>>0@ `?` $``$`H 0 㿘H /d * %    & & H 0  ؐ`   ?` &  & H 0 㿘  H /d * % `  $`$`H 0 1 f)>> g e"P ,U` h"2 O` >> P  @u  B h>bc@% @O#>   'p@_ ` ` ?` $``"$`$` &>> >> ᨒ @F h>dc@%>  @%  &   & ,U`?` $``$`H 0 㿘H /d * %    & & H 0   `'& $  ?& ` &  & H 0  C"@ "` >>@ޒ 0 ?` &  & H 0 㿘   &  "@ "` >>@ 㿀`>_".` €  r /m?> @ .`*    ܓ.* @*` @( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@L#  @  " >> ( >> "( >> "(!>>!>>"`.*  >> `#\#`0g>>`` >>@* 0& >> ` ? & R  ? @` & >ea@$  & @$ >>; 3 /.> . ܑ*  ( b@ >>2#\` >>#H>>#P#`#d#h #l #p@Ԓ 0Ѐ>>`@͒ 0 '  ">>  >>)"(>>%"(">> >>"(>>"(>>##>>#>> #>> ##>># D$ >>@  2  @2     !  &* *  ( ( @2`@2 `@2`  @"    M  (* *  (``@2 2>?@7 03<.@ @ *@ &@ >`>`&@"&`  `€        ` €* * , >?023 @  㿘'P'T`'X /@ >? @?@}ct@#"Ȁ 2"Ԑ  @Y &""Ԁ 2"Ȑ  @P &""Ȁ >?"Ԁ 2">?@;Ӑ 0D > >?!@;˒ 0<"* ">?"@;!0" @C  `.  . "*"@ *`"  *  , @2*  . . &  @."" 6 f6 j> `l& |& t& @% > `*"@ @"*`㿘  @!> "!>?!P @;!  ."`  "! >?!P@;o!  ."   E!"` W>?>g"*` €     `  "` &"  "` &"   "    &". .     .     `   `   `   `  " @; !` `   `   `   `  "  `  㿘 @>?!@:ޒ > b!>?!P @:Ք!g  ."`  㿐> "`>?"!@:!> " 2"> n>? Кa#\ L  @0=  $"" 2  & & &  @" ""??06 ."6" "`, @ې Ȩ  "$?   $ ,  "`, @ɐ    @ $@" ,@`,   2 ?ڬ@ې!&"&"  "   :   : `!`*" *** @` ."␀!>?!P @:=!  ."`  0 ."@㿐` `,  ` > "` >?`/"`I`J@: ."`` 2"`А"@ >  @#> _ Z @# @!`" 2 "!>?!P @9"\  ."`            * "' @P ,`"* "@H* &`"  "  2`   `2 "􀌠"?"  "          ` "j`I" Q`/`@&"&"'    `  @2 "  ` "  `  " "!>?!P @9X"s  ."`  "!>?!P @9H"v  ."`    "`@@`/"!>?!P A@90"{ A ."`  A0ܠ  " "    `  ` `@`I.`,`,*`J *`@  `..`." q 2p &"&"'    `  @2 "  ` "  `  "!>?!P @8Δ"  ."   `!" @6".""a >?!P@8"  ."`   "!>?!P @8"  ."`   " "@  @0E @f " >?@8"0"!>?!P C@8}"Ɛ C ."`  C0)`!" @6".""a>?!P F@8e"ʐ F ."`  F0"!>?!P B@8T"̐ B ."`  B㿘H /d * % > n В@0s&` H 0㿘> "` `@? `H / * % > n@. вH 0` L@>}`a@`  &`  㿘  ` !> " `>?@7"@" >?  "X @7``*    @,`  ̔ 4$  @>  2@$ >  H<$ H /d * % ` $ ` "` $`` $ ,` " H 0n 2$ N  $  $ @ $  $ D  /b  $ @ $ < $$ D, HH /d * % $`$ `"@%`  $ b`@OH 02  @ " @ϐ @   @Ɛ 㿘> "`>?@7A"h"" !>? @ "`@ ֐` ""  b @7&"@ #贆2  㿘> "`>?@7""`" >?@5"``` `*     ` @  ` "`  @  !H /d* % ,      ϐ &> $  @A   H 0@@$  <$  "` $$ , " >  H$   "$  `      `  H 0v@=,`I  2 H 0g@ *`  *`2    *`22 >?@4̐",  , *# ,`JH 0       , @``& `␀ @``"`& `@"` $` & 0 "@>?`#@6`@`2`㿘``/  *  > b  >?@6#@  .`/  *`,`,``  4   #&`@&`<&`D&` &` $,     ؔ   2, @ , $  @2 0 &@ " & &  &`` `&` " 㿘` *  ,      > b  >? ,@5#0@``H (2  , `>?*`4 #P2@5  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (Z0Q$ ( b `$  (`" ,>?@5`# ,`2>?>? 4@5X#@5T#@7 @2  ," &  ."+ , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@U  ے`@/%㿘`  `*  ` 2,``  ,`  2  >?>?>?#@3d2`I*"`I `J*`  "">?#@3L ?*`  ?&` @``"`& @`"㿘!> " >@@4 ("!>?!P @4$  ."   "   㿘``>@0"&"""@@3 8 @€ "` * ,`  '>  @€ , &  % `   @€ , @ € "ܠ  '>  @€ , & "ܒ@&"␀  >@` X>@ p>@ x"@4B ␀ """ܲ @ >@!>@"Ԑ @44 "ܲ`@ *">@@4, "܁㿘!> " >@ @4 "   >@#>@@@4` &@>@@4   `@ " 2   `   & 㿘b   bb  b* * >@ @3`!>  ? `*   `@*``       `` `    ,bݰ `.@  >@ @3`!> ,b$` ````+`b`@ . "* b@* & bb  ` 2`` "?b  `  `  `    !> " >@!0 @3P%X"!>?!P @3H%X` ,b`   bbĐ @ ` @" >@!0 @31%Z"!>?!P @3)%Z` ,b`   bbĐ @` ,b4b< $bD>$b" >@!0 @3 %c"! >?!P@3%c` ,b`   bbĒ`@ " >@!0 @2%g"!>?!P @2%g` ,b`   bbĒ`@ 4b,b 㿘> "`>@"@2͐!P"܀ 2">@!x@2Œ 0"" >@ @2!"&"ܒ `."" >@" @2!" "!>?!P @2%  ."`  >@"ܐ!"@2 0"܀` >@!0 @2%"!>?!P @2%  ."`  ""Đ 6"Ē`A3."" "Ԛ "Ԛ  ` ` `  ( ` ` ` `    `  @`?`""!>?!P @2:%Ő  ."`  0">@ "@2* " &"  >A >A ` " *  @ "N>g"Г* €"">@@2" " 6  @.` ">@"0@1 &" ! " $D" ( .""">@"@1"H"€ @"{ ""L!2">@` "`@1Β "b>@@1Ȑ""! >?!P@1%  ."`     ,`    *  2    I   J*` ",J" ?*,J,I *U">@` "@1 " `."  ,  "`     `   `  0">@` "@1a  , `$,"" >@@1V"""">@ "@1L """>@@1D#  $"`." !$ "">@@12#"$<"$D"">@@1'#0<&"D&""">@" @1#H" `  " `G"">@ ` `@1 #X" ` O" `,"   `,," "   `|"@-|` >@@0#x"`2  , `," >@!0 @0۔&^"!Z>?!P T&^d @T  @N!-`@*`@*`" "@C ,`"* "@;* &`,`"* "@1* ,@-6` >@#@0"`21  "@6 ",   ,  `," >@!0 @0&{"!>?!P &{@0  ."`  ""Đ @`."6"Đ ," ."  `+ " @ ,`"* "@ۑ* &`""    2  "? "           ">@ @0#" ` 2L,  @, +@ "g @ ,`"* "@* &`""    2 `` "? "              ,@,X` >@@/ǐ#"""">@@/#@,I` >@@/#" >@!0 @/&"!>?!P @/&  ."`  ""Đ @a`" 2>A"`2 >A  S""  >A h@/ "6"  @"Đ @/t " >@!0 @/l&"!>?!P @/d&  ."`  ""Đ @` >@!0 @/P&"!>?!P @/H&  ."`  ""Đ @` ."6""Ā "!>?!P @//&ΐ  ."`  "!>?!P @/&  ."`  " ."&"܁㿐> "`>A"Đ @/"" @" "=""!>?!P @.&  ."   6")&"Ѐ ">A" >@"Ɛ!0@.&"!>?!P @.ٔ&  ."`  ""Đ @"."@ 6"Đ! @.Ŕ&"Ѐ 2""Ą "ƒ    * 6"6"6"€&"@"""є ǀ""""s  "” """    " *"ȓ*`* "Ȓ`* "*  "* "`&"  ,  , " @ ,`"* "@* &`"    2 "  "  `"?`"  `         ]"Ȗ    `"ȑ* *"Ȥ*`"*  "* I&"" >A!@ @.'! ` "Ȑ 9*@ >A!@ @.'*   I"* J"* (&"Д "Ȑ ."*@ ` *    ` , , *@   "Ȑ  *@ *@  "."*@"&"" 2" "̐""!>?!P @-'k  ."`  0V"@8  '"̔"П@  `   `  @2 "  ` "  `  "!>?!P @-~'t  ."`  "! >?!P@-n'u  ."`    @x> "`>A"@-V!` @ 2 z  € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"␀ >? !  @-  <  -& < @€  ␀! >?!P@-'  ."   ڐ " >A @,!^   >A!@+\  0@Y  @( @€  ␀! >?!P@,Ҕ'  ."    "  2  "`, @"-""  ."ݰ ">A" "!@," @€   ␀! >?!P@,'  ."   n " ` ." € "C  @?2  >A @,x!   @ 2  2* " "& "`2"" >A" " #\ @,U  2 >A "`  ?D#\@,C B>A @,<""`␀ >@!0 @,1(?␀!>?!P @,)(?  ."`  ""Đ @` >@!0 @,(A␀!>?!P @, (A  ."`  ""Đ @`."6" ` ""6"␀ >A " @+ ` @€  ␀!>?!P @+(I  ."`  ␀!>?!P D@+Ҕ(P  D."`  D"?`q>g#*` € ",`  *  ` 2  2 4 `8*`` " `"  "`  "@ @ `2" ">A@(` >A@+"` "*  `." ` ,`" 2>A @+m# `>A@+g#8ѐ>A@+b#H@H  W"`,Z& "?`h>g#p*` €>A @+G#`r "  >A@+>#>A@+9#X""   € >A @+)#Ȓ ?#>A  € @+c ?   "6"ƀ 6"6"."␀ >B@+ @X $ " & &  $ `$ & " `.">A @*#SC   $"" "" >B   "#\@*В : ."␀ >B h@*Œ ` """`."␀!>?!P @*)  ."`   " " "" 2"" ."" >B  @* x ʰ 0  2;>B2>B@( `   *  `$>g#\*` €␀!>?!P @*r)=  ."`   ! ` 2 " I 2">BX >BS ` ␀ >@!0 @@*M)L␀!>?!P @*E)L  ."`  ""Đ @`@."6" ` D ",`,`" ." I`␀ >@!0!@*")T␀!>?!P @*)T  ."`  ""Đ @:a >@!0 @*)V␀!>?!P @))V  ."`  ""Đ @`␀ >@!0!@))Y␀!>?!P @))Y  ."`  ""Đ @a."6"Đ t&"" " " @€  f @€   >B    #`#\@) ␀a>?!P @))y  ."`  ␀ >@!0 @))z␀!>?!P @))z  ."`  ""Ē`@ 6"."␀!>?!P @){)~  ."`  !" !"䀠 >B  !8  ` #\#`@)^ !&"< &"D."u&" ! @)O ␀a >?!P@)G)  ."    " W  `.">B ! @),  "܀>B"@)" ""ܐ ?,H""Ԓ@␀ @ >B "8@) >B ! " $D" ( .""H@( &"␀!>?!P @()ʐ  ."`  0>B"h @(  " 2>B2">B@'K"   "2 @z @ >BĐ#! >B#>B#␀ @>B@("&"␀ @" >B@(" /"  2"␀!>?!P @()  ."`  "` ."␀! >?!P@()  ."`  $ >B" 2 ">B " @(m """@ ߀ ."’`?   # @(Y  `&">B /#@@(P@ @€  ␀!>?!P @(A*  ."`  " X/@ &"&"`'"" @ `   `  @2 "  ` "  `  ␀!>?!P @'*"  ."`  ␀! >?!P@'*%  ."`    @ @/␀!>?!P @'Ӕ*)  ."`   &"␀ @>B"@'#`␀!>?!P @'*/  ."   ""@8  "'" @*&">B@'#x" 2"␀!>?!P @'*8 ."   ""@8 ' "" @ &" >$  `   `  @2 "  ` "  `  ␀!>?!P @'J*E  ."`  ␀! >?`!P  @'6*O   ."   `   @N  @>B@'#"`."␀!>?!P @'*U  ."   &"@' oI+  ."% @"@x 2В@@@ '"@  ? @ 2 @@*@$  㿘` 'А @&`&`  @ ;" !'!> " >@!0 @&*"!>?!P @&*  ."`  ""Ē`@ 6"."А"@@ #@%'>  >  '@#`@ 0 qp  `` *``@#    €  @ >B#>B# ">B#\ ##`#d" #h"#l"#p"#t" #x D#|@&V HH /d4 * % @  >C@&E `y 0!>C@&> h $,h   " @">C@&( p`  `*  $ H 0㿘>  H}H /d * %   H*`  `(6 2  2 4 `8*` " `"  "`  "@ @   `ґ*`H 0>  *"@ @ *`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &"> "`>? !  @% 㿘@   Ha >>>?"cԔ"& & & 6 h& 0  &  0@%@.C! 8&!! @!  @ @" !>C@ @@@" >C@ " >C        &!&!!@# !>C!@- @%7!>C! @%1 > &>"0 @{ &!>C@#!! *&"! *`&"*  * &"&" &"㿘H o*@ g@ H 0h h! 77!!+`!*!+ !@ !  77ސ 0@c7!&""&" @!3`7&"&"?* !@"! 3`77?* !7" ! 6!  ", !"@!3`: /7Ԑ7/7֒П ! f!  0" , !"@!3` /ː7/77Βȟ ! f㿘!  㿘!  S d!`"!@!! l"!  !, 2!4  6 d!  a" !€ !"?!€ !! !B h6 f @ ;6 h@Ȑ 0!>C!0@$/ !`@㿘 > ߤ#'> +>  2G!H /f * ' V* 4@s$  ""8@ <"`<<8"`8"($@+H $0,@4&0 ?6@bXH 0M@H /f * ' V* 4@rؒ  ""8@ <"`<<8"`8"($@ߐH $0,@4&0 ?6@ːbXH 02l ; <!" <㿐H /f * ' > "X@ H 0 #+>  4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $ 2  @h 0 0 $ $ $  '􀦠> ߨ# 8ܑH /f * ' bX@ H 0  4 H /f * '   5 H p@  $ $$ 4   쀦1H /f * ' > #H@o $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ( ' $ 8 $ ! $&@㿘%- 2 |   &  \ `& | @y 0@)㿐"; 2  >C!X@"  >C!h@"~   &    >C@"s! ` & , "@*`  ! :/77 ! " ",  !  " @&"㿐"X#>C`@ ;>6 h @>C!@"6  @>C!@"- 0@h0P!`>C@!@" @  &   @" a `&   & ``  "   &   & ! " " ?&" "  , " ! `" h 0@m&"" "6 f㿘!€  ?L !  !  @   & (  &  >C @!"'   >C @!"0 `&   $>C @!"H `{&   """ < 㿘>Cbh @ ,  X`a& X㿐 8 $@ @hb+>Cb,@a  b 8d6 8b @!Sb Ѐ  @A    €  "=$b  & & $  ?& "1$b , ",@ ,@b *`    6 60 /77a a  Ha " b   $b  8$6 8$b㿘H /f * '  0@&   H 00\a2@a1@5a @a@"8G 0!5@70 !6@3 0<8 48 ` E@0.@  2818 ?#48 2 @00@*B@* 4  !Ā !@F H 0㿘㿘 8!9<6`6`6`6@!d& @W  *;n # ?  @?`   @2?26 @22*@  * @6@ 2  ؐ 8 = 6 8 8<"6 86@6`6`6`㿐!' @㿐!'㿐!'@㿘>  P> baȀ>C@ "0N#> n>C   @`  ` `(@ 2 P> n"$a%!0"abؐ@6   )> n  > b  " 0> b!!%! @M #> n $a>C@Ր"0@!a"! ""P> n"@"> n"!#!? 0   ` > n   㿘#`a `  > n@  !> n!a@ " !a"  " @8 @ ` > n> nἚ   ` ј ` a B4BBBBBBB``" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @$  &` &`&` &@`6$ $$@  㿘  @$n &    "  20   " "  ` "@0 @ ""`" `" ` " 㿘!bab@2 !a@2 !?ac 2 !a@2 !a  ?@2 !@@2 @@2  `@2  `@2  ` @2  `@2{ 2 $ `@2s  `@2n  `@2i  ` @2d  $`$@2_  (?`( @ @2W  ,`,@2O  ,`,@2G  0`0@2B  4`4@2=  8`8@28  @`@@20 2 P @`@@2(  D`D@2#  H`H@2  L`L@2  P`P@2  T`T @ @2  ! @ƒa 2 !a @ 㿘 `@2  @@2 @@2  `@2  `@2  ` @2  `@2 2 $ `@2  `@2  `@2  ` @2  $`$@2z  (?`( @ @2r  ,`,@2j  ,`,@2b  0`0@2]  4`4@2X  8`8@2S  @`@@2K 2 P @`@@2C  D`D@2>  H`H@29  L`L@24  P`P@2/  T`T @ @2(   X`X@2  l X`X@2  \`\@2  ```@2   d`d@ l @`l@ 㿘 h`h@2  h  `@2 2  `@2w  ` @2r  $`$@2m  (`(@2h   0`0@2_   0`0@2W  4`4@2R  8`8@2M  <`<@2H   X`X@2?   X`X@27  \`\@22  ```@2-  d`d@2(   D`D@2  D`D@2  H`H@2  L`L@2   P`P@ @l@ 㿘 x`x@2  |`|@2  `@2  `@2  ~  `@2 2  `@2  ` @2  $`$@2  (`(@2   X`X@2   X`X@2w  \`\@2r  ```@2m  d`d@2h   0`0@2_   0`0@2W  4`4@2R  8`8@2M  <`<@2H   h`h@2?   h`h@27  l`l@22  p`p@2-  t`t@2(   D`D@2  D`D@2  H`H@2  L`L@2   P`P@ @@ x ``2 $,?7a' 7 ' 'a`'7'7.2   > ` 4 `@*`4 > ! ''䀢' @ذ 㿘> 0`B :0   㿘> !@ 2$`? q,`9 p`,`8 p  (4`4 p`$ 8> !4`6K #> #Ԁ`>C@Ԑ#>C@ѐ#8 @ p>C@ʐ#@ $ @ p>C@Ð#H p@ 8>C@#PL@C 2$ Ő@ q , 9 p, 8{ p 8 4 4 p $t $> 4 6#| +> #Ԁ`>C@#X>C@#8 @d p>C@#@ $@] p>C@~#H p@V 8>C@w#P@@?0 > # 8  ̖B`" : 8㿘H /`* !@ @#CH 0>  > (@_X> #|? c> > !c->C/>C5>CҐ > `dHM8 '  `q/  `p/  `p 7  `p`( >  8a7 2`㐖@b" @>C㐖@X" `\`" aX?"aX > @!"Ԓ@@@̒`B <@$̠ 㿘  > 1 "@W )&  @  "` `  "` *  >*`  d`@  "` ` @   @ې&  㿘    >C@#H /`4 * ! : `"2 ` 2- `   @    `   @   - 2. 2 . H 0㿘     @>  @n"& 㿘    & 㿘.`0V.`>D `   3`@2`0K     * ` 2 ` " "@ $      *  %>D)>D    2 @ݐ   .@א (8 @Ґ   倢>D 0@ɓ6`㿘 q ">D  ">D>D :">D>D@ 8 >D@ @ @ H  @ P  q@ X y p!>D `@ $ q p@ 8 (k p!>D h < @ H@ D L P X@ T>D Z @| J㿘  >D@s `  >D@m  >D@g  >D@a  >D@[  >D@U  @>D@O @ >D@I Ȁ >D@D Ё`   `X+@ *a,#a, ! a" a"!,"`X!PaP2  ! a2!,"`\  ! a2!,"``  ! a2!,"`d ! a2!,"`h R@ 2M `2I a@" 2< @27  `22  `2-  ` 2(  `2  `2  `2  `2  ` 2  ( `(2 !,"`l@ $`$2 @ ) `)2@!,"`pR <2M`<2I a ,`," 2< ,`,27 0`022 4`42- 8`82(  @`@2 @`@2 D`D2 H`H2 L`L2  T `T2!,"`t"!, P`P2  U `U2!,"`x!, a,`  * *` *`+ 02 *?0" 0  ( (2 㿈` `@_͔ɒ`6@`0P  *   2 66@ * . *  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2|6㿘&@64 p?c * 2  h6@㿈X T V@* P2 * J2 * D2 * >2 *  82 *  22 * 2 ,6@x\l @`kؒ`2@, ` 6@/ @24  7@@4  ` 4* @2  4  K *   2 5 *  2 0 *  ϑ2 *  ɑ2 *  Ñ2 *  2 *  2 *  2 *  2 4 4  0@d ڑ* 2  d22@ ڑ* 2 ܑ* y2 ޑ* s2 * m2 *  g2 *  a2 * 2 [4㿘" < `  ( `   @cV   @Y   @c]0@c`> #D$   $$@H$"`  , 4$  @$  - - -        (`4@@4` `  ` $` ` 2`` $`,` ` c  $` ' 09@ y4`  /* @@  $> 2 #> 2,# ` 444     @5 0 (@] 4`   ``- @-     @ 㿘  @b   沐 @Y  @b0@b 0 ` @͡ 0`@fM   `0&@@```` ` `  " ``@ `? ?=>(**`03 *0@.@ **`0  *0@#!  (`? (@ **`@ **` `?**`@ **``? 㿘.`.. 2`22㿘 .`  .  .. 2`22㿘 .`  .  .. 2`22X`^ b ,X , -`5 O 5 4@7@/ /܀@ 7@@$   @?@$@ @?&7@3> @"7@@c|@77@ ͑5 @@47@5 4  @c|@77@  @ 㿘>  @ i\. |`@ @"W "S ``@2L 2F   " ( 2> (  "5 ) ```2  < $6" & "%  < " T 2 T , @ " U ```2 /` P2 R "   " |  2   h  2 㿈 @v > ` t 6  2 i`@+ h %  , "    ?   @ " j  j 0 X. 29 26  22  i`@2+  h 2%  T " 2   D  "  @ " j 2   j 0 X "  ` `  `k 2 `  ``T  ` ` `  `,   㿘> !@ ] / 7  `@ @"J  "F  ``@2?  ~ 29  , " 21    X "(  @ " 2    0 h "  z x    7  x@ @ 8    "   2   T  2  x*` |2` ? 8 (2 㿐?$7&@   08`> `"`> ` @`` `   `@*`'2`*2 '@Ȼ 28@֚  28  `$8`&@h`   'H 'P ?'X''7&HR .`4   z [@ #`#\``D@` #\ |'Ԩ X@`  `#\Ԛ 7#` i  > #Ԁ`>D` @T`ʰ $ #`#\N`.`4 ` Κ'Ѐ + `77| "77 4#`#\``#DH * ڐ2P6   ؔ` `#`#\`` >  @ "!8 !`B  `B : ႀ  P X@4H(ڗ2P a 2D a ab ;Ԁ 2  `H`  4#`-3`#\Ѐ2  `H2 4#`-3`#\``   4 X%b c2`P !`  2` Ԁ 2 ` `2` Ѐ` `   2 X* "@  "@\`> X > "@ 2 > # ( B: (7ڀ`"aX "aX&\  !@ .t  !2   .s.qH.p*.r` @6$(``68`&&&6&& $ 6``6(ߔ@`68ЀӒ6$Β6$`,2 @ &@&< `  2&D "&D ! !> @ &D<` `>  &D!> `  @ &@ ` "`@ &@`*   6H6X.J&L&P&T.Z H&` ">  "> #,@  &h&d &l > ( `B :(7> "@Β   PX@8  ``  `  'P 'X'''7?T&.4   \'Ѐ < #`#\D #\ ~'Ԫ X  #\Ԛ 7#` I  > #Ԁ`i>D`!@ 4`l  #`#\P.4  '̀ * 7| "77۔  4#\#`$Dڐ2P 0  ך 'А︔  #\`#`ת >  @ "!8 !`B  `B : ႀ `P X@z4җ.`ڐ2P !`27!b 2Ԁ2  Ѐ  `2  4#\#`-3`̀`2  Ѐ`2  4#\#`-3``4!bP2` !c !` Ԁ` Ѐ̀   \`> X > "@ " `"aX "aX&\  !@ .t  !2   .s.q`.r#.p6$( `68Ѐ'6$!66(`68̀ߒ6$ڒ6$ .J&<&@&D6H&L&P&T6X.Z>  H&` ">  Ԁ "> #D@  &h&d &l > ( `B :(7> "@   `PX@v  p`` 'H` `'P& ` 'X ' '܀ :H$ ` @`? ` /  H '` ? *`  /倢  'H C-4   r S``> | `_`D``m`D `#\ Қ f5``> ^ `AX``Xɖ  O'ܣ4  ` ՚ ``> ; ``D``,`D   &``>  ``z > H * 2P```{  '>  @ "!8 !`B  `B : ႀ ܀  `P@X4H*`2P !` ܀  ``  \`> X > "@ " `"aX "aX&\  !@ .t` a2  .sH ``.q.r.p 뢔6$(띔68`듒!6뎐6 뇔6(낔`68`x6$s6$&<&@&D6H.J&L&P&T6X.Z>  H&` ">  "> #P@  &h&d`&l > ( `B :(7> "@  ܀  `P@X x`  ` ` `;& ` < ``> n `X`D:`D`#\  Z``> R `<XX `  ``> 5 `DDՔ *> `  Ɣ``>  ``K > 2 횘 `ꬔ >  @ "!8 !`B  `B : a  `6.`2Θ  !`  `  \`> X  > "@z " `"aX "aX$ \  !@ , t` a2  , s``, q, p, r 霔4 $ (闔4 8`鍔 4 鈔4 邔4  (}`4 8  s4 $n4 $ , J$ <$ @$ D4 H$ L$ P$ T4 X, Z>  H$ ` ">  耢   2 7 (> > #X@  $ h$ d`p$ l > # ( B: (7`> a  `ۗ.`2 > "@  㿐`> & @ "!8 !`B  `B : a  ` .`2 2 2+  a   P`    /-/)7 7> #|> !:&`2 `r6 `<`L`<`L@ H  .`@3 $`  @ "       `@ `2  ` $@ ,```     ` , `  `  $`` 5 84`   ` "@@   I  D  `@ `2   2   "  @`@#  @" @ ?"%A!ۀ4 .`h2` "hl "l` @ *4` @$ 4$@ @  $$   `  ,` " `  ,` "    2  ,  ,,` `   >  \ H`> `Ѐ M> H#@ ` 8 ` >  \ H`> `̀ 7> 2#<` >  \ H`> `Ȁ %>  #8`8>  \ H`> ` > #0>  \ H`> `Ā > #4@ # d ? ? ` N?"% IA!@@ C> #Ԁ`>D@!H(s >D`h!`@.`h2` "hl "l` @ *4` @$ 4$@ @  $$   `  ,` Y ,V,`> #Ԁ`( >D@!0 >Dh!`"h>D!>D!#\ r 2>D>D!!#` @`>D!@  1  @ @  2 ?"% 3 A!ۀ  4 $ @  5 @   6 #\@bW @ p 2$@@   @$   $   #`#\8     #`#\- @Ӕ  ` @ɔ  \" @`B :@\H@ B :H P`  `` `//```77> #|> !ߒ&`2 `r @`<`L`<`L`h "`h`l "l `2  *  2  +   2  >  \ H`> `܀ > #L>  \ H`> `؀ > #H@ # d@` p 2$@`@ `  @`$ ` $`  #\ ``#`|   `#\ ``#`p@  \" @`B :@\@H@ B :H 㽘`    : 0  @` `         *`    2    //7`7> #|> !&`K> `h "`h l "l \H ">  䀢 > #T@ # d    2(   @ `@` @ `    0   `=  @j     0    `#  ג `/`"(`x`#\  @  > #Ԁ`>D"(?@2  * /''S'#\X ( @h  ^> #Ԁ`>D"P`p> #/'''`0 3 < +" ,  %  " 2 #\P  @6 `Ԁ r>Dn"x 3Q *  * P/    Y> Q#ǀ :> K#Ԕ8#\   @  > #Ԁ`@>D<"/1  /0Р:7,8`7.> #|> !ݒ&`""  `r@`L`<`L`<`< "@<H9 ` >  @" <> #Ԁ`>D@">D"@   p 2@`@ ` @`$@"E``2$#` #d#\#l#hA #` #d#\#l#h:1    @  @  @  (@ X P#\   @C  > #Ԁ`~>Dz"/ /R7P`7> #|> !& _@`p 2@`@ ` @`$@:`2$ #h#` V#d#\#lꪒ #h#` V#d#\#lꙒR    @   @y  (@tX#\   @  > #Ԁ`>D#/ l/†X|7z`7> #|> !卒& ф@`p 2@`@ ` @`$@`2$ #l#` #d#\#h   #l#` #d#\#h   @  zP#\   @<  > #Ԁ`w>Ds#8/I $/HT47DT`7F> #|> !& X@`p 2@`@ ` @`$@3`2$ #l#` #d#\#hT餚   #l#` #d#\#hT锚  @  (X@@z   `>D#h@ X  //7쀦`7> #|> !䝒&`2 `r @`<`L`<`L`h "`hl "l `2  *  2  +   2  >  \ H`> ` > #`>  \ H`> `쀢 > #\@ # d@` p 2$@`@ `  @`$ +`  " #     `  "    \" @`B :@\H@ B :H 㿘\``)E * 2    277;  7`27@> `B (: @   !  @     *`  (   7` 7@> `B : @E3㿀@x * /" @_`  `8  @c 0?"`8xa  aT沔 @CƖ  ' a'ܦ   `*`@xp  , / $a`2`@`2`t> a`T "`T "`t4 `@0 2$`aPܒ @L 2  @/܀ ܀ t  @L)  ~@L; `@ 81 ` "4 `0 2 4 >  `" x "x@4  > ;cpa,  "a, > b`0 "`0`ܔ 9a@> ! L`" La<ܘ  @ &aܒ@F (-0܀   " `ܔ @BR܀'܀ 2a> a`D "`Da 2&``8 ?"`8@B5a@| p aTa 2 a沔 @Bߖ  'Ԁ'Ԑ`@w ܐ . / & &  &` $ &a 2 `a 2`a " a`a&a& a&&a `  @KY  M@KkԒ    @wD 0FAaPԒ @K Ԑ @9Ԁ 0Ԁ (  @K3  '@KE`@   ` a`" aa<`B:`a   `@@NŔ a 2&0@Aa㽈> #`Ȩ  7' ' @K< "w 2>D@p# @   7 *     7 ``B <`7  '''  // ??  7    l@ؐ #\ '  f̢ܓ2`*`"" '#\ @ * 2``7#\#` )* `7 > #`#\՘ 7 #\ ' j *ؒ#\#` ]* `Y7 g> #`#\͘ [7 #\ ' B @ f #\#` * `7 \ '@`B :@!H@ B ;!H+ s (> #`#\P 7M* `7`\' `s  > 7> !@ cਟ. ؕ. @ B *H; `B ; (  #  " t   "  !   7 c`B 7:Ԁ  >D@# `. <#/7`'P2 _ 2W `"  a 㽠> # Ȩ  7''   @I "{ 2>D@# 'U ``''/' ` `*  ( ? `$@ (/ 3* < +"& , !EB=ؓ* 2``7c  B:  7#\Ж   c Ԁ >D@# 7  `B < 7  3ѐ *  * / K : p #\ '  nĦܓ2`*`"" '#\ @ M* 2``7#\#` f* `+7 > #\#` z7 #\ '  1ؒ#\#` * `7`\'[ `s X> #\#` L7 #\ ' w @ T #\#` * `7 \'@`B :@ `+  `aH @ B ;aH s > #\#` 77> !@  cฟ. ؕ. @ B *x; `B ; `. <#/7x'h2 Κ 2Ɣ `"  a K 9 `9[ 8 `8V"G4`K  I?$`$D 06`?  =?`8  6?`1  /? ` *  (?$`$#  !?(`(  ?,`,  ?0`0  ?4`46`6" `" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @ }  &` &`&` &@`6$ $$@  㿘  @ [ &    "  20   " "  `㿐'> >D#\c   @ܘ #> c|>E#\` 0  @ј %> >E#\` 0  @Ƙ !> ">E`#\   @뻒 @#c @  c @ 0cP @ > ch"ch" > cp"cp" 㿘> > `H$"%> +> #Ԁ` >E>E`@ >E " @@h ` > ! "  (>E>E>E (`8@H > > > #pc%>E)>E5>E1>E/>E->E3>E @ѐ  "@͔@cp   @2 @( 8`@   @  ! 2 (( 8@ ǀ(ԁ㿘> !* @o& >  c`Ԁ >E>EaH@ >E!`@"@'> > #h` "x @9 x` @ x *@n #`Ԁ >E>EaH@h x>E!@c"@x> #p`  @x` @ 㿘 ! 2 , , ?%> #> ` "` "@: @la ,? $a0(&!> #>E%>E'>E`""`"@ , " >   @8> `(8@p!  @D"#x ,?$#x@U ` * `2 "` " `" hȒS =>  H !& ( `>  "` h"   "hh & h "` "`"hh `>  "` p"   "pp & p "` "`"pp& 㿘 ! > > ! `"  "`> "#l  "> #|@В0!w `"  "`> "#t  "> !@켒㿘 `'P * @`! "  >E>E>E (`8@ʔ!R ` @ " & ;& > #|@ 2 .`!@ߒ > .`!6`$> ` &``&` ` .` `6`"H&`(&`,> !w> ch ch&`h`"``"`"hh&` -`, -   2` ` @ `  @ (`` `>E>E>E (`8(@f!}2 2@; m`$' ``` ",2`@8`  @;> #Ԁ` >E>EbH@ߐ >E"X@ے@" 44 C- - 2   @ :> #9>E7>E1>E `Ԁ "@H@ ,`2`@"h ,`2 @ "@9& `"  "` "@> @ِ > a?` "a`4  4 `$5@*6`$P ``! .`!2 @`, &`," &`,`, & &@" %@&`! ¨ `,`--> >E>E`  *``$2 @  `` @ Ԁ`"H@O>E`b` ? `$@C `2``Ԁ  - >E>EbH@4 >E`$"@/4`$4  `,2 >E>E>E (`8@!? c *  $ `Ԁ  >E>EbH@  >E"@ [ !> @:&@4 > a?"a  @@'!?$!@:`2 `$ `1$ *  4    "@ &  &   @&  Ԁ`>E>EbH@ >E"@0 > @ > @8'" 㿐@` `* *`"'P'T@    !  >E>E>E (`8@" 2\,> !@  > @  @> "@ > @꫒6 cx  "cx.!6$` > &`&` . `6"H&(4`4` &,$@&,,$`> !> cp cp&p"`"`"pp&> cԀ >E>Ec(@: -`>E-`#82@22$   -`2 @    (  >E>E>E (`8X@r"@-` 2 "@ > #Ԁ`>E>Ec(@ ->E #x`@3`P#Ԁ`>E>Ec(@ >E-`# @3`4 _> #Ԁ`>E>Ec(@Ր `-2 >E#\#Ț@ʔ%4 T C@@ * @7  % " @>E>E>E (`8@"m `*`@9{ @9R   < ` @`&  ` "@" `>E>E>F (`8@"|" 6`+6`) #Ԁ`>E>Ec(@x `-2 >F#\ ( @m> "@ ,> cx "cx4`4`  $@" $$` - 2   > #`Ԁ>E>Ec(@F >F-`` P 2 @=4 h >> #`Ԁ>E>Ec(@-  >F`-`  x#\2@"T4 % ! @8     ` @`&  ` "@"36`>E>E>F (`8@`")#`Ԁ>E>Ec(@  >F`-`  #\ 2@> "@o > cx "cx4`4`  $`$@ "$ j`- ` @'# Ԁ`>E>Ec(@ `-``>F` -  #\ 3 #`@3``4 @`"``"``@"@> "8<  @6` #>E>E>F (`8(@" Ԁ`>E>Ec(@ `-`>F -  #\ 3 #`@}3`4 `""`"@> "@> cx?"cx8P$-2 @*6$P ! .!! L,` G` $@B> #Ԁ` >E>Ec(@D >F`!8@?$01 '@P )'!# P  T ! .!T !  > #Ԁ` >E>Ec(@ >F`@!X! .!@5 㿐>   ` @ *` 2`* * , ! "!P X " ! \ !" ! `  " ! d !`"  ` @"  h   ( ` $  2 @ l @   , T @`    t ꀤ` -  ƀ``> #`Ԁ>E>F @a>F@!#*2 "@> #`ԀӨ>E>Fa@ >F!@~ɢ# ! 0 L> 4`4`a{  > `! - `$2  )> >  @  > 䀦 6> (`B :(a>  "a$ $Ԁ  >E>Fa@D ->F`!7 @=2 &`"O `! pI` ' @>Y L`> a) " ! `!- `$2  ( ! ! Z)> W-`! !3  Z & 30;` `  @=  '@=`` `! )``V ! "`4` 4`J ! `E ` *A,`?  6> (`B %:( 6>  `B : #`Ԁ  >F>E @a>F@!؀`] 6``B <`   !  .`2M  㿐>   \ @   ! "!P X " ! \ !" ! ` " ! d !`" * @" *~ h " *  ` 2u!, * 2' ) `   " ) 2 (  2 (  2 (  2 ( " ) ( ډ  2 )L l " V $ & 2 V@ p " Ve ` " V5!, 2' U `  @ " U 2 T @ 2 T D 2 T H 2 T L " U T ,J @ 2 U  t "  P Rڷ 2 x 2` ! 2 k ` `P> ဌ`2 `` ` G> ဌ`2  `A> `( =>  2` 7 @2 @`  ,  *`*$ 2` ׆ 4` 2 !d`" !d{ 44 !d  @& 2 `@5  > #  B:  7 !  . 2 /  㿘 `2 @* ?` 2@`ad@ ( @76ad 6`@&@   `  "`" ` ` ?  ` @@ ?㿐> >F#\!a <  @⣘ !> &"> >F#\ a!  @◘ > >F#\#b   @⍘ > >F#\ b l  @⃘ > >F#\#b    @y > >F"Ԛb(#\ x  @o > >F"b8#\ $  @e >  " > " $`> #"## >  " #> "p""p"> ""x > #"#"> "##`1> > !> -> "t"#x%%> '> )> +> /> >& $$% %b%@ӹbX>  > s(@Ӷ>>  "cԁ?  0  ?  0  > !l`Q 0`#@&`"@I0 @ "F  ' &@ "?80   @ "6 0 @.0 @+ % 0&` @` @ 0 @" 0$`@`@ 00: @" 0h`@`@  >00$`@`@50`'@20`@,` @0`"@ #`#@"0 @0 ۰ 0: @0 0&` @` @ 0 0h`@`@0  0 @" Hg0` @o> /&@ @> @>   @@ >   `@X> `@>   `@ѐ` @7>   0@"`@" T`@>  v `@p`!@>  m '@"  @ @"  _ (@ 0 @" 20 @ p 0` @i> 0 )@٨  < `"@ې`#@>  3 0$`@ " >  %@>  ' `@`@>   0E @"` @> ` @"&  07 $@ 0: @>   0h`@ 0I @?`@_>   `@0 @"S  #`Ȁ`"`  @f > !> H $`$`̀$`В`@eD `Ԁ  >F@"@0 Ȕ#Ȁ`2 °   ">F@"P0 #x@ )> #> !,`"x!0"a0!0"`!0!,"ҒҐ ,@`x 2!," %" &"@ 2  !>  @F o!> cx  @`"4a`a` 4a`La " $aP@pa $aP`cLa  a@d $aT`W$aT aѷ `, aѱ   @>`C ?!#|`%> 3>  5> `" \| 2`"x&` &`$xH 0@  %> !,`!0"a0$`!0!,"@ ,@a@ 2!,0H /` * ! >  ` "&!` &>  &H 00>  @ 2Ѱ H /` * ! >  @`a`  `a,`a` 2a,`  H 00 n!ўќ4H 00   `:!>  @E n!L " $P@{ $PnL  @p $Tc`$T Đ , о  MKP`  "@  > > `  @ @`H 2a,`2  H 00% ,`!> ?#|`+> 5>  `,`\""\| 2`a,`"`a0"a0a0"`a0a,"@`@_(` `,$,$0"`"` 2 a,a0,$0$,a0"$a0`$,,"a0`,"`a,$a,$05> ``4a`a,` Ѳ` &H p@0> #@ )> %> ПН ,Л X `"c "` "`  "@c   % & @ 2 !> #@D m L`l " $`|@{`l $`|n `ϐ `,`X `Ȑ  `  > QOM#R#`$`$`"#T"` H /` * ! > >  >  # """】H 0@ 1%>  , X ` "`$`  "@@@ 0H /` * ! >  @` >  &``2> "&H 00"@ 2  H /` * ! >  @     *   H 00ɒlʔ Ͽ4Ͻ`H 00  `2!> #@f l Ll " $|@Ꝑl $|  ,X     trpu#H /`4* !  >  "@  > > `  @ @`4 2``2  H 00N `53`,1`X``" `"``"```"> #@ߚ'>   $$" "` 2 ``$$`"$``$"` "``$`$> "`""H 0> "@ )> %>  `"b "` "`  "ڐ ؐ 0֐ D@Lb 2 # %#&#@ 2ذ !>  @݋ ͐kД lL@ " $`@ $`` `h `0`D `h  `h  > ΗΕΓ "`$`$`"""`# cH /` * ! > >  > ## " "H 0@ w%>  ` "`$`  "@W U 0S D@ɐ@ 2 0^&H /` * ! >  @` >  &``2>  &H 00; @ 27  H /` * ! >  @      *    H 00k l$8LH 00  `3!>  @ܬ pj lL " $@ $֐ h7 0D h0  h*  ͹ͷ͵ H /`4* !  >  "@  > > `  @ @`> 2``2  H 00 ```" `"``"```"n`l`0j`D>  @ߒ'>   $$" "` 2 ``$$`"$``$"` "``$`$>  `" H 0H"@ )> %>  `"b "` "`  "   0 D@ݒb 2   % #& @ 2 !> #@ђ j L@ " $`@ $`` `~[ `0`D `~T  `~N  > ݐېِ#ޒ"`$`$`"""` 􀢀 H /` * ! > > !>  #!""p"H 0@ %>  ` "`$`  "@̝ ̛ 0̙ D@@ 2 0&H /` * ! > !@` >  &``2> "p&H 00"p@ 2}  H /` * ! > !@      *    H 00TiV M$K8ILH 00E 8 `7!> #@ 5i8 L " $@* $ ~~ 0D ~w  ~q #@q  H /`4* !  > !"@  > > a  @!@` 2``2  H 00 ```"!`"``"```"˱`˯`0˭`D> #@"'>  !$$"!"` 2 ``$$`"$``$"`!"``$`$> "p`""pH 0H /` * ! !> ?q#|  `" dF| 2`]> #" ̓H p@0fH /` * ! !> #|L? A` `p 4`"0 `q@,0 `pÖ "4\ `pHϻ`( 1 " ],.)` ] " $`dXZ`8 $`d | 2H 0 &"@  H /` * ! g x$ \>  H d@ $ `$ d$ h$ l b@I H 0 H /` * ! !> #|?Ř|` `2 ` H 00g x` \ 2!`<c6`H 0> `Hdh"@ &d&h" &h & H /` * ! !> #|x? N|  H 0- "* &o H /` * ! !> #|S? 6>  H`w/- "*  x`gP x` \ 2!`<c7$@''"@'e~ x /|x`x` `H@(`- "* &H p@0 > > "a#@]7 0@  > "a> #ؐ#g  0#`Ȑ`̒ `@]`> !&`&`&`Ѐ`&`Ԑ`ؒ`@\e 0dI J/y/x@H 7vTIB`7tH ` "Ӱ `2      ` " `` `2B 2B 2 B 2B " B " @ " H /``* !` > #|> !Ǫ@ ` p Ą 6DH~0B6F0x  $ 6FHr@6D H 00e`8b  T> #,*` "W&`8T > #,*` M&8J > #l*  C&`8? > *`#l  @̖ "2  * "+&> ("#ԑH /` * ! >  @`   :aH:a@:a8a,`2:aHH 00H 0㿘?2  @ >  < >   #|+   㿘?2  @ >  < >   #|+   㿘?2  @?0!@ 0!@!: @ 2@0!@ !@ 030!@ 0-@㗐   &&@㏐  @@㆐  @~ >  < >   #|*  @8㿘@+   ``"`  "  2  " " " " $" (" ,\" 0`" 4   "  "  " " " " $" (" ," 0" 4 㿘   > 2< H /f     ! * '   2 ,@%s ` ` && "` ?& `  0`& & H 0 㿘  6H /f     ! * '   2 ,@%2 ` ` && "` ?& `  ?& H p@ 㿘>F"x@ߖ>F@"㿐``8 ( "d`  4``  8P @G> #\" : 3`+ @+` b 2**@ b 2`* *` B 2**@ ;C3`+  +`   d 4 2   (  @^   B<    4  2 <   @(<  < <   4 `,   8`0& `(€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (㿐#> `d 2 @@`d 2@>F@"~  2  0 8 2& 8u [ @S k @YҒ 0@2 `d   @Y <`   <  ?  ? @Y< ?<  @< > #\ " : 0(@(b2*@ *@ b 2`*  *`@C+ 3`+`@ ;B 2`*  *`< $ ( 8 & 8@  !>  D  >  H `>Œb@Ő @Œ $ D 㿘 H /f4> * '> "8   Ѐ "   ` `" @  2 БH 0`>  H `>Œb@T @V 0> " D㿘 8 > &`&@ d 2`* @ *`@]&@ &` 㿘``" 0^. < @@ U 0.. p. . && @JF &6=6  ..?.*`*  2 .** *`@  * && &$&(&,&& &$ &" &  )(& @X  6 6 .. 㿘66 &`?@@>  ";  @ * @@: "/ @  &@  * @`   "   @   2 .   6 .6   @@ " 2 2Y @* @:M `"@ (@  @"@ @` 8 `<4>Äl(  2 *(2 2* " * `   *" ( ƒ  (@* 㿘`   l  l @n  @W l`aƔ X`$` %!  2 4$ 4 2 ?$ 4 2 8$ 8 2 ?$ 8  4 @   8$  ~$ 2~   2 4  2 4  2  4 2 4>"H"H 2 $ 8 2 $ < 2 $ @ 2  $>""` $ 4`$ @`$ 8$ < $ 2 D ( 2 D , 2  D 0 2 D>"H"H   H  $ L  D P  >""` $ D`$ P`$ H$ L  $ D  4   *$      *$  `22`!@:  @$` @,@&$`H /f * ' . ` ``   @``2 ` $@"  "` $` $@" "$`H 0 `  &㿘@Ԓ  H /f * ' `"`"H  @   㿘H /f * '  *``` 2 2`"  "` "@@  뀦 2`aݑ*`H 02& h|ɀ`F ` `N$`` ``@Ĕ 2Y`@`2`S 2`$`M ``@ 2F`@`2`@ 2  :  . ```@3 2.`@`2`&!.ɀ 2! ``2`@:   !. ```@ 2 `@`2`!  `8 `2: ` 22  `4`(  `8`   `   @  `< `@   `   `2  `2  `      `    `      `<  `@  㿘`S `2U `2M ` 2D ` 2;  `$ `D !   ``4    `T`   `   *`> ``` ``*`    #  2`` 2`( "    2   " 0[2 2 2  2 2 2 2@ @0>2!2"2$2 $2$ "$$$2((2 (,2(0"(  㿘> n!Ā`@G @d 2  *  "  " `2 ` 2 `" 㿘> n$! @2  @2 @2 @26`6` &`   @Q   " J 2  㿘> n!"!"`  #>F  <@͔  2 *`@Vb  ?  "@ "`"  $  > n@` `"`@  *`Ā"@  "Ą"` @> n` `! `@ *`"@! "`  " `! ` 2; `     * :  "`!  `<@  `` @ `*  `(( `2 2 2 `b``[ `     * : `B"`$``<8  0?8  ( 8882 *` *  (( 2  *(000****㿘>  !А> " d@[> "`h>F#@V 㿘>  l   @  " l 㿐0! @   !:@K  a@! a@/ !@" 0 !@Ԑa@ 00! @   ۰  װ  Ѱ & Ͱ@Ȑ  ư  @a @R   @X ' @Rْ      @ݚ  '  @ @    ' "@  <"   "` >"  >>Ζ"ch#\#` k  > @  @ޒ @ے 0~`l'{"`lI  u @uq &  &D   (:& H> P>  X>( `>0 h&8 l&< p&@ &H &L &P &X&T&\&h&`K&d  2 D H /f * ' @R @& " & @ ' H 0&   &  &  &  " (@>$   > > > # p"t"`x㿘 ` N   > `l2"`l` @2@"@`>F@ #(@r  @3 @0 㿘 x @l ^ @Q x $ 0 $ ("$ $ `2$ >  x$ 2$ >  p$ 2$ >  t$ `$ # $$ 2 @PP"@ 1!+ @4  $    <>    * $ >F#X@֯$     *  * *`" $ ]$ *  @$ $$ 8@c㿘@ 8@   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿘  @     $  7㿐 0 # (@,& 0 <"@<* "@ *`"  @*  " * @OԐ ?`$ `@ 8]< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @\ "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@Z? H`B > H P @ ; B > P 㿘]&&@`$ ]_@Y@ `"j ``2c `     * : `I"``% 0DA<`2; `6? `(`(  ::8 2 *#  ` @ `*  `(( `22   222*`*`*@*` 㿘`         @   ?$ 㿘@`  ` "&@"`` ?&`" 2 "00   "0@< 㿘` @ 㿘 @ `2`  "$"`  ?$ "`   2& 㿘>  |   "  2   @T  >F@P# $$ @OΒ `| $$ $ ?$`|@NR* $    ?\ : &  2`,$ `` 㿘 ? & > `|2 "`|@ 2@"@@ʒ  㿘`@ `1`  @,`[: .@``, 㿘   2 * 8'   8#  (@ ,@   4@>F# >F#@V @=㿘  2  @Ȑ "  @ 2   ]!$@㿐ђ   @ 8 "  0 #\   @ $   㿀`$< @@"4`" l @@" d 2b  Ԁ 2^  ? Ѐ 2X ? 2S ? @   *`2 > ?$> ̖@#h #\ #d#`@  >#\#p #`#d #l#h@ 2&`8  "?" ?"&  & Б, "@ 㿘`@G "&  `0  `0& & .` "@ "  `0 `     *`  㿘  2   ܐ  l H!$ 㿘  "  A!$㿘ޒ   @㿘!$ S    ,``" ``@  "@``$  ؀`"  `@ 2 v&  Ѐ`"  `@ 2 k&  Ԁ` `@ `& Ԁɤ  㿘` @ 㿘   5 `/`0 Ԁ   Ѐ ` ؀ `2 >F#@ǒ Ѐ 2 >G @ҿ ؀  >G 0@ҷ   ̰ "$ 0 ̰㿘`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@ & H`& L`& P@ & T`$& X@` & \@` `\ `㾐   > ` 9 5 `"``""  ?'?'?',  4%, `" ' US!  `@ р`%㿐@ "C  %,=  @ 5 @M %,! @M  $ @ $ @7 $ @L$!$>Ȕ a`#\#` $ >>>іX!`$   2 >   " $@ @ 㿘   :  ؀`" 9 Ѐ`" 3 Ԁ`- > `"`"  "`" @`"@ @Ԓ @ђ  㿘` 2& ` & ``@! 2    `$ `  $` `C >B> >  7㿘  @I  `  $  @Q& 㿘      `    8$@㿘  , @  @[ $    2&  㿈> `  #>G` ̒`P @TC  "` 2 ́㿘0! @!: @& W @ A a@+ a@?a@? 0Ba@!a@1 0:0!@ " !  @0! @* 0*@0! @  0" 0 0p00K0{00 0 0ِ0C㿘 p`>G@Ь X  ؒ @ @K ؐ @K   @  $@’  @K \ $ L沒$ P$ $ "$ @@S0$ <$ $ $ 8$ "d"` "W$ d & :  $ ,$ ,`WŒ2  $ ($ ( (h$ $W2  $ 0$ 0`$ T`  `2lW@R#而`    F $ \" H /f * ' . ` @ $ H H H H 2 H& H"@$ H P `@'`<$ D'`@@`  ``` " @ @S"H 0㿘  H /f * ' 沒@R"& & 8& "`W?2  & ,& ,W72  & ( & ( (& $W,2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@W @I+%@     $ @RA $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @`H /f * ' @T`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ `F @@ @ 㿀h@Iƒ! 4  @4  `&` &`&`&`&`&` &`V@Qi#* V&`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \>#``d#d#h⠘#\#l#p ɚ &`>G@v 0" 㿐`   @2`? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @/?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @ & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ 㿐@E       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l m  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2>G@m  `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @L & `&@͐& 㿐@    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@P 2>G@ː ` , @@?"@ H "@  ؑ* "  *`"  * " "   @Lm & `&@?& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,   ST< <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$`Rڐ<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4&   * ' *`%   @K3 & &㿘 @ΐ ` @ * "㿘   `@@Y `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h> "  pВ@ "?@  @ ?/! l @ @& l& p   ԑ* `@& 4& @jǐ l   >ْb @@㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0㿘>G@Ƚ 㿘` 2 d ` \  `q `"`&`"` & &  㿘`2`  "&"`  ?& "`@ 㿘` 2@ \2  ""@"` ?"`" 㿐@.`? ?*@   .   ` 2 㿐  + >@oxoooooooooooooooooooooooooooo㿘@`` >G! @ > n  "!>G!0@ɍ5 @ > n   ?  ">G!h@|$ @#>G؀a@m  *  @ ?>G&!@Y 㿘``: `" ` `"   2   @ _  * 㿘 < `24 `"0 ", "'  @ "&@`2 `  2 "  2 `"  *  2&& @ " "`"㿘 ? ? A ->G   "?`"   " J g2  @H" 2 ??   d D ': `    2    ': T  * `` && 㿘`D ?` $28  4 :/# 2+#@6(#1>G` "  H:2H:"(: # @&# *  㿘  ?`"8   "3  2. > n a*`  ?`>ڐ ؓ*` € @*А * *А + *А -*А /**"   А _@ *㿘> ` ">  "``>  >G "`@Ԑ" > "  ਝ㿘@8 >G@Ð" 0 > >G@Ǻ"00 `""" """"`㿘>  @ @֒ "  2  $@ >G@Ǘ"H0Ő㿘>  " @ "  2  2 㿘@㿘> `  >   #$t@     $   `   $㿘> `  >  "$`@      $`㿘P    & & & &M& & $t e 0>G@ "0 㿘  Y G㿘!>  >G>G@ "X0!@"p >G"%>#>G@C ">G>G"" @  @۔@b  㿘@+6㿘" @!㿘  > :p@"  p`   > :p㿘@  @ @ "  JK2 ` 2"  `@2@㿘  !>G@Ƈ"@ D   2@ f  >  't'x'|r/   @ 0>GW"`|#> %>G!>Gc|  | DB"`@ 4 c`| `C|@ (@ " >G&"> c@ 0@  /@x x> > "`" >   'x@  @t  |>G#@ @ @ ?'t| `|H|  & xt| a>  `>  >  >  "`V@؞>  > "`㿘N> f`?@㿘>G@̐#㿘N> f`?@&㿘N> f`?@U㿘@i㿘>@㿘>@㘐#>  $㿘>  "㿈> `> `'> > > "`# "M#`> ` )>H'> !%>H#> !> @ 9 "$@x $@u@.c">  `> " 㿘 @a@V> Mi`P@ʐĀ  >H) @<Ā (@Ȁ   >H@  `@' ` @@   >G" >H @*@to`  ȑ,``` "@#\#`#d#h؟Āܒ>H@ !㿘@Œ(㿘@‰)㿘@†)㿘@ƒ( 㿘@€(㿘@| 㿘>@`#㿘`>H! p>HaP@@4      ` "`>H[!X >HV!h`2 ` * @ *  `0 @  />H->Hx@D- 2  @  @D" 2`0  @@ `0  (` `>H@>H! @`@*@@ Ֆ?&`>H! @ċ  >H!>H!@Ă 㿘   2 *  *   0@  '>Hx@CВ 2 0 `@ ( 㿘    @   *   9 "2  @ -"@ '  02  0  2  "  02   0"   * 2""㿘 } 2@&@&`&  㿘 f  1/ '> n!*  ``" *`  +*` `  / *** &**@  @ *PhhhhhhhhhhhhhhhhhhhhhhhT$hhh0Dhh<hhphHlh<hhhLtX$0㿘J@ !> !@* "  @㿘 > L@  `@  > @ >H@+"> "``1`>!*` €        >H"@`,  >H"(@t`  >H"0@g`  >H"8@Z`  >H"@@ےM`  >H"H@Β@`  >H"P@3` ޔ  ^ >H@³"X%`>H@®"` ` ` ^8>H>H@£"X@Ÿ"`   0   @`@H "L@@FL@M6C> " 㿘N > !* ?* : `8*`>! €>@ O ->H>H"h>H"p>H"x@W  >H>H">H"@M >H>H"@F >H  ^8>H>H@<"X>H@8"`>H@5"㿘> @ >H@*"@1  @(*` 㿈@ $ @ "> >H?"#>Hb@A} >H b@Au >H  @Amb >H @@` >H"@X >H"@Q ?'@  @F쀢  >H"@@Ğ0@?'@㿘!> 耧   ?> " Ԕ 2$ 㿘@  > #@h < >H3# >   >   >    >   >   $ @ @ @ >H #@X >H# @K 㿘@I   2>H#  $ 2>Hߐ# c $ @#㿐Ӑ / 0=  >H#   >H#(  @:'@AO '@:?Hk'@? π ̀ @ݐ $@㿐 % @? !>H  u#  " @'? @ $@㿐Ґ , @?  #>H!>HĐ Hc  B#8 * 2 @'? @~ $㿘̐@h <@@ <㿘 N@  c̐ "@$c> cР c̑*`: @.@#в`"@*@ې c̐ #֒"@ #А"$#Ё㿘!> %> В ##> Ӑ"#̒ cΐ"c$$#́㿘`~>!p*` €1> > ##̀@ ( @ #̐?> > #cЀ:ܰ @J#̐ &#> > #̤Ԁ ͪ @ #cԐ? &#ð > > #Ѐ  #@nJ@##А  &# > > #̤Ԁ  J   o cԀ@ J  0> > cԀ \  > > cЀ 0> #> cЀ|" I y k 0u> #1> #̒` m J *#@*@ #@J#@J^ > !>  (@  "#> !` $ > ! '> !@%> +> )> 1> `  ? $ $  J``* @` '` @$ $ c$v%#К '` @$ `$ c %#J`e `cД*@`#cДJ  S#> !> !  @  J@ > ! > `'  `  "#  " J  > !>  '@  $  $ +>  )> c%> %#J`  cД*@`#cДJ  #$c#d"@ >H#P^ 1> > ##Ѐ@( U"@> #А ["  > !> !  +> 뀢 )> 4'> !c#Ѐ@  K`"KK@@2K> ! > `(#Д   " `@" KK"KK@" K c#Ѐ@ #`$ +@%#Y c#Ѐ  #>  (> ! *  # $Ж * $ #$ * 0%#> > #Ȁ @ݐ % ^ > ̔   *̔ 8 ̐*#Д`$@%##"@#А ƒ"  㿘@IJ> > > >   "#"c""@ @ #*#c԰"@㿘@  01 @   ) ?<, 4$Dd㿘>  ` x > > "`X"ذ > `> > X"#> ! >  > X@?J@`"؁> ! > ! 㿘> !` "`@ 㿘> !> !" "`㿘0? ?߀ ] ?Ѐ ` 0 > !  O o T  t X   x> !  > "  D/$ذ /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ?ؐ?Ѐ  ? ?  _>H0#Xx ?  ?  _ \C > 뀦 \ #S ?2,>H#x,>  X %>H#>HB? ?  ?Ѐ  _ \ :2, \2 ,, ?2,x, c0,H `??*`>! €> <   .4 0 . , * ( & $ "       <   >  >H@#?㿘> !> ! `@ > ! @5@CU @@$@א @А `@> !$ఁ㿘>HJc c#> ! %>HL@ L @ c"$` q ` ?`?$`$` $`L  L@ L 8 㿘> ! ` > !  ??߀ ] !> !@z> ! > !`" @ `@k > !`$  "`$``($  @^ > !> ! > !"""`0 !> !#> ! `@4B  $` > !` "`@< > !㿘> ! > !"@ >H@8#㿘> !   >H#>H# >I  >I >I >I  6" @k㿘!> n!耢  >I@ 0>I$!@  H>I> !h@e#>I@ p$!㿈> b> b!ܠ` 1#>I@- @ܐ`@ @ 쀢> !"( >I􀢀  >I@Ő `">I>I@ >I@ ܠ Ւ> ```㿘\@ 0 " @ ? "  " &@8  >  `& & > &@ 䀢   &"$ > `? "`>  耢`>I@x E>I@s  䀢   "   㿘>  䀢       u > `  #`  䀢 ` ΐ  $ @> 䀠     Jp"  > > > > > > > " #`" " # 㿘N> p`? 3> 5> 7> 9> >  #&` & & ' 㿘N p`?3>  ;> > 5> 7> 9> > &` '`& & ' Jc>    > > > >   " "` "㿘>  P> ba>I >I @ܔ0> !""`'> $@$@    2>I$@Ð!㿘> ! Ě @   ``+``2`` >Iđ+`` #`"`""@ !@@?㿘> ! Ġ  , @ " @8 2  >I!h@x0 > ! ē,  "  "  # " 㿐@7 > n!@* *`` :*  **`'􀢠!㿘@8 2N    @8`?㿘@ 'D @D  㿘N  %> ! ->IL : , ` ,`@`"`@8 2`` :`,L 䀢 :@6 > ! ē,`@%>   @K `$`@  㿘@L`@:L  2L@=) 2L` F>I>I!@Ŕ0!@㿐N  %> ! ->IL@ :`,@  , @`" @8 2   : ,@6L@ 䀢 :'', > ! Ġ$ @)>I'>`" `@!Ȑ@'`? 㿐> !"  `  @; > ! Ħ    @  ` `  㿐> ?> !  İ '"`   @@:` % `` &㿐 !> &@ @  &@&@> !"$ 7۔,> !"(@ (!>I %!>I!ƀ   @!>I!   ƀ`@ >I!ƀ0 !>I! @   ƀ㿘> `@L㿘> `@U㿘>     㿘>   €㿘>     㿘>    㿘>  ` `@㿘>     㿘>  㿐 ' >  '>  ` 4>  ` >I@5">  > >I@." >I>I@'"0 `@#"P ``> ">  8` ">I>I@"`>I@"h>I@ "s ` 㿘 *>I> !> !"hb,  #> @6gc h *> b> b!ܠ` #> @6Uc &   *>Io#8 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ 㿐 >I-#8 >I&#8t l >I#Pe >I#`̒㿘> !bt "> ! "btbp> #4>I "bp@\#h > !t"  t㿘 > !>I@M#0,"x @u "   2  >I 2  x>I@-#0 @*#0 @$ $$ $ > !$x""l㿘> !"x "xG "  8   @ $@0   2>I@#㿘!> !"x >I>I@#0@#"x >J %>J#>J, `   @ޘ#  㿘㿐?   q㿘㿘> !bl  > !"x > H# #> a  8  c @  2 $l> ! l㿘> !"x $ > H# "   @: 8 8    @* 2` > !""l/ 㿐N h  l  b>J  (>J (   ?'> %> g>) >J@9 8v   2&>JÐ H&$m$pL㿐`b ?`\>#*` €> ! > !  > ! > ! @u=!> &"ܐ'@k 2 / "܀> !l`$ $"! !> &"'@O    "> !l` $"  -㿘>  T`@2JJ `` `>J А  *`: ?Ѐ4 L@: @z L 2  8LN  -L@g  ? L` `>J@f  a?N`_2 @R  z$?>J@W hN s2 N?Ѐ /> ! /> !Ģ  `[  ?耢??'̠  #> !Ġ , `2  "= x* >`Ĩ!'ВɔА+ f'АԀ J@ :`$J@    8 $J 2  `> c4 "c4ؔJ@?  ? ? .J *L@    *`:  " `:  2`J 2 ` +*̐" '̐ _*̀ b`'> %>J%!> 퀦#L@   +   8 *`: ?: ?+J 2 ސ#84@t$#8-   @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`㿘㿘ДDLTT`?`>J@!(?>J ;>J 7>J 3>J />J$ 2(` '>J( 2,d >J, >J0 >J8 >J@ >JD  >JH >J\ `>J@!0&`4&`8&`4&`0 @@ >J&`4@!H0`h @@  @>J&`4@!p0> !&` &`  &` ?&` ?&a &a&a &a  &a &a &a .`@&a@ @j@h@&a0&a8.a<&a@&at&a|.a&a&a'  >Ja@0̀ "  >Ja@0̀ "Ȑ 'H€ > !> !"b'/>J->J+>J)>J"!>J a0#\@#\ata@!䀢 Ȑ@0! &aȐ 'H€ ``""!  - 㿘 &!@  d@  `H /d * % !? &!>  >J*`" ȗ*! @  >J!@ܒ H 0@8 @5 h> `! @ 6 > Z#>a  # `@ , 2` @6Ŗ   @6   @6   @6  h' @0  Ȑ ' 4 H€ 0 ̰?㿘\@/ &`@/ߒ ~ ?  &@@ 6 ( @**@``$, @@/Ð 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@/ 2(`@ * %`*`$ p``4*" &``  &`(`@ *@`2(㿈  >''H'@ >J@! 㿘` ">J  ">J >J">J>J ! ""@;">J@Ő"8 㿘 0 4" T &@ L` @ &`   @p &` `   㿘 4 P  0` 0` @q 㿘?2  @> ! @ +`@ "- ! " 4'  2!"  `$!`  ``2  @@}!? $!@\!㿘     0    0 @@ 㿘?2  @> !b   b*@ 2!&  "!!   `$!`  ``   !@ !? $!@!㿘?2  @> !b   b*@ 2!&  "!!   `$!`  ``   !@l !? $!@Ȑ!㿘?2  @> ! @ +`@ 2!'  "!"  `$!`  ``2  @;@ ے!? $!@!㿘?2  @> !b   b*@ 2!"  "!   `$!`  ``@R !? $!@S!㿘?2  @> !  `  + @ "$?! "!? ` `$!` ?``@j?!? $!@!㿘 `$ @' @'  ? & & 5L&  . ;@& & & & (& 0. 8. 9. :㿘 4ِ h  =   t x 0" Ő &  "  = "     0"  `` ("`Ȅ8"``""``"```  "` r `< n `4€`0 f&`X&``&`d.`&`.`.`&a &a(&a, `<  .`< `<` .`<2a> !&a&a &a &a&a&a&`&`&` &`&a&aa >J` p>J@R"H&   @'a'a 'a'a'`'`'p`'|`'t'x&`l&`@ o "  `4 @`0&a,.`<.`=㿘H /d4 4* % 4 4  !, " 0 =  0€ H 0㿘H /d * %   4&!$`4 0€ H 0㿘M ߀   4 l 2.L`9`` `@- $`" @`:` H /d * % `$`$`@rH 0 >L`9 >J@"h,`9`0 H /d* %" >  d+>J b*`" * >J!  % d! @ !`% d `0 > H 0㿘> ! ". @ 4H /d * % ` 쀢 " !,  40,@". 0@ 0.  `&  퀢 " N ܀ 2 4U 2  4 `" 4@ 0 4 ,@ 0.  @ 02 <` ` < = `. <. =`2 <`2 &!, < = `. <. =&!,& XH 0 㿘> !" . @hM ;  , v = s` H /d * % $"@  #>J6b`>J!  $` !  @ `$`  )$"@ 倎H 0`*@:$@$$`  0H 0 #H 00H 0 #H 00H 00}` z xH /d * %   (!>J 쀢 "@ Ҕ"`>J!  $` !  @ `$`    ݪ  - 9H 0  ""@@& `*0@ @@ %@ H /d * % % % - 9H 0`  㿘H /d4 * % 쀢   `  `@ & ` 4 0@ 0.  퀢  d  d@ & d 4 ,@ 0. H 0㿘  4`!   h> !"|2@@-o#2` 2``22 ` ?€ 0$   >@(  U        ` *@`0`*@`4*@x! Ȕ `  @ 8  8@~&@`  㿘> !" . @L;  `    $ ,  =` `&`@ B >``23`(`. 8 ` <`B#&`>`("$(``2`Ͱ H 0Ű #H 00>J@ ",9 `  H /d * % $  !>JӔ"d>J!  $d !  @  `$d  $  ,9H 0$"@  " @#F@#B@&`* @~7` $@00 : H /d * % $$L:`$ @#% @#%  @)% "@ ,:,9 퀢  L8 @!`H 0 `  R㿘> !" . @  4@ )!@ " @ "V !@ 0@"  !@ " 8!"!@"!, @"`\  b}@"+ !@"`8!@ "!@ 00!@"b~@ٰ 0!@0"!@ 0΀ "$ X X "$ Xư  H /d * %  " =H 00  퀢  ` @w  =   쀢 `@FH 00&&H /d * %  &   l@+=" & t  |$ "@ &H 00dH /d * %    "   @@ :  &   @+" & $ &H 00=<&@7@2g -``)@ 0% <&` € 0&`\@ 0  `<  0€ " $!,02 0@ 0&㿘` L @` ` d@ @&@@ X " @y8  @U 㿘> ! ". @H /d`* %` `" =02 = "$ @ @  H 02# @L0  Ā@ H 0  @@H 0 㿘> !" . @ 4\@ 0 "4?X  @  *?L ; 2  0 , ;   H /d4 * % 퀢  @4H 0X 0 @㿐 4`d !#\`d> 0" t x l >`( 0 t@ l 2 .  㿐N ߀ 2  4  @6 4  ``  #\``> 0#d    >`$d 0 @ 2 .  㿘 <  4  @%   $  $ !@  (L ;@$ ( ` > $ d 0@0 "$ L 9 "  x, : @'$@$!@ gL 8 " 0 4 $ 4 $ 0!(@ &!( 耢 " @    " @   @ ( "@ * &    & &   @@ :  $  $@ +$  耢 ! @ @  #@@@  @  ( `@" * &  ̔  `& &  Ĕ ` 2 = $> 0 d@ " =] = "!,L 8 2 !,   4!,7 !,  ` - 㿘 < h R 4 @$    $  $  (L ; `$ (`d <> `( @ 003 L 8 ` $  4"   @ $ 4 $ &`dL 9 2 `d 0"   @ $ 0$ $ `d  `(>  0@ Ւ ``   "`2 ``+  "`` 2` "`` 2` "``>(``"`  `   㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 㿀    , &  :  @,ِ" & : @2` `2'g [ ,'`4 '`D`0€ R` H`$`4  耢@2  ?' ΀ 03 / `4 '`D`0€ (` 耦 `$`4 "`? 'k "` "` @K㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && p@ '؀'`z ''іr` /' 4 '`D 0€ b`  \'`$`4  耢@2` ?'؀ Hؠ A 4 '`D 0€ 5`  '䀤@ ''" , `$ 耊 `4 'zЀ ܢ`Ж  ''` , ` @'@'؀  &.*`&@*. @& @"@.㿀` 2@J @F ` '> '  `$`0 2`@ 4'@ 0"` '䀢`' `$ @@`'耦" 4耢 2 4  @€ 0 @>㿀@"/ ` '    4' D€ 0   ` ```"@`0 ``@`H`4`8 g ` ` '` '`'a'a'a'a 'a'a'a'a@'' `쀢? `' `8?"` 'Ȧ ` ?" '  ?"`'̦`?"' ?"`'Ц`?"' ?'Ԧ Ȱ  {ఒ    ` X  ''ܠ   ` L  '' `?`2`?`   ,`= ,`= `=` a,  `,`=\\@`0 2 `=  ?''' '2 `=?'''' `= `0@Ȱ Ȁ  ''' ' ''''$a$a $a$a$a$a$`$`$`$`$a$a``l " `  `? `2``oat b ? `2`a0 S `?at`  B?a0 1`3 at`3   3 a0 3ِ `p?"`0a `4`s '''/@€`0 `0 ` "' 0,``0 2" 0 `퀢 2 0 `= " 0H /d * % H 0  0 ` "'`t,` 0 2"`t `쀢 2`t `= "`tH /d * % H 0 `t?`2`t`t      ,`€`0$`$`l,``?" `=  Ӑ `= "``@`0 p`"C`xH /d * % א )``l" `= `=   `퀢  Z  `=    `쀢 (H 0 .`x? ` 8 ( `(Ӑ $``|  `?8`(Ɛ $``x?2``|?  ```Đ" 4$`İ 㿀4 `8v 0&@&`8&`$&`$&`  B$ t$=&`@`k$&``HE`@`3"&`p4  '''D€0 2&`p&`p &`$̐" &`("@$( &`,$, .`0 ,0Ԁ@ .`1@ ,1,2.`2 <2  .`6 < `,6 .`7 ,7&` h$ &`t@i&`x@e&`| =&` 㿘 \  \2  &@b 0 2㿘 \   @q  2 㿘> !" . @֒ 㿘> !" . @0!@ + 4 ! !@ "}@  0:@"0!@ 02    @`  \" "$ \# `8&@`H`D€ 02`@ € 0  `` @ 0 > ! * R`   > !"`8P> !"`8D"`J@8#* *`  @`.#> $c< @`( c<%> 퀢`$@ 2> !>J@#c< "@@aԒ @  @aΒ 0"#$ @@@0> *` * < * $ >J$ $ cH@ 0  * * @_    $    a     @$@\"$""`  `@_˔ ` $,$` @@?Ē { $``h @@ n `  2 `  (* @@a]  @aZ  O ` @"n& W:$`$` ` $ @ `   `  &!: @&`   % `"`   " ` @a$  @a! I  "1 *`  * @@:$` `* @ *` @ *$`  2 ` @`  @` 0"` @`  @`  &$ @" (' ''  @!_('    $ $ $㿘   *  @_@&           @^ $ $ $$   "@``  @ a$     * @^ $  *`  *  @ " @:  *"<$ @ِ$ $   *`  *   @ " *` *  *  *   ,`: " ` *`  * *$%$ @ ͐㿘? 2  @> !#$4` B * *  > c<* @ 5 `   `* `@n`  "  @6 ,` ` " "  $ $    $ @ɐ㿘?2  > !#$6  **  *  > c<* @ " "      **@$  **@$    @ @$ 㿘 D? @2  `@3 * * > c< * `2  < 0  <(& 4& @& 00% # `  `@X  <& @H /d * % @H 00H /d * % @H 0㿐> * @* @` 8@p `D ``T *`@`@    @]*  @*``H` > H# "`< `<0#\@I)`0`\`t "`t@?Z `"$ 0@2 $  \t`"t@?J $<` @զ  @%,`"  0\`t "`t@?,  `@ ,`@^ 㿐`\ ` `  @      Q& @א`@#`` "$ $@ *@`  3  :`@ * 2`@ @:`2`@ :` *` *  @ * @@@#- @*`  2$"* & - @   @\ @5 > H#  2 @\ $ - @" $$`0> @a&0&X`,@&,&T&D&<&\&p&t@&x&|&H'> n#> !)>J@`<  $ Hc( $c(#P @{(  H $ '` ; 0@6  @\[ @ޒ > Hc  2 @\P $ @    $$ D$ \$ p`% *` *  *  *  : '`$ |<'$<!> H# H * @@  8*@&8* "*` " $㿘> &"䀢`>Jc`@  `0("`<`<&`@`< 8`@@" @ ِ㿘 x> -  t* <*  < `> &"䀢` >Jch@  0(` >J #x0($0 4`" >J$4#>J4# |@R 0`(   @ 3> n/> !> H# ,` ` H @Ǣ*    @  b@ H( b@|7%(  @]S <@]P @@(">J@#  $@- * <* @s㿘? 2`  > !$2  * > * < * @` >>j! p @_ 㿘? 2`  > !$2  * > * < * @` >>j! p @_Ȗ  p? 2  @> !#$4  - * > c<* @  "@"`  m@"`e e@7 0  h@: 0 e`f@ `g@=0"@ ` | y @Z t> H  c ''`'a:` @ 耊`"`'  @ZΑ*   @Zȑ* f* I#  @w " @8 .` ` @8@& +`` ''' " @ .` ` @8@& > * <* @@ Ȑ@\3 @\0 @0> #@*` ϔ &!> n"` `&耊  `0> :`p#\ܔ @+ $"`0$``@`8@U@Ր԰ ϰ @ ʐ  `*@  ` " `` "`@  %> `8 `  @8`  @[ְ `*`` @ "``.@` @[Œ `.`2``@[ `@[ `@,  ?@$``@[ @ @[ @@O @H/ /@h@a ȑH 0^ ` I`0!U ` @ `&`*`` H&` 4C @$ >`$`` @`İ 2`@2`- ?`5# @ `* * >`a@`İ` @$` " 0` 2  `$` $`  㿘!> ߢ"  ? @2  `@ `2`*` * >  <*  `2 ?+  `?b   ?  @'''''ܐ @6_ 8 D   @:`@@7  ) `@@9"P   @:u`@@7  0P @:g &   @:a`@@6  㿘? 2 @4`,`* > c<* !@l@i"  $ < $ ($ ,$ 0 $ 4$ 8>JcȔ @  4 >JcД @ . 4 H4 J$ X$   !W $ 4 $ , $@p,`?`6  @  .  `4 * >a@E @㿘  * >J c@ 㿘  1>J @$ !# @w@ "    @   $ 㿘  `@&  ?& @y F\FFFFG$G$FGFdII`IpIIIIIIhIIIIIIIIxIIIIIIIIIIIIIIII OhOhO|OOOOO㿘 \ @  *@E cP?   h ` ? 2: \ 2  3  X* \  * \`* h> ! @ #T?,  \i  h @ 렄? \ `*   $ \ h `@> ! \ `*@&㿘 \ D ` cP? =  h ` ? 29& 2  2  X .   \`* h> ! @ #T?,  \  h @ 렄? \ `*   $& h `@> !&㿘'>   Ȣ $@~(ᠤ8 8 $L,`  ` "? `,` d  6 :&%L& * \ *@ `* h*@ t h *@ `@㿘 \ *@! \ * `a*@ d"* t @㿘    `@@"  @c  @D㿘 `" @   & %P 2   \  ``*z%P &%P@= `@㿘H /d4* %  >K@| @0  ` >K   @s h `&  2   $L * *`@"  @H 0㿘   ` `d>K@ H /d * % `  >K   @0 }  >K@   Ȗ    ``8`8, $ `4`#   ?# #   #  $# # #  Đ $ 2$$H @    >K@b!H 0㿘 2 >K@R!8 2 >K@L!X  @ " >K@?!p ,  $,, 25    `%` `>K!   # !$,   >K@!$,$ & &  $L *`*  '"  $,>K  !@ $, 2& >K@! $L *`* @" @|Ӑ $ Đ& `@$& 㿘  ` @ " >K@א! "$H>K@ѐ"&$H$ *" *  О @ Ȅ$L@ " ?- ,@ `Ȗ 8`8 К  2@    `@0& @t -   z>K @"( %P` & p&%P, $L"&    &  `& &%L&%P&%T&%X``0  >K"P@ $, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  >K"@ђ &  "  "    @& € "   `" @   >   @3# @{ƒ @O "B 㿐 " h>K@ " > !#T @`>Kk  h ΀ @2b  X  2 >K"     *@" >K# @e 01  \ *@#T+> !8  h "  \`>K#8@L  \* h*@ t h @ cP?   h ` Ԕ? >K#`@- U 2  >K #x d* X @ />K# @ > *, $L0>K &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `@ y 0*"Ȕ@ 0##@ْ    \ & *@   ` &%L&%P@ d *@ h* t h @* ?& 㿘`  `d*`\*@``*H /f * ' `X *@`` *`\ $`\r `\? @ @ j `\ @ 2 `\ *@a `\ ` "``*``*@H 0ҐT *`h*@H 0` `X* *`\*@; `\ * 5`h @'a?, `h `@?  `\*@ `h `@2`\`d *@`\ *`` *@`h*`t`h @*0`\ *` ```` $*@ 㿘   d * \%L @ %p:" ?& %h&%p  h @> ! ` #P? ֐  h `  ?   2   2 l ` " %P 2   \  ``*%P  `&%P&  2A \`$ X%P 2   \  ``*%P  `&%P*& > ` `%p*  &%p%h (: ``27 ``%h ` .`$  \%h %i @$ ` \* h> ! @ #T? Y  h @ Ơ? 2 \ *@g `` 9> #*` €]%P  %X \  ``*0%P \5%X "9 H \` ` B %  =%  &  8& %j   >K#@/ %P>L @) %P 2 %P \  ``*%P \ &%P  `4( %P ` &  \  ``*%P &%P \* h> ! @ #T? Ґ  h @ ܠ? 2 \ *@ݤ㿘 d   * \  *%L` %d%\@z"%P%T &%P&%T%P%T  *  &%P&%T` 2&%X>  *` € 2 >L( P :     2  .%\       .%\ >L @  .%\ >L @  %]K&%d `@N> !#PW  h `  ? 2> \ 2   28 \2 %d%P 2 %d \ *@7 %d&%d > ! X *@ \*#T(  h ` ?  2 \ *@ `4 h%P o` \ *@`"㿐   d*` /  *`// ///    C @` $ , %P`  &  \  ``*%P &%P 㿘 ` @`>L<  d*@4 o j   `> !c,* @ >L @̒ 0[2   @>L!  4` ` K  h  h @2  ; >L!8@ $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*T%P  $%P㿐 d  *@   >L& @]!X 㿘 2 >L@Ɛ!p2>L@! m  h @ @>L@C! % ,X` @> !` #L'>L?  C -  d h ` ? h @2   >  ,  €-/+'/#>L"0@ %P`  &  \  ``*%P &%P>L!@ `&%L`") l   @ "   &  @ t `" l%P    \  ``*%P &%P l ` >L @"X%P`2 %P \  ``*%P &%P`^`` >L`& "p@ ```  `>L" @ &  % (`4> ! h `cP@Y  h `@" \? >L"@l  \ * ` *@ d`* h* t h @*  &%L&%X& & & & &%P&%T㿘 ! (J @> "  @I@`@  0@c! 1 ` "` $`D  "@ $ 0  $ $>  H@V`,   #⬔  @I{>L!  @n1 0⬐ @Ik  㿘  (j @-  b~@ b}@#k@% " e@f@"  #m@"l@  #g0#i@0#h "  @ > "  @I$@   @ِ    cl@"I`$ce@"+#k@"T\n cf@4cj@c f #m@@ #g@+ Y0#i@.0#h@% N⬀  @ے> !#t`@>L>L#c(@d9@4 1$`$@,@'@"@ "  " @ "`@`&d& $\$d$`@-⬐ @H 㿘` ( @j  @H@m @@ @  @Hv   -㿘 (@K!> "  @Hg@N`," `@@. @_ `,2`@!> ` "` $`D "@ H@ `@2`8@\`8``` "`d@J`d @D  @H) (@O L& ( 㿘> " >  (@H 㿘> " >  (@H 㿐> >L Hc8#\!P  @" > >L#D    cH@#\> >L (X $ @Gט     㿐#@P  L @M h h@Ԓ >L  X@G $&`,`,&`0&`@`@&`D&`8`8&`< @@Wo!: 2  &`P  `&`T @3l&`X @Or L0 2` 2 > !#X""`(&, ?",`0?"`0`, @n4`0 㿘@n-@  㿘@T   "    ,@ 㿘S 耤#> b  @GjQ?@@2b @G]  ,B ,*@& ,㿘/ 耤 > 3"   @GC*@| b`4@ 2 >L@7#h`" ` "``4@Yb @G# 㿐`    0 "  >L>L>L#xc@"  @G`P "`, !``T@  `X `?2   `2`  ` `-  @ +-`T@q # `耤  `T ( 2  $ T *@N} L$  ?$ $   T@,  `  @F X``,a`耤 K `G`P Ch`耤 " ` $  ?$ $ `    @Ft[ `@$ @@0NB``耤    @FW>T#\@03㿘> !#t`>L>L@#`@Βc` ! ` ,@ @ ` 6 (`*` 6 * 6 *` " $ $ & $ $ @l& $㿘@ "$> !  > ! Z> ! #t`>M>M` @` `#8z @W 2 s 7p&`#t`>M>M` 0`@x`  8 "c ` @   "Y   2 "R `@ "L  "`` 2C ``"&`@ڐ&`   `5$ ` 1$ #t` >M>M` HV`` @8V` ` 8#  8 " ` @      2  V`   ` *@   $2  "  H1` 㿘> !#t`>M>M` h@`p "> "``  `2` & \ & ` & d` $ @ ` $ @  p> !#t> b  >M>M@ ``@``   " ''  ` :` `?''ܒ''''' @A<ذ`"@&`㿘> "@Q 2`,/ + #`4 4@$ "  `    2" `4@T!: `4 2> !l @ 㿘K @` "`@L L$` ` @0  a` @8'  `  (  L@J#$` #` ` ;c 2 ` `  c&` @LH L$` 㿐6`  `@q ' @p*'-  `@6  2,` &@  ,`  & - @L  L% 㿘 ,   2   㿘> !#t` >M>M  @` ,*@","  $  ?& $@j  $ "  ` "` $ D  "@` "`$ 0 " 4$ 4 `" @ "> @K L> @ H㿘`? &` L?& L``"@`@K L@``"`& <`@"> #D@㿘>  H@ݒ  @!P`4$ $ $ $`0 $ `0"@`4$`0 $`4`,&`@ &`, 7㿘 L @>  P > #D@ > !1 #t`>M>M ؒ`@.` L&& & & & & & @I~  & @&  * `@&  L  H`$ L&  $ H& & <&  <"@$ <㿘6 &`<  &`@`D @"@ `?$@@; 㿘\`<&`<7  "  "`D @"@ `?$@" @" 㿘``<   .`< +` +` +` +` +` +` @+`㿘 , 0  6 , 2 & 0"  "? - 2  $   & $&  D &  D"$ D $ & $^ @B 3>M!> ߐ! a @g " 耦 "  $  㿘>  @~ H @”!P> !ct  >M>M`! a@@N $ 0` 0"` <`?` 2 "@$  D $  D"@& D 㿐'P@ ݒ" "@ P  !H@֔  !H@5"P!H@n"P 'P b㿘 . * *  @Ho  >M@!x0@> > !"","cx㿘> !#x `2` [ * * >  b,* @ N d 2 d$ @F   `` *  4`2  `   02`   *@$  $"  `*@ `"     $  $    @ @$ 0@㿘`!@}`@z"  d"$ ($ 0$ ,`@ & d$ 4>Ma $ 8@  4 >M a@ `Đ. (4 H2`  $ <4 J$ X$ $   aW4 $ $, @t6   p4 * >`c@Z 㿘> !#x 2` **  * >  b,* @t " "      **@$  **@$    @ @q$ ` D> `2`*` *  ,* > ` b 0 (& 4& 0H /d * % @EH 00 T <: & @ 0 (& 4& 0H /d * % @%H 00 D  ``@  2 DH /d * % @H 00c D `(H /d * % `& $a$``$aH 00CЦ  D` * `@ H' <'''' T: * 2* ?''`Ȓ`@&B`h$` 0 '``@& & 4aH " H <   T`aH  H <  T'`Ȓ`@& & 4aH  H <  T` $``@( 4` 0(& 0& @H /d * % @pH 0a H /d * % `a $?$`$aH p@t D` * `@`Ȧ  XD`L, 4 0,  @`@ H  =`'Ē`@%=@`ȖȐ @'Ī`Ȓ @'`Ȁ?" @o`%Ē  *  x@F" ̖"0"< 8"4"8`<? ?` "D"Dȑ< @"H"T ,>̐# ","X"\ `"` d"d h"h l"l"p`"t0"4("0 @%"@& @H /d * % @ǐ H 00%"@H /d * %  @r7`a`Ѐ@`$a@H 0 = Dh@㿘  0 $@s}&  0@ \`t "`t@'㿘 t>  D 2 * @*`@,*` > &"䀢`>Ma@  4 "  < 0h$ 0@4$ 4 < @ " @G:$ @ @ < "@@Ya  `0@s[` "a0?$a㿘> !#x 2`@ *` * >  ,* @` >>j# p @I 㿘> !#x 2`@ *` * >  ,* @` >>j# p @I    2`@NÒ!: U> !#x 6Q ,* > , b* @   m@"0e e@ 07  h@ 01 e`f@ *`g@0"@& `" @  @  @'x'P't'T'|P @! " @0@$`  `@&  @`&  @&`$+ 3`  $ @ 2  & @D A    `@"@{0ʒ  @D H$H@ӟ@ @F? $H@Ģ  * 2@ * > $@>MaД@%> !c|0$@q$X@@F   @"   *@     @+z @ݐH @H@E @qݐ0H/ /@@!PH 0Z $S|!Q $J &*`` D&$>? @А :$ @ 2@2? 2  @?`4 # @ `* * >c@7 ~@$02  " =$  p> "@M$ ̐" @C  ą* 'Є" Ȗ   ?''''''`@#  ̒ @#Ô  Ȓ @$@ES > D`8t  "  Ѐ " Ё㿘> !#x*` > * , *   x@x!P* @*`@b,*` * 㿘> "  Ȑ ?`& >M@X! ̐ @!M @M & & & ́ 2 > * ,(> !x(@`2`Đ? 㿘 1>M @$ !! @a "    @   $ 㿘 `@& ?& @cLT㾘> b o "b@QV>  l2`8 @Ho o>  a a?  *a a` `,a @ @  a  ,a @ a,@ a,@ > h( @ <CB8 ( 8(H 0> > "ha#`  (  B8 (  ( (>  *` *> "@ "4@i?*`>  㿘> !!> !` +!#! h !+!  + ! +B; 㿘f%> > !! !`*!"! ` h ! `@ *! `  * ! * !` ! `*!"! ` D ! `@ *! ` (* ! * ! ! ` `*!"! +` !@ `*!  * ! * ! < ! `*!"! ` +` !@*! `  * ! * 㿘> b0 1 !>  h> >#"La@h> >! "4@hcT>   @ @" $ h $`> "h"@m">  @i$> !  *?I  $0? 0     㿐> "0`Ā > .  @ . @P`  􀢠Q@` `" #@ `& & 4 4 :?  ; ?#`: `: `:`:2`> !> !c ㄐ" :    0 ` > hx`B i:x$`$`$@2 > !> ! Ho o>  :<㄀    > > "h pB: pH p@0;" " "" "h ` `(`B ; ` @〒`B  8ㄛ. !!   8@B 8B :  >  h`  > " @g"LH 0㿐> @gݐ"L> hh`B :hHo o-> )> !r/> !' 'H 0 %> h>M "   h" @2 c* $h ) 1 #* g *  * # +  # * @ (@ @ @ @ * @3@ $ ʂ`h @B =h  & &   `   @a&& !> "@ @- Ho o# >    @ <%#%#2 &H p@ 0 > `Z h@:H/` / @? 2`,"@% % H 0@\@ X耤/ @ ///   @/// /r$ k $ :`h@~ > "h .`@ C : `   ` @8? @2 `e>!!l*` €^ > `h  U #> h X> ``C :X>M t8!  @^p @  h 2`@8> h`B :?#G- `,`:`$?#?c,`,  $  ?# ,  0    ?#@S ` 㿘`` 0 >  l`>  @˒b R`   > !> "`8> !> "`8> h"`   `2``"`H  <`" `@ H>   `2``"`H  ? @ `2  2`y  t ?# @8*`2  @Rܔ Z?` , *`2 `*0` , 2 ???%> h>M "  h" @2 c* $h ) 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * 3@ ?$@ ?ʂ` ?` ? @2   > ""㿘 @"@% "@ "d 8""@"H  @"v   "@"   b~@b}@ @Ho o>  l&H 0o!:@G 2h Ho o> `h`  "`"`H 0Q!:@G 2J H > "`lH 0;!:@G 24 >  l`?- #H > "bH 0!:@Gr  Ho o> "h@C"H 0 @    `  ``\ ("  `X8 @ "8 "" h  @ ''?'  ' '"  @a   X <`"?  А@} \  @T@/  @ @z 27܀  @ @g܀     @x `T @܀`   @c @g "!T' 'M =`?'؀ Ԭ'̀   (`"$ , X@@$ ,  ' $ , :`   @_ Z> b ` ' "` X' ,  " ,@ , :   @< 7 H ` , *s ` w  q `  !@k7!T "@ ` `ؓ2` ``?@UԀ M ."!`򀢠6 M`! @pM`! m; ,@`!  ` @`T*  ,$'2/$ 0! , @T* $ 0 0@2  @ V  ,$ , , l&$ 0 ,耢 B :@:@ @@;`   @  `H$$ , ( ?7$ , "@ @@˔̀  r p?@$ 0䀢` > b ` "` ̀ ,$ ("( 0@ @ 0@X@ @ ј `@0?܀ / ,@   '@H0/   @@@4"X@ @ @ ܀  @ݒ "@@@V 㿐  `@ `?@L @ '` H @ & '㿘> a>  9 @P@> > "bD"H 㿘> "'> %> 6` @ D*  "  @2 2  `@` 6` 0 2  㿘 >  2 @> @D * > ߀b 2  @2 22"&& # 4 @4    2   " "㿘 > ( c    D >M"@ $ @' x`@t  㿘 > (c    D >M"@ǐ@ " @$  @M@xd#@2 㿘  `(@`$F`0`2 `,6  /,@ ` >M# ` ! >+ x*` €  $@ `$@  `@X> > !h a  >M@x # `,``,   @`(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N >M#`  >+ *` €  > > !h a   ?>M@wؐ#@`,``(@2*``,2`@  ` `(&``$""@&`$2`$`$&`$ `  ?&`㿐>M `$* * *N !   !`a`  #\ `$ `@`(0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`h  @Q h  @`` @ h l" `" d  -@ؒ`p.` 2  "@@2`h  @+ h  @&`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@M 㿘   ( ``. `.` (. (? 07 ? 0?@ . @(@@ ` ` 㿘 `? @`@&`![㿘 . (. &`` / ``..> >`  .  (.&`$㿘  2-    2% ` 2  >Mc` @m 2   2` >Mcp@`  >Mc@Y  `" =&`㿐 `!`' `!a`@`2`  *` * + `  L "\`!X  ?#  ` )&` `  "`L@L@2 L`L @2 €` 2  ` (`@`: `` ,`) ``! :` B8 2  + ?@J  H`` @ @  2  €   2 ` '> !''ܔ\X6  !` x`!7'' '''ܐ !@K> " ` Ĵ ?'Đ8`$  7> "'6'''Ĕ'& `>M# "&a\@h     1&a\@_  2?"'> "'ܐ"?  *    ? * 㿐Lf ;) ;Z  А S, * @ ?Ѐ –.`@*`@ <$    ? ,"@ *"@  " . ; 0`;   ??? 㿐`\    =. `.c  ;` .F6tXtttt > "> `a> @ɒa(  >M> n`#> @c >M@t#09>N>N `@ 1c'@   ?"@@6 0> $" "$@  #`$ "@`$"`@ D@@A    q p  <`@| @   @o @&(&&$&&,@0 d< "@[ > Z `܀& @Q ``@ @@! @,0; @ߔ<@@2  @1  @ ! Y Z`@$@  Y `@ے$@ L p@# D0@]㿈   '`< ''   'm @$ h@ > # _ `@  @ T耢   ?@ I0c ?@_ 2'   (?@ >N H` @e  2   " 4 :0 - ''&l 'X>N` @>  " >N`(@6  " >N`0@.  "   2  @'c @'? * b> ?   9@3!d@!d$`P ` `+  P* `@ @ *@ $`a( "  +  *   *` $aL ` `+  গ* `@ @ *@ $aP$`$a`?$`0`%0@&a&`d` `< &`h&`<&`@$`$`$`  " l`2%l aL?`* ` @"` P5H $aXl l ?&l`0 "`0@P'l  $@` $aT $aTaT #`!a(r "  *  *` * $aL ` * `@ `* @*@ $a`$aP0 &0$ @    @ @    耢   @?`@4 9&a㿘@⃐($`D   '>N,($`<$`T$`0@8$`@@@a I`H @  B > c$, 5? * b ,( (@쬔  8 @쨐  " "   !W<  @&&&.6&&&&.&@_!6 `0 $`0@ 㿘6` @I a   ?# @1 @\ @4 9`<*@$`<$a㿘!!(!T `?@I -㿘! D @ &`&` &`&` &`&`&` `T Z `} Z!Lay p&`8  㿐 `` & x` &@ & F㿘 @ 㿈! &" > "P @Ė  & :@1ϐ @R >N8 4 @+ "`$$$  @ "!2F'6@ @P F>N H@`!  @D F>N p@q(0ے , ?@}  @4@ߺ>N @q0 H @ @@# " @ߥ >N  @p@  F$  @$ 6@$\@ߍ     @0 H   * *   *` $T ` *` ` `* * $X @ $\"<T ' "' ` *@ :   'w쀢 " @;ɔ "x@0x< @ > (#x2`  `."<>/ *` €> "T#"`8> "L" 8@ > `$ "`" 8@@$ 'X:  @S TL@`@ "`@ &  2@ "`\"`㿘!@`  `0`4&&   dxx LXdd `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < >3(      㿘  x /| @[ `   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X :`< `X .  < 2*   @0$      $?'''''''''''@i耢 А$ < @1  $ <$ @`$ `X :< H <$ 㾈    /  6 @  0 %` @n `  `  "@ 8 X  @:b    `; { ;  > H (# > H#h`( 6 ?;`#\#`@h/ $(  x   `` ` ` X*@@  ?#\#`@z?@V&`@$8 `H@Ct`@  X : @   `0 "`0@v    2h`㿘 0"z@"      @    㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @C#0 2>#8 㿘"" N" =`?  " !!? 2!@S ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#" 㿀#P`    @.' '쀢 ,!, ,",!, $#0 $#D  2 '* @. $#D$#H $#@ <#(#,     @02 0 X#(  @  "#(@ܐ#(     H ` 8#(  @ @ 8 Co<#(` ϐ  ˬ `!@,"  ے$"T* $"#(  B<#(!T >N"" ``>,"#(7! `!," "` 4"L! 2 "," % "  L! 2!T ,"!T!`  !` #\`? `" `,"!T`2#(#(" #(>`e #,8`#(  !T  ,"ɐ & ` @/t  #H""@"@ "#8@#8?  #@@/^#㿐    !T " V ? ?2@*@  @v  +   H   (`@۩ :  $@ @-o [  ` @/ @ی 0@ۉ`  `@" $` "@"  "@A\@. 㿘  @] @ 㿘  @S @ 㿘   @' 4㿘   4 @'`㿘` \<? >N@k ! T P@2* T   T@l " T 0$ 4($ 0H /d * % @ΐH 00,?2 T H@d <$ @ T?2 H /d * % @ޯH 0  > *` $ D#h8*` € 㿘>N@lB!0 㿘 `@& 4`>30(`!T`     %` $` "`     㿘` `* @?2 "! @ "8! !0@ @ @@k @`㿘`&a`&a ` &a` `@&a`&a$``2a` aa H` @ g >N@j4!p@ ' ``@*`@D``>>* "@` &`*`," ` $ a$ a $ @a $ $ $ ``@*`@$``* "@` &`*`" ` $ a$ a $ @a` $ $ $ ``@*`@``>?* "` &`*"@ ` @ "`` a "`"`"`"` "`@Ȓ㿘`&a`&a `c  2 * &a` `@&a`&a$``@*`@ΐ``>>* "@` &`*`" ` $ a$ a $ @:a  $ $ $ ``@*`@``* "@` &`*`" ` $ a$ a $ @a`  $ $ $ a> Hc`a *  " ``@ >?@``>?*`" ``&`*"   " " " " " " @G㿘`&a`&a ` &a` `@&a`&a$``@*`@S``>>* "@` &`*`"  `` $ a$ a $ @a  $ $ $ a> H# `a @ *@ " ``@ >?@!``>?*`" ``&`*"   " " " " " " `a *  , &a@ݒ`㿘@ 2!@ $!< @SF2  @2  2  2    2  ,  ӄF2,  @2%  > #`8 *@8 *  2  2    2   , * 㿘\   @& *   &   @&"@@2   '@`'@  `'@> H  'c`" 8 J@ "! @* @K >>* "@  & *`,"  $ `$ $ @칐$ @$ $ @"D @* @) >>* "  & *#  "@$ `$ $ @씐$ @$  $  @* @ >>* "@  & *`,"  $ `$ $ @t$ @$ $ #@@ @8 @  @* @ڐ >?* "  & *"@ @ $"`"`"` "`@"`"`'x  #\#`#d#h#l @ 2`   D '''''@   <  `@@ y ~ X <`x `@@ [! 2j`x  4 2``   w S  ,  @)G 2D`= 'l 2'h .`* 2  'p "@'p#\plh  l@ p   @ "@&$&pl 'p`@Ƞ @` @@* p@'x`  ` 3'/   1 2 a`H " ,`@  >N@f͐!ؒ ,  @(Ɛa ϐ?&a&a /, @> #  2,#a > #`@ > #!D&a4 . 0`?'>N @  & > #!4 `": "`` @ ``  2,. 0, @: ,`?'''䀢`*>9" *` €  ] a#\`͚쀢 @  a&a? &a &a&a&a&a,`@ˑ,`? O> Hca@*@ 'O   @($  @( r$&a@&aD$ *$ ,$ $$ &a8&a@&a$ @)@a@@) @1` Pa@aD`'h a8K  @) @) @`0U`  "` 5>N` ` 2 @e  $ € `` "`@ & '` ''` > H# ''`  ''''`  ''''@a<'''* @@)9 @)6    㿘,,   @'ha 6 ,* *  2"   *  @'L a   `@2 ` @竐` `0* `@( @( 㿐` 4 a(?`? )a` %>NbP@  2' `  @ 8  @ L  2` , @ J@ 2`*@@ *L      J@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` , ` ``@`!@ @  ",`a( ">N@d"X@ Ha0 a(  &a(2` > ) ""`(2 , ?",`0?"`0`, "`@G`0` "` ?"a(  &a(@&k   ?@&f@$  ? @&[$@y$ ?@&R $a(  >N @$蘖   >N@dC"a0 b@e $&` @q 2"`a(  &a(`@@$ @' a(&a,a &a(h@2a" d0 a-" " 4a(   &a( ?&a(a0@  ``@@ ` 4@'`  @' ?  @' ?@/㿘  >N@c" , >N>N>N#cX@cƔ `, " &  ?@%͑* , " -*  @ @'| ?& 㿘  :    " @   `  & @'^ ? && 㿐`,> H#`@ 2( ` 2$  "`  @˒  2` A`c  ` #`` #\@X  `€ 0 㿀` .> H#` #* &` #`  * #\` ?@X? 2&  #`#\@ ` #d`` ` #h@L#l 2`2`   ` @  8  @a @ 㿐`> Hc`A`#*&```   * #``#\ ?@X??  㿘<>&a&a > Hc4 * &a ``@*```>?* "` &`*"@ a@ a a" " "`a"`"`"` "`"```*``` * "` &`*"@ a @ "`a a" "`"`"`"` "` 㿀> > ߢ"@M%"b@=>N@dH#>O@dE H@J@Q@@_/@"@@K?@OY@:@*`@@|> `$``"` "$` > cd$a > ؘ  $`8`8"`<"$`<> @ ##d@" " > "cl$`D$`@> #  ##> #"b  $`,$`>O,`1,aa PŔ >cܐ`p@J>cD`@J> "`$`@." `> "@`> #|!> 3 `"`2`&2`$`X"|  ``"`"`"`%-> 1> )> 9> +> 7> 5> ?  $`$` : : > !c  @@< @4$!> H#  8+@ 8  P< @  !> <`!0$> b @f`>  X  $`$a($` @* @E@x@HÐ@>@@@j@ @!x    $ @  2 @MH /f* '@a @@bH 0@A@1> #$`$@2>> &"(@8 > #! @  $>O@a X< "< $  €# #>O@a pb| @$ # @ٔ@|$ HH `T%`T"``T"`\`#`&\"'""`">A#`b$`$`#\   @T ">>O@aW >O  @S ">B>O@aK >O ฒ @G ">A>O@a? >O#В @; ">A>O@a3 >O#ؖ @/ ">>O@a' >O! @# ">B>O@a!>O   @ >O@a!(@W@1a@^@ > @H!" P>O!h @ '''''@v  `>O>O@b|!x0@by!0@h> "#> H# >" c'#`#\Ԗ ?@U?  >O@`̐!> # a"aĐ؀7> F -/#x `  s/ِڦ  * "$@ N@Z $@ E ?怒 ?z?v'''@q >O!@b  2 ->O@b">O@`u"㿘> @b㿘> @^b㿘@㿘@ðP !:@+ I@  '''''ܐ@p :@ <    @@1 + >  `1>   "@> @BĐ $` "  @@ & $` @ @$` 2  $` @ @>    ` $ @.$#?:T Ȕ@- @7@7`'H /i* * > `HԒ`H"'`" 'Вb@ ??H 0 @`7Д̒b?' '?/a ?>  >  @گ" 7``` @ڦ 7`0 `,@5 7',  '  ` "? l?' ; /@  #`#\#d#h#l  ( @m @.($㿘@㏒a . c   6  `  # (.` 6 `.` @.`6 㿘> `$  `$>C>O!@@/  #> %> '>O``"!> `< 2 `X  ?@ L$` P > %b\@C dd@0`> >O" bH$$` `"$$$`< 2 `X  ?@ ($  P > %b\@ dd@  >O$`$ b`@_ > @ >  > %$ (@@? `㿘 > n> n""@+"b>  ,`> >  ( ""(@(> "``㿘> "&!>  @`  ` " `@Fy` 2`@1V `  `  > @Fi` > @1F >  ,`> @/> P>  h` 쀢 "P> n> `0 "" " > 䀢`> ""@ " >  HДb?" ?/!" H`# H> T` "`?/!"`T`"T@GD > #> ] *aE 2 0  㿘H >  H H  # " H 0  А"@? - (c(c' > , "@*`" * * > ?@6   1#@ #א> @#   #㿘  &- (c`(c& > . "@*`" * * > ?@   %@ђ4 栐> @   #㿘 , (>  \ `& ,`!" \>  ,`H /m * . >  `> `(> n> n"@*"bH 0㿘 , &>  \ ߒ& ,`" \> `,  H /m * . , > n> n"b@*"H 0㿘 @$> n> " ,` > n @b> nb ? S"b L!`B < > `4` 2"`> `4 -"`4b ? ;"b > > #b >  ؒ`B < > `4`  "`  >  В`B < Д4 "> `4` "`> n" " d> `d  $ d> nb  "b@@㿀> >  > > > ' '('`,`'' @8 DLD㿐!> &"> >O!Pb#\ 8  @SҘ > >O#\ lb!@  @SȘ > ""88 **6*  6 *  ? * "? @*`2,  㿐`@ 2 0   $ 0 @  0 ,?`$ 0@> 0  @@㿐`@  ` 9 ` 5> !@ @. 2 0&)  $ 0@ @  0 ,?`$ 0@> 0 @Aː@">O@\"В@sx@ @ q 2`0`  $`0`` Q>E"d*` € ``  D ` (A`0> ! : @nܰ  24`0@`0`,?`$`0@>Y`0ʐܐ@+' @ &`  @ *@ @ ?*@`* :` ?* :  ` &`ؒ 34`` %  ̒@`4` `'ؐ~ 2`0` `@'`} ~` ?4`'` `0T` 2``( <& `wذ &T` 2 ```("< "@`"D   &`@# 2!   &``  `v` PT`  ``(Ŕ  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "%   h`0 d`0` ",`$, ` ,`$,   @@rCT` = `(`o  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @9 @ 2 `0`B  `0`,?`$`0@=*`0㿘 . `"` `0 $`0` #@2 `0`,?`&`0@=`0< "    ?*` `&` `0`,?`&`0@<`0`> +   +@@"   2   3 * +@@"  4$ ` ' H@ @ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @>O@Z"d& 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @>O@Yڐ"2 H,$  H@@ +@㿘@ A  8`2@ 2 0"  $ 0 ` 0 ,?`$ 0@<7 0  a:`@%: 2'`7 `㿘 @ 2 0"  $ 0T "`  -`   "& @ ( - 0 ,?`$ 0@; 0㿘 />   @8@ @&: <` ! <`  "@,  ?2 ?2,  `2  2 *  ?, ?2,   , ?ᓐ8??O `-    : "@,  ?2 ?2,   , ?n8?-  * @@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘` "( @ o 1 2* .  ' @* $@1 @(&  @X '  :`: ` :`: @7 ',` @,` ' @ :  : * @@$ :  : * Ԕ@$@ :  :  $ $@ '@ '$$$$$( @O 㿐   2v{> > 4a0  @;`&  *@?2   2*`  * *#   ` * *" @>O@X">O k& >O@X"= "4>  @P"!P@ԉ 8 $ , @`" > @ $@" "@ $ b8b8 $b8" "b8$   `* "@$  $ @ "@&@& 0 $ 0 㿘 >  @O l@L!@  @^$` $` @X>O`( $ @ > #! `X` ``?4`&4`$$@$`$`$`$`$`H$` $` &0& 㿘 >  @O l X  " @% " @  `6 & X &&   `c*`@,`4`@: `c,` * @4`,` '@a & &`:  :   '  &  &  @N, & ,  '@I & & ,`ݪݦ < < , ݟ , ݛ  H?  @ "  R 2  `@ ?& H& L& T& P  @#`"  `  Ӓ "`  `@ 㿘 &?* `F4&``" `0 "`0$ @9 &   @ ' :  :  $ @ '@ ' " @ "L@L "T@v T "> @p >  l@Px㿀 ` " ,`, " ,V 2 , (   ??77 @* @ , 0 0@9%& 0^  ? &  0?& 0T 6 0>O@Vy"& ,` #> !>O  0# @7%  0`  /*  @2  (   ??77 @    € `"  "` "@@!  `>O 0 "b4>O 0@V3#> $b4@O!P㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @     @ 0? 0 "\ 㿘]   7 2S  " y #@2r .`"@ >` +`* ` #    +  "  @ ?2   3`* `+@"  @4O& N . .`" >` (*`"@   * +@   "  @ ?2   0* +@@"  @4&  >&  *@ ?2   2*`  +@*"   +@ * "  >O@U]"2 &  㿘  `` `>` $`㿐!> &"> >O"<c0#\   @LK > >O#  @#\c8  @LA >  "`㿘`4 €`4R` (> %"`8 "`"  4(  `2``"` 4 `("   㿘@l  > ' "    2 ,!"  @ {!: "   & 4 6 ?Ȓ*  0 & & 6  & $   ( 4  `2``"`㿀< ,@@    &    (  `  6 & (# 2  ,   ? .@  $ '77'''@Ô   &  @ 㿐>  ` + . 2` 2 > %b"> "<@Lm @Ԓ && " (& H &$ H& , ?",`0?"`0`,  @6ѐ`0 㿈`@ r T` "`00l $`0`  ؿ  2Z`0&`` D`( ' ' * `ت* D $   o4 @B ` 14 $ ` ؔ `  ``?&` &` *` `* " @ &` &`   &``` @&`0`,?`$`0@6V`0㿘V`    `  ` 8 > %"*` 2  "1`P@ 20  $0 `$ @`H:*`L@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `T* @ "` 2 2V`T @2`   W 23`> # @Ka  2$  $ 4 $ 80,?`$0@5ѐ0`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@$ $@  -$ ,` $ 0`$ $Ho o 8    (  $ (@H 0` " ` 8@@3 "` ( H $ (H 0`  ( Ho o  $ (@H 0 P ('X + A#@Ͷ'` ' ?C` @:V  H /i * * >  HА H ? @ ' '?/a  ?BH 0` '' `   + ـH/` /``2"'6`  #>O $`@!@2 H 0 Ӏ? # " `'`"@$`` @ ` "` $`   "@H 0@0 (` $ (`?o$`  2  8` € 2   ( ?$ (`\$`& & & &  $&   ( ?$ (`$`H 0 8@ @vHo o " $  ($ ?$ ($ `?$`` $ `"@$``H 0,, J Ho o `2s@`"` $`"H ` ,"*X%"@   㿘 ( H /f`* '`     @eΒ   $ H 0㿘 (@ʒ `   :6`>`0&`@ 㿘`  H' ( L*@ @->  @ 4`0 "`0 8@ 4q@J $`2  H& L P #?!  T*@ @3>  @  8@@Jc $`2  P * T> "<@J& ( 㿘   ?& @3w   ?& @ee @ 㿘  8` € "   (  & (@  2 8㿘 @@ @S@ 2 8㿘 .`L@㿘 8@ `P 2   @  @'G`P$`T `P2  %`T`H  ! (!  @u, `H`L֕*`H$* @@*``L "$`H@  $`H$`L `L* @@&&@& (㿘 8` LP2  T* @@"@5> 5> 2" ( " 8@= 8`   4`0 "`0 4w @I㿘 H/` / (`" & >O>O>O#HcX@O#w & "" ( & (`"H 0  㿘 H/` / (`2  >O>O>O#HcX@Oє#` "` "  "@ ( & (?"H p@ x`(D$($$@A &a`<    @@a 24`X <  "a` 32`@@ @ 2z4a` I 2q @@]  2j4 @ߐ#\#`@ `#d` #h#l@~ 2J> # ` 0"   &` > # , €  2a(a(  8a0  ,  >a$@8 a @@  a   $   n` @4@ܒ 04@ؒ @㽀> , X 'L$,hа+> #> #!0`> #   X@8%"X@ ''h"X ?'''l@'"X''''' ''''a''ؐ R> `c@:_ 2>P@Nʐ   "  J@,`J@   @@l ?  @c ?ؐ ?'``  2`   ?` ?%'*   2`` ?Ȗ  ?"ڰ 0`?%'    #> %c   ?` "c * "@ @ b ` *   " А ? ' 'А @R>> H %` 2 %`%` 2 %`@2@ %`%`Ȁ  >P@N @$ !̤ />P ` `2 @N8` $ € `Ȣ`@ 6 ''>`$"  t=c҃  nZ@~ @8 ',?,:c 4:@̐ @S, $, $ ?H@0H$,    @ ,*@$, , ",@ ,!  $, $@ @K"@ (" $" '씒 'R ( `   T'쀢 2B``  耢 耢>P@MG `@E-@䀢 ϒ@䀢  `H "`H 2 > )2`  ""`(, ?",`0?"`0`, "`@/`0``$, >$,`" ", 'H /i * * @5֐$$$$ࠖ *@" " @ "`"`H 0> `c@7J@  @ɖ  , € 2m (L@Ր I,(@l  ?@c$ @`2W,@}R,ސ؀  ?' @솖@E > `c@6@= ?,*@7$,Fʒ@ц < @w>耢 "@ @  @T> `c@6Ȓ@ ?@ɒ @ƒ?,*@$, 㿈`` ''  2V !4,  **` ` '&@'͔  .v쀢 7  @ ?' 'г  ? &`Щ   R쀢  ?  'В   㿈`4%> H`0`8 +"  @%F@%&`8'> :p  Hc`8@ * '#`#\ @@ "`0>P@MK ,  @ * p@:Ӕ@   В  * &!$@%`8 `8@  a* #`!$#\ @@ƚ >P @M   㿘@@*` 㿘 4 'H>P ؕ>`@K` , "> >  @C! , w&!<`& , w H@.& ,?&! @4E& g @pǐ 2!  @vt>!  `@2"! ` "&`` `|2``x  @ @|` ` " &`@ ` "&`@E&`&`! @ # 䀢`& @  ,@  . 1 8`" < <"`< < 8"@ ` "`   "> 쀢 &  "` "&  T`> @-c`H %> `L@O`,( 7&`,@ 2`L` H6!8 B!<!<`@  !<@J`H& h  ,@>  H ,@  > # H@  T 2 ,@-W ,@@  ( (@ H  @k @-E H ,@@@->@* > @g"b@z& 㿘> 耢 & 8 # 8"`<"& <@-$ 㿘#> %>Pcc   @+2c 8`" < <"`< < 8"@@17 ,     H@", 1@, Hc@c㿐@ 2`! ` &@`?" T    , @" ` 4  !  @ 2{ L`  ( "s L L 1B2L 1 ( 2i LL 1 E  4&``  !8'ο 2p` `"  X!<ε H 2f X " `@ $ X@\ ( B ,@  @@,K  ` $ `@ 8 & `4!8 !<@U H @]09 2 L2 L2 4`" L 4$ ,&``  !8*  'k  L 2u , 2` 2&>P!  @*d "_ T H > @2L "(LP PPL `T "L`TL P"`T`T"P"H㿘!<> @CF!@ `"  "`   "@ L`" P P"`P P L"@ @? `?  "` @@>  @C!!  "> @e> "@C> %c?"c㿐#`#\    @7 㿐#`#\    @+ 㿐@` @ @ "  $@ ` `@   `@2@` 2#`#\   @ h>  > %  c'H'P'T 'X 2>P >P@H!(Ұ #@  :   p  > : t `p@ ? #> :`p@4 ' >  @@" @ T'''Ԑ6''''>  ! @''' -> #> )> +> 3> % " >@́ %@ > %c> % " , 1 H$ 4$ (cc $ c "` $c$ $ $ 4#ܐ cؕ* @ $ 8@  8"`<# 4cؒ @ *`"  4 * $ < X@ !Ӕ (>cܐ p@1 >cD @1 $ , $  , " ,걐 ,! , @ $ ,>  @@i! $  ί   " @ " $ @܀g $ $ $  ` "$ @ΐ $ ` "`!  `  ,   , $ ," @ , $ , @ $ @ @ @"`D& @$ D$ H؀  , $ , T $ L T L"`P& T$ P$ T @"  ,$  䀢 $ @ ,@ `$ `@J @9$ $   &  , @.耢    >@G1  <>@G, X`$!( >Ϛ#\`#\#\PT@.C䀢  `` &``` @%" ` "`` @"" ` "`` @ "  " `` @"H /m * . >  H H  " "4!:, 1@CH 0 > H#&   " "Ѐ`" " 4 n " 4 , " 4#>P a0 @'  ,`  4 `"@"`㿘@ 2 @ 2 > #쀢" 4"    @2 24 㿈#`> 'T'X#\" "  @n ,"& ,!@HT2& 㿘  !> ">P`4!8a@Ha"J. 㿘  @Ȕ  2>P@FĐ!h@F $ $ $> %c`""`㿘> %#  $$` @ @ a  2㿘 䀢 ` @1 䀢 & @ˢ㿘 ,@ @6 `4a&   h @&   @o 6 $@$`  `*" 'Ȓ'@Ȑ@   *@& X @&   ''Ȓ7''@ *@& h @&  @'Ȓ'@ *@& h @&  @ΐ'Ȓ'@} *@& h`M  & > Hc  8 Ȓl  @ `'@'`'`'Ȑ@T %"@&`&'  "@( 8 @4h א@ |  *@&  @& $ .`>`'8'<'@'DH  8 ''Ȓ@  *@& ` @&   ''Ȓ''@ *@& P` ` @  *&   $ @ @'''''ܐ!@䎔 2|  @躔<`  @@N  *@& l `> #`X`䀢2`@ &` ` ``2`B2` =  !@  "5  `/` @i@1`@``@  `  @M@"  @@  *@& 㿘@ ( 2`7`&` `2`  &`?* &`&`! ` @`   㿘 ǘ T`  L " Hh 䀤 , @ ,Ȑ  '?''''''̀` '`(`, ''''`@ڐ @棔 @ǒ `>P  a@D> # " 䀢2 &    2  ` 2 2  2 2 `&`,   zl}{{{,~㿘@ 'p?& & 6 & & &P  2 㿘 ?4  @@ 'p`  >P@C!>P >P"@C  *@& `  &   !@!@>P@C֐"0`>^!*` € +  @  #2 M   `&    *` @$g:` & ꀎ f  & 0a  &  >P  >P@C"P  *`:` & 6  ?* & & 0 @  ?& 0< >P  >P@Cr"x ?&   @2(   4$   2   &    `&    *` @$:` &   M *@&    & &   " >P@C."   @%  @ڠ >P@C"  6 0Ҁ   @ˠ   " 032 M   `&    *` @#:` & ꀎ   & 02 M   @ `&    *` @#:` & 倎  *@&    & &   "q >P@B"   @>P>P "@B ?6  ` * & ?& 0   >P ?& 0@B#  J@%"0F >P@B#H @9   5 1 @    &    *` :`@# 5 24 M @     & &  6 0>P#p@BA   @" 0@2  2  2   *@& @$Đ 㿘 >P @C#   @>P #V @C  `>P@C#8L`t> n  㿘?2   0&% > %c  #>Q`##`&#!`( @" 2# `#> %c$ $# 㿘  @ɐ H> %$?" $`"$" D" " "> nc` " ""`㿘`"  "`> n"# "@@c > %c$?"c$ 2> nx ز   &% > n#/  ,@w 2 > %#$  & > n# 2  &㿘> %c - > n# ` `D?# `,I`# "# 0" # > :`p4@+ # " 0# "$c " $c > :`p @+ # " $c 㿘?2   > %c   !> n#  #  #c# ## @#&# 㿐> !l`'0# @c  0# @[ c @1> % #@> %#@ H'c@V B'0# @"0# @ 5'10 #@#@2+ > n"# `" #@  "` 1> :$ & p@+l"  0 c""@ & `" "4 p"<@+Z  "`8"`0 &  0 #@"`8"`4"`0& > % "c 1> %# ? 8   > n# `` " (`ؐ @ ' ``    &#   "# ? 8   > n# `8`4" (`0 @ ' `8`4   &#  8 "8> n# |#   2 7> n> n#  @  "@ @  s    "(   ' &# Q b 0 84@  <,   >Q"D<@A}0 ` "`F&# L1> n >&# `(   6  > %q"c # 061> n (&# `(   !'# > H$&,` &,@& &@ #  &`, &`,`&`, '㿘@l㿘@O 㿘> n# "  , ,`@} 2  "  2 , 㿘 ,`8 >`< "` 5 a> #! >bc     `a.`@ 2`a> # > # !ԡ.``Ū `Ŧ  $` ` > #.`aԒ `Ŝ 㿘 ,` 4`2   @̫ @ 㿘 ,` `~ "`   "8`  ` `> Z#ܚ  > Z!>bc4  ! `@  2`c܀@ .`l 9> Z#܀@ 6f .`$> Z!, `: `7 `> `!  > Z#>bc4  # `@ , 2`a@ .`9 > `!@ .`1 , $> Z#, ` ,` ,$` ` ` .` .`"> Z* a ` 0 @*`"@> Z#*`@` ,㿘 ,`A I`G "` @ `> #!0  > #  `  `@ .``2`!0@ > ## > #!0@ > #  .``ġ `ĝ > ""X $` ` > #`.` `đ > ""X㿘,` >`!|*` €      x>  .`@`>R@= h` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  - "@> *` @H /f4'* ''@?> %#c4.`0  4 @  @M @ *@  $  2s> H$ c* @c`@ *  > H> %@: c(L,@ @'` 2> >R@=b H 0   > &  :  *@ B < 2 > Hc* @ ?#@$2>R@=> @$ &2   B < > H"7o$   @b" *"@2`"@" "`  "$  $ *`2` > %#4:` >R>R">R#`#d В`:`@>n> >R ` ` J'> %#(` ` !'`` `'> &`` ؖ @`  > "`"ǔ 2`` &`(@@ (` > " ` `>R#`>R>R h``#\ @>3$?" 6 7o""*" 7o" 2#\*> `> H&`> &: ഑* R@@>R@R@  .`>  @>  > H> %#4.` >R!8@<1c`& > `: * R+ > " *   *@ H /f * ' c A> &h!8`b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HT!8*`  c> %#4.` >R!`@;’* )c> %(@&+ `*@ "$`44``  6 @@ @?B$@< H 00r7o"@ `>R'>R 2`!@=@;ᰀ`    7o""@`@ *"@6   4 * @ "3   $  3 2   $( >R@;W! (@8  02 `  ,@(` 0`B < 0` "`B< $`6@@Ӑ@?`$@$ " & $ H 0> %,> ]L`&`> H8:`4&",㿐%> %> H#,#> !> ` '> :> npc#\  @#ʐ> %"c(, p@%*`> `> #"`(  *@  @:  c,ð ̓* @*`@֒ /$? 6$`` \``` `". ``  -0`"  -> %0 %> 0"0@   #>R .@@ > G!E!4> > @">"H $!4> > 6"4"4> > /"-#(4 04> > #`#4> > #  @4> >   @  x4> >    8''  8 g > * ถ  @$[> &a4 O > "   L> %#4 .   @@ ``  @o%!4>R> %" c4  #>R. !4@b(@;   !4*? > & _4J@ "*@ 4  !4@> H㘅(`7*(   . ,  @) ' @"!"" !$($    @(0㿘> ߬`?"  @H /d * % `0 # !>R`0@&`0 "0 @ `0``0 &`0H p@&`D&`4&`,&`p `@-   "` &`0`*2 @ &`T &`<&`H`<6@>R@9"8$>R@9"X  $, 2`H@`H  @ `0&`4(&`01@h@H /d * % `0" #>R bx @ `0b" `0 &`0H p@@hK`H@[?$`0h"`<`4 " `<`@@@>R@8"$ >R@8" "  $ $`;`` B# ?` '`@   o` &c@H /d * % `0?# @&`0@"0 `0 @`0*@&`0@H 0㿘>  @0!\@ t!P#!& 㿘 \ @ 0 @"> >R@8R"!\@2 <@4" <㿐> "#> "c> "#> !>  "c >  ) : @ > "cؔ:>  ) @ > "b:>  )@Ք > "b!> &"> >R#\"b!@  @/% > >R#\!b H  @/ > >R Ԛc#\ P  @/ > >R#c#\   @/ > >R" c 0   @.#\> >R#\! c    @. 㿘> "> " @ *`  ! 2   +" 6>R@7#(`""`"@ h )  >R @7#@ )  "" $""" > "   42 H 2 4 > ܒ> @؇( "   4  8 2 4 > > @( "     2  㿘 "! >R@7J#X!   @`>R@7A#O@  4>R@79# > e #@/G >  @/@"  $$ $ $ !      ,> b ?& ,  $` >R@7#!  $` @ "@$`$`> > "@* `$@" "@* @"@$`$`"% @Y ! @U  @` D"`D D @"! ` 2&! @# &! ` & @` @"`D`$`& D 㿘 @` D"`D D @"! ` 2&! @ &!  㿘  `"`x""`x`"  "` "@ ? ">  @0b" > #@0^㿘 H! @` ` 2 T` &`? &`@% T ! @" L` 2 L 1?  ` "`? "`@  L 2! 㿘  L 1 2 @  @  @   @ 0 2L 1 4" H4 " H4 "!  "㿘@` 4@"!  2!   ! `   !  `&㿘@` 4@"!  " ! ! `    !  `   4& ` "`"  " , "" ` "`"  "㿘@`  R` &R @:`   \.  2& 㿘!  4 @ " ; " 4 I  4 &㿘` @A  4"a  "5  2a . ! `  2( `,@"a ! a  ` 2`4`4 " ` !    㿘`@`   @ 2 / @ @ `@ @Ԓa: `@ @ʒa: 2 @"$ G?D $ $ @ݰ $" `,!$`,㿘`@`2  @"  @ @a:  @ $" `,!$`,㿘`@`   @ 2 & @ @ `@ @ra: `@ @ha: 2$ $ @ $" `,!$`,㿘`@`2  @"  @ @Ea:  @c $" `,!$`,㿘`a:@2 2@  @K&``,  22` `, !$`,R` `(@ :    *   ` @2@㿘>  @,g ԰@Β P &㿘@? "@> @. ԁ㿘   P &㿘ՠ P &㿘`  &`! ` ` @㿘 !:   !   @P` ?"  ,2  &  㿘@  )  "`M "'`I   \ 2:N!9 )` ! e . )  * )N!& @ 2N! ) >  `&`> #  )` `2 N!&  2  ) )?&  㿘@    "`R "-`N   A`@D; ` !  1`  -``@. @ `"` >  `&`> # ` ``2  `@`  2 `` 㿘    `` 4 &?Na6 .a!:  .a@ 㿈`  @@㿘`(     .`@    @ 4  2   @(   !:x " q` ``  `"`@m & `> &` `` > & ! !> !>   :`? 4 >2  (>@4  ` @`>`2%  "> "@ " "  "  > H#8   @  @ @12  << 㿘@  *  `  㿘H o4+@n   ȑH 0 @D@B 2 > %%&&&& ,4`>  , @,`b2*@ *@ b 2`* @ *`B2*@ 8*@ז Д @і@&Д @@6`.  .`@c3`+ +` b 2**@C3`+ +`&  @ Д @@%А @W@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@ Д @@&А @.@&㿘@ `   M `  H`: H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐#> ncȀ !> > &"#\>S"`   @(`  $cȐ"@)\   $ $ 㿘`? "`> @*"<<<<<<<<<<<<<DDD<D<<DDDDDDDDDDDDDD C A2 ,!   ; ,4>q* "* @"% @ 0   " @  @"  @   㿐> &b> >S#\#`0!4  @' 㿘>  @(# $!4 $!0 $"`$ $0 0㿘 $!0`@& $㿘 $a0? "a0> & $@*5#㿈@   $` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a   $ a `  @$ 2  , " ,  $  ,@"   $   2   $  `* $  2`   "@  `$(H*`"  ("?`" `,#`,`4"`, 2`,2`,`,(#`,8"8"@  "  " "`> jt2,, ", > &*` 2a`쀢` #`a#aa  a #aa #aH> &  *``*!"!``*`㿘ΐ! ! $> &!! * 8 &!*` " ! &! & *$@!`2! $a $a$a$a ,*@& ,`P`"$`P " H "`  "` "` ? "("?"H    "㿘 $?!!`$!$!@ 3>S&!!(`8 @  㿈 $! 2`!  $! ``!m *@ $ \   !  ! ?$!#@  ! $!$!$!$!  㿘`` / @   2`$  2` ` @7 `    @㿘 $ > #L4 $,"2T `@24/ " !  2 (  !4 $@,"2@+  ` 1? @ђ@24  㿘 I)  B  >   "  "   2 @@ @ 倦0Z    "  "   @|㿘  L @ 㿘    , @] @   @ $` xt@['t.`!Ƙ , 2* !"/$(!2+$( .`< "< 't` t!@! &!@!`* &!> &! `" $ !&!$ $(@㿘 ( ,>S@-; @@ g@ > &!.`   ,(* ! !  !   N!  .! !  `   *@& 쐊 *@&  쀣`  & 쀣 lN 1 hHo oN 1  %> G" , PhK `"1 쀢?`2>! `A 6!8*  H& ,`  @02 ,h/` & `` * & "!  l  . 1" l * & 쀢 `@0  > b  "`! 2 2.! @H 0㿘!  ,*@ +    ? * !*@ $  ,("! , ((29 $4!8H /m * .  ,@@" H , 1@@5 @r@/H 0 ,("!!8 "!? !*@ 2! * $  $.  > &a @ = F  4`>S X@-!+ ,(2!!  `2 H2! H4!8`,  Ē @(H /m* .@ܰ H 0k!2i!  2e! ,(2a!>S@-p x\! $ 㿘 ,*   H. 1@o& ,> " `$>S@+ɐ ` ?* *@$`. $@ (` @`  x't  @t a  @[0F>Sa>S@+ Ho o  ?$a@a $a@ a* $a> &!`"$a$a$H 0 `< "<$@"$('t` `  t㿘 4>S @+` 4>S @,_ 㿘 ,!:@  6!:> && ,.`` $@ "a$ "`ߢ㾈, a: ,!> &"$`ݰ > H c  ` *   @: @ ˰  D Ӑ`8$` >S$``ؔ@, '''''ܐ#@ ! 0P@ؖ <  T?@*@2 @  ?h @@̐:(4:c!@(@d@ '@Ɛ $'$' ('$'(` *', Ė+@'0 `+ + @Z'4 H -( ('((  К 0 #\;`#h#l @} .`> 0* #`("` *  4 #\#d#h#l @U   #`#\#d#h#l   @P @͝ @5 "㿘  N㿘@ &&  & ` >q!t*` €& &  > ⬄ 2 " 4`" "`  4  `2``"`@*@   "  @ 㿘  >S@)   `> " `>S@)֐ U Q` `?&?&8  "'@ "@ u  2@@UJ "@0# 2@@ @&@`@"$`$@@"B &>` 2㿘` 2`>S@)w!``4@>S@)p!  2` &`&@  "  j 6 *  `?$ $```B >`&`㿘 >S@)?!8 4< , $, < 2,     @?*``@&&㿘    2&  `&  && " $  &" $ & $㿘 2 2@>S@(!P``"`& `@"@짒 㿘`  @  2 0` "`&  " € `셒  2㿘  꼔  2&  & > &"8`"8 && "" "8㿘> &"8"8@  @ ` @@@2@`2>S@(!x "88@ "` 8@"@> 㿘Ho o > &"8  €  2 0"8"8    € 2 H 0$ $8\xl Ph4(< Pl0DDth|4Pl0H\t$p8H $㿘> >S"Ȓ!$ Ҙ > >S!pВ!$ ʘ > >S"!$ ˜ X`    '`a:x ~` y @*jȰ rȒ?` #>z \*` €>{`  X >|#>!>!>- !>* ">"d>#0K -` :  B` > "  ㅖ 4`@   u 0%```` #\`` @ > " Z  ` ` 㿈`\   ' , 1 3 7?ʰ ?`;>z *` €>>Ð_>>@> !>  > !> 5"4> 2!> /!,-> ' !> !l'@ m k!l 6 $!l@6$!l`4 ^ $!l[ > !@O! P M> K"!h>  h@?! @ => ;""!> "Ԑ'@.$"Ԑɵ)> \ @ @ @ @> ߐ"a     > (֘ > (Ϙ > )Ș |> h_"p> &"$e ` [ V >   a@  G>   a@"    #\8|> 4 > T>  @e @_'\> !> &"H> %#@M @$F!> %# @# # 2 "  2 " > Hc* ," )  @"> 3#@> 3#D> 3#H> &"@y -㿘`\l ?` f>z!t*` €> <;> [5㈐L F> ]> H!Lc* => H> ]!L " 2* > H-# @ /> &"@>S@ @  > # > &*`D# @!+  > # @+ -㿘  @     `&@   㿘'P` @     `&@Pn 㿘  @     `&@S  D 㿐''` @     `&@/ 㿐@#\㿐 #\@㿘\@ `  @@  `,  `% ` "&@@   ?*?@@@*&@  Ԕ/㿘@   @     &@㿘  @ ` `&@ 㿘` @   ` &@㿘@  > "4 ` *`" *  (&@`!> "&@"8h  "8&&@   `7U 8   8&&@   ` `2n   > f > #J "G``->z!*` €`4 "@a    `, "1`a  ` "+` l @` ` `   `,"2`h@,!@ a@" cЦ0``2N`1 > #  $@ &  #& 㿘&@! ` `  P&` &` &`  &` &` &` &` rN 1  1 8  &a(&a0&a4&a8aP@ &b,   &  , @ @I&a( aP&a0 Ĕ &a4 &a8H  &b, ?&  H "&b0 4&b0!  &b4!  6b8 , ?` `?`l&b<`x " #&b@`|&bD&b<`  @ &b\!  `2 &b\ `bH>S! @ǔ `.bO`6bT&bP6bX6bVb`@ .b  @b.b    P>bX`'T `(  `` -   `1? ݰ `,b@ְ @Ұ ` !> H  "#\ =?c?T  ''''''''ܒ` @ D ` `c  `Z &?#*  ,``*` '`w&@:u    u ?T''''''''` @  b "U# '  ?#'T" ''''''` @ ߒ F L  @`@@L 2`@ +q ,@@&'',_  ` &' `@   'E @&` R 㿘> !p  ݈ > c a > # %> & '> & (@0  @  * D "> $ > #  *"  * $D]$@$D X c*$@ * >S! @ (>S! @#@D 0@"@ 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4 ݠ 8`@@*?"%c > # > &"D 0# 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4  8p   㿘`"    >   >  !\   \> !4 $ @!(  8@& @@&  Ɣ @@E >    :@) 6@> !X!X`&@`&``&`` &``&` $&`a4a4 &@ &`  &` &` &`  &` &` &`&`> ! ! `&@`&``&`` &`&`  @6 / ">   , # >  > * a"*   !Б,  $   , a"*    $@@: "&  "hhthh㿘#> nc>a4@͔!> n#>aܐ@Ɣ@@.㿘> "> H /m4* . "  "H 0 > ` > b> "` @ "@㿘> J>  `,*>  ( > >S>S>S"bX@͔ # _ 1 ?` $   $ > &"H h 2 `G$ hH /m * . d h  d d* *  @* @$ h `$ d@ޒ($ `@N ! 1> "  ! L 1 2,!  ,  22@" ,! @Ր ! @,! 0,! H 0  2 1@(=> @">  @㿘> J *` *`@  `& `&  & ( @@ "& ` ? & & `@㿘> " `@ @a ٤ Ho o>  T`> a>  8`> a`H 0 H 0  >SL 1 >S  >S@"`> > #b$ ,! $ l$   " ""$ p@`"  ,  ` $ ,(!@ _   l  @ , 1 2     , 1@ @"@ ! > *bؑH 0 , d$ , { $ ,  @ @`@D #  > #`@ p`* 2  쀢`"   ,(!@    @ @`@2 $   $?a *  ?  @ @`@  ݔ  㿘H/` / l`N 1 @Đ ,@} ,$& ,H 0㿘> "` >S"h@Ւ>S@E"Ho o>  T`> a>  8`> a`H 0 H 00D >SL 1 >S  >S@":> #b,! $ l$ $   "  "#   , 1$@ "@ `@  @ ` @  @2 !  U ! > *bؑH 0Hl8>   2 ` ""`"lH 㿘H > > c"@ =   >S 1? >S@" l2($ l"`@$`L 1 2 ( , , , 1` $ @> > b" "c> @"`Ȕ0 2 H 0㿘?㿘> " ! ,! H /m * . @~  @`@." @H 0㿘> ߀ ">S@:" ! ,! H /m * . @Z  D`@ " DH 0㿐> "> &b䀢 >Sb@. @g>   "@ Đ"  А"@ А"??/!`$$<` (2   #bX     bX  @4  bX  @bX`B <bX$`" L 2 ,@c> H ?$`"@> ߄   㿘Ho oN 1`*`>  €>S@# ,( !8  * @&  , `. 1@H 0 ( , , & > "0 > ! "؀  > > b"`"J! ( `  8  *! > ؀@ > > b "#㿘 ` $ @8& `! 1! .! 㿐N   n.>SJ#` #N@" L@`L@ 2`L@m> >S@#>S@#@>S@#h>S@#0n#wa0/"0,>S>S>S>T>T#c@l  >S>T>T>T>T>T>T#\ `HPX `@Z`h>T>S>T>T>T pc@M ^%>T)>TN1 KH> ">T`   *@:4L@ n">T w a"(7"'l3  @&, ? 4  l` N1, "#\#\#\#`@ >T! @ 2N1> # 2N1㿐 >T!P > !l`> `H`H`  &0 `H >T`H!"@ @ְ 0NH /i * * `H`H " ' "'Вb@ ?#`H # > #\#\b?`##\ #`?/a  ##\#`> ""`#" #`?/a  #"#`H 0@? 㿈@  @H*`" * `*'' 㿈 !: @  `t   #@''\㿐@   `  >  '@Ɛ"'`W p@I  #@''Ԡ@[ ~ ` H /i * * >  T T ''H 0  $ > n>T#! ) ?"  #" ` LH /i * * >  T T ''ܑH 0 "@'ܐ" 'Вb@ ?"" 'Ѐ'Вb@ ??Ѐ ''Ԑ*`" * `*''Ȕ  㿐@   @h@   ``>   㿈 !: 2'@   `   @ "`v  ` > `"`" 㿐 !:q W@ g  O> &*"@ *`" *  * "L >  *@ *` @k @ & H /i * * > "> """bH 0 ` !В"@@'"@@?'`!   㿈@ W H /i4@* *@ 3   ' ' ''쀣 1>  H  H`&'0H''HH "@ " ' 'Вb@ ' ' * ''''H 0` 㿈@ 8x `   2n`  &`  a ]@ 2W @ P H /i4@* *@ -  @>  >  H H  b? ''?/a ? $ @`& & & & @~@ * """"H 0 㿘S   >  & G& ?/"?a  H /i * *      & @&  @ & &   H H@ 0H@' $ @H 00H 00Á}x8   Є?  >  &"  6  "@ @" "    "  "  " " "  `" Є@@" "   H(> TT#h#lH h #`l" #dІ@;``@d` h   l"" #H(> TT#h#lH h #` l" #dІ@;`` ` h l##  "@ @   @4"@#>  > # >   " " " 㿘Ho o `>T@K!6> >T@F! P@   &  & @   "` " & > b`&& `""` H 0 H`" ``@ `@"`"``"` H> `P> (  > b`  `  "`# "`P2Fb8(   b`  `  "`# "`P8.b8 (   b`  `  "`# "`P8b0((   b`  `  "`# "bb@ 㿘Ho o> 耢@ > "> > ("b-> %@#@ "` " P"@ e !:` `*   ' 2`:` '* P `" # 4: *  ' 42: '* # P"@ !4:` `*   ' 42`:` '*  " P"@ !4:` `*   ' 42`:` '* "   ` #   H p@ Ho o耢@x H 0 㿐$> "&%>  _ _3 `2'>T"' >TP<`"   @N:2 㿘>  P>T@B" >T@?"0Ho o> "#Ő?`H 0 㿘 !:H @@>   >  >  > "> &P"`""  㿘   @> &b\  `>T@"XV` `>T>T@"pV`@"x2  @ 2 `>T@Z" \ >T`"@ڔ   " &   "&  & &   㿀''''耦` `  ` @ > "' ,'"$  * 2  (*`: * @*``  2  V  2V   2> &"\`耢 " >T >T@x"@t"㿘` `  ` @ > "􀤠4*`$ %` * 2  ( `*`: * @*``  2  @ T ` 2T` 2㿀> R` '' ''''` > !$V* * @~ 2V 㿘D @>"  !> &"`ƀ * @ 㿘  >T@#0  @ 㿘?` .@  0?.@Q ` `0?.㿘  `  ` ` @d `* "@V   V `  6 6 > b&```&``""`@B`>T>T#P@` > #``@` > "􀢠"&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@㿈@ /`>T@#p ն  2>T@#@4V`  && ("& V`V` & @   *`   @ &   *` 2 0V`&  @8 2$`(>T@s#Ք  Д& $ -  , @, .`@$.`$.` T   &@>T #>U >U @H *`@ɐ@  $ * ` >U @0 & ,㿘  ?* 2   >U@! @  @  € - `>Uo  h@  ` `>U`$2`@`2`$> !$`"! 2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> "#  "@@ `@* "@>U @F @` 6`@@ 2 `   *`"` @W $`$@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(㿘 $ 2> >U@_ # >U2@Ta2  K  2">U@G!0" "# " "" 㿘> # #  $@` $`$ " € ޒ `2 㿘> "` `$`   2`$㿘> " #>U``$```0 \  p @va` - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & , ``@n 㿘@e (&>U@!@Ɛ&> #  & ""  $"`$G" $`@@&$"="`$$@ @ $ @ 02`T T&*$$2$$"`$$2$"`$$""`$ $@ @  2`T T&$$2$$"`$"$ (   @*`2 㿘 D? 2`  2 ?`a>U@qa>#>#Б,  0: >Ua>U!>U!Ȑ  U!П` >U!؟ <>U T!: @ `' ` <`(@ `,` !>U `8!@#`8@`,!>U@"`,@>   > >  "# 㿘 > # `>  # "   (@  2 ( 㿘 ! ̆ @ , $ , 㿘 ,   (  ғ!&  "Ҏ  `& 2 >U@"@! @"H /i * * >  T T& P & TH 0 &> & "@">  >   " "㿘     `"  "`> "# "> >   ?" " >U@:"H0"0H(> TT"X"\H 㿈 0??& 0>U (@"hH /i * * >  T T ''H 0  X"@' \"'Вb@ ?? ` d & ` & d?/a  & `& d`& X & \ H 8@ >`CB> H> 8 @ 얂B> @@ 㿘> "  ˱ 㿘> "  ˨ H(  :`@:`8:`HH(> TT"`P"`TH "``"`dH )> n !?@   @4  `? 4 ` ,`* >U@",`@*`"@> Z*`#'> ⬐@  "`>U "@G`e⬖  `e@ "`>U "@6 - ` >U@'#@ ">/  " > @ 2 @ >f # !H! >U@#(>aH> o``> o "``"   ` " 㿐!> o  > >U#$cX#\   @  $ 㿘> o @ "  @Ȓ   2 㿘> o @ @  㿘@ \`>U@#h >U#@5>U@#`+ >U@#  `>V @  @& ( 0& $`&    " " ' `" &   n 2&  & && & &  &  &   & S㿘 2 >V@P H " `"`"@@   ` "`  "  㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@ @0 '` '` '@" ''`㿘 >V@ ː h @>V @P >V@  :  >V @E>V@ ! @ * @(>V @6!@>V!x@1>V@ !@ 2 >V@&!4 `* `&>V`     &  ! 7 " @A # ``(` ; 㿘\'H `>V@ Z"d 2 >V@ S"@H *   >V "p@ >VH"@ɔ>V@ 9"H& @ >V#@>V@ *#P`>V@ %#x @: >V#@>V@ #@ H>W@   "@?          >W P@>W@     *    " S? L 75`%?@  " ` ?@    ` @8 ? ^@ ]` `y" v :  "@  F? ? 86`%@  " ` ?@    `? @`? @ `$ `-" * ` `    &  !>V  ,H@  #d "㿘  >W@   @  @@3>W @ >W@ !(:  @%>W @ >W@ !` 2  @q 2 j K @ ; C@2  2 `""`"@@ >` 2!@  2@  ,@   $` $` "  $@" "$`   @  @Đ>W!x@ *>W@ !"  "`@[  " ?& $ 㿘  * 2 !>V`"`'   & ` ! " # 20  뀎` `"  "` !"@H /f  ` * ' `> #$@_*`H 0  & 㿘 `>` &`  &` &@ " &  '&`H /f * ' > #$@ڒH 0  &` &@ " &  &`    & 0H /f * ' > #$@H 0㿘 2>W@ ِ!>W >W ! @ Pb   !>W "0@ H  2 㿘`%`a>  "         @) a& & > > "`">      > >   㿘>   Ho o  $%> '>W H 0E #`$!h  "  H 002 @‎H 0> ` ?"``  `$  @&`$ ``     " 8㿘Ho o`>  ``  > H 0  @`H 0  R > > &l>  "8"    `2``"`H  <`` " ``@ 㿘>  `>  @F? ? ۧ? > B`? ?$? Ӓ  }@0  ~@w@=?0?@< v@)?07H >    H `6#">  @">   > `"` "` "`> (" 㿘` 2 @ Ā2 @>W@ @" 8@:>W@ 9"&  @ 8" & @@``"`& `@ "@ &@" &&"&``@# d @2 4``"``"```"@H/ /> o @ʒH 0 4 ? `& 4 &  `"& ` "@& 㿐\ 2 > &"     > H#$  $ $ $   =$  ?`$ $ " ` ( `  ?@  >W"@& & &  & & > 4? & \& H& 4& (& ,& 0& d& `& & & P& @& D& & & & & & & "4 & L>W@#  & : @ %> o @& d & #> &  T&  #> & T  "?@O&@J& $ '@  & 8>W>W>W# c0x@T!I@'D & & & & & & & & & & & & h` 2& >Wc (   \#\> o>W c#\ L  R &b|& "@"& T & X "@$ 㿘 T`" P X"`X X"` X T"@  !> o@   D`" >W@ #  ``"  "`> &"" " "$ 㿘 ܀ "& >W \@#& ܁㿘> "``"`D>W@ܐ#`D`H@>X`\@Ӑ 2!``܀ a`€`D`H@ a "S``` J`ǒ` E>X``@@ @` 2R `@" `\>X@ 4 H>X@ p@t  `d @`H/ /> o H 0   @` 2`D`2```  z$``$```\   `h`D@}` $` 2`@>X`\@X 2 `\>X @ݔ >X@M p7"" >X`\  @B` "`$   "@`@`D $`@$`D `2  `Ā 2?>X@(!($`   `"$ `8">X`\@!H` "`$`  "@$` $ ` "@$` ` "$`  "$```@ `( $`@㿘 P D` @ \>X@x!p>X@! d @"  `2 *  l` ``  ``2` 7>X \@Ȑ!b&@  &` " # #  &` #   @ D` ?& & @& D&  `  ?& ` ` Đ & 80` `2C 8  4  0 &  P `" > 0K` "`&  "@# #  "@& H /i * * >  T T#  # $H 0   ""&   "& ?@` "`&  " # " & &  # & 㿘C㿘 8@h@d :'> o@  d @ @H/ / + H 0 ` `@ ,@  , `& & ,ˢ , 0@ `& 0 㿘 P` ? $>X \@ې! d @2$ ` 2 *  l` & P` 2 *  l"` P` 2 * " l P` 2 *  l&  & " & &  &&& &&& &$  Ĕ    & Ė@ & & #@  8 @ ??& @7"" " "& " ??  "&  4   & 4& 㿘 @ (@7 '> o@:   d @ @H/ / o H 0 ` 2 `@L  X  @  ( & 㿘` & ( 8@e 8@a 8& ,& , @ (@㿘`  8@M 8@I 8& 0& 0㿘 D@  & & & H& `&   8@/ 8@+ 8& 0& 0㿀 ܀ € '' %> @5 H /i * * TT ''H 0  4 4 ,@.Ф"@'> &  2 " ' $" `'@?℀@&  @ 8 (" K  4 ,@耢` 1 %> o` "`' "@  d @2 `"  "`  "@H ) H 0耤 2 㿘 H /f> o* '> o  > &"|" "M H p@㿘H &* @  H 0㿘@ *   :  l"  p"  c" `@*  ` \>X "  $ƀ d P>Xƀ"P (>X ,"` 0ƀ 4 8>X @" Dƀ H >X "Пƀ  >X " ƀ Ā 3   >Xƀ#0 " '>X @  ƀ $ `7"#>X@chƀ``2@ 2   2 >Xƀ# >Xƀ#  `>Xƀ# d``>Xƀ#`.  *+>X)>X  ƀc ,# 0 4ƀ 8  "'>Y%>Y  ƀ  .`@`ƀ8`$.` 2  2 㿐 `T ->Y P ` @   d @`>Y @@`\`H/` 3 7">Y+>Y)>Y `"``@@ǒ`` \@#\>Y@/    ``@@` \ #\@    ֦@`2 P "  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @J` "`$  "㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 1  , 8 $ ,$ 8  >W>W>Y# c0@@&B ?>W>W>Y# c0`@&C* "  2 " >W>W>Y# c0x@&F "$ 㿘  2< 8     23&  2 H /f * ' > o  H 0  @703@~U L 4`& 4$ $  "@  & &  8 & 8 ` `>W>W>Y# c0@4&R*`$  @ " "@ >W>W>Y# c0@%&U  "& 㿘 $"  (€ 㿘  m  <%>W'>W->Y+>Y)>Y 8?& 8    0@@&B? 0a`@&C* $   `2"  0!x@&F  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' > o H 0 2 㿘> 㿘> 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' > &"|L  ' H 0   2!     0 0@ \   & \㿘 P@€ 2.` ܀ €@€ H /f * ' @. H p@ 2@ 㿘 P €      `  ?& ` T 2 `y  ?$ 㿘  T`X"`X& XT"@"T T"X "& Ր  &T   &  㿘6` H /f4 * ' > %c(> I@5H p@㿘H /f * ' > %c(@8H 0㿘> :`p> I6`p@ 㿘> :`p@!p8@@@@@@@@@t| 80Н㿘>Y!@ 㿘>Yb0@G 㿘> : #>  `8@?H'H 'L'P'T'X ! `!> o!ؔ @$`8>Y@r"H@>Y@l"P> &b܀ @3eFN@ِ㿘>Y"X@Z> &b䀢  >YF< "x㿘'L'P'T'XH/` /@   @LH p@>  `L  @ 㿀  <@A >Yb@GO`  >L @3  L   > @* 㿘'H'L'P'T'XH/ /   @oHH p@>  `H  @_  㿘>  8`> Z" (`  `> Z ( ````@7  ` `> Z`(""`(`- + ) ( >  `# >  * `  " `"@ &"   "" `> Z (` ` `> &"@`Dѐ㿘> "'H'L'P'T'X`,  a   `   @ژH ,"  ! `" @"@! 㿘  @? "@> z" 㿘'L'P'T'X       @3    @L㿘'L'P'T'X  @L㿘'H'L'P'T'X   @H㿘!> &"ؐ 'H'L'P'T'X$"ؔ  @nH>  8`2$"$"؁㿘!> &"ؒ $"ؔ @Y > `8 2$"$"؁㿘'L'P'T'X  @DL.㿘!> &"ؐ $"ؔ @7>  8`2$"j$". 㿐'P'T'X`?' @P*@?㿐` ?' @ *@?8  '`' '   "Q. N N % 逦``8  ''? N `ZY>#*` €` ? ? N ? ?L@  >Yb  >YbW O3>YbLO ``  " . L )L 쀦` @L@? * :   1`"̮ < ,*@ < ,L@  ".`L@ ` L@ 4`L@ `U`  " >.I >̔DN`> !` !   ?    @?* : ?: ` - ,@ `>Y"'  x ?     @?* : ?:   2  `` -`" N  ? ' '  +N`*   ?&?NЀ   , * ?РNЀ  &֢?ՒШ  , * ?РNЀ  ' @N l2    ?/    ?``    @?* : ?:  ` -` > !   x u o  ?=t:  @ ?m" ?h2    ?   2   @  ? ? ^  ?>Yb '  S x ?`>Y"  @~ϔ "@ @~    ? 2   @  ? ? # >Y">Y" ' ?  2   @  ? ?   2  `' ?`"R' ".  5,A>Y 4, 40 - 806 03- @~! `0- @~c  8' 8'0-,4   4 - '"'@~+ '?`Ӭ/  @&+` ` 2`@  ' " ? `2 ' ".  ?< `  ".'Ք$  `  0" 0.`  "v. 2" ? 0`  0 "]. ?# (? 0`  0"E. ?2 M "2 .k퀦` # ٠? `  2..N ?N`2&㿘` @@`% 2    H /m * . `"` " @"`"H 0 㿘   @ &@   @{ * 2`      $  , & ,> b "`㿐 , ,* ` @ $&@   @{a * 2`@   @` ~ɔ   @7~Ɣ  h|h\,<Ll|8 hDx0Dpɀ㿘> $ + > &> .((S7> &#P4P&.`(@2> &"b .`($ " $> & "!"㿘!> &"  > &# 2 ">Z @ٹ>Z $"",`:` `q$"`Q > &> & > &@"> `( "㿘>  h>Z`0@{ߐ1> &#> &c  !>  @{Ӑ}@{͐#@&#> &> &  >  ( > &"#"㿘` > &"쀢 " >Z4 >Z  >Z>Z| @0>Zx 80u H㿘. > . @> *`!$@ >Ze PV `*`>!H €>ZV X 80 >ZT X0>ZP `0>ZL h㿘> &b.  >  > &b*>Z x80y*b:  > `t"& *`>  (*`>   x >Z  0]": $. >Z 0T@> *`!$@>Z  >Z V? >Z V?"T #>Z`V | V?T   4>Z>Z!>Zܐ!> c* R  > #X  '>ZV* ɰ ;V? >Z! 㿘N -    N 02% N x  X2   `     ɠ    *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +> &J@    `,`b:  4- *> : cX,`: @z42 `@} "`* b:`@ - : ? &@?㿐%>  +>Z)>Z'>Za0W@!8 (@wLJ@ "` "` "`J@    &@Ð@   ؒ㿘> &" 4> &. j< %>Z#>ZX@ׄah, :``y`Y`n`N, :  y YȐ cՐ. > a$*  `   %>    "`$`" `$@ *R@? @ `R@?, Ԕ  >Z]!p0 }0R@? > #X T* \ @T?`>Z!R  , @y % ^ >Z, >>Z&!ܐ0T" >Z!0K>  t 4D>Z. ɑ< %>Z#>Z X@ah, :``y`Y`n`N, :  y Y'' c4!> &  t*`>Z@! & *`$ > &?`(* @>Z֐!>6А 㿘> &" 7 . @> !$*`@R` "   "  >Z4 >Z 2` 2` >Z!>Z . 3:  >Z! >Zϐ dܐ>Z!0> &" > >Z"0 t  >Z& ?> `(* @>Z"(z0w 㿘> &" 7 . @> !$*`@R` "   "  >Z " >Z2` 2` R!>ZN . ڑ:  >ZF! >Zv e>Z;"P0> &" > >Z"`10 t  >Z& ?> `(* @>Z"!0 㿘>Z"#> &cJ@ j c,@ @@x3)>Z`  %>Zآ`` c, @ ?* : `2?*`>!\ €>Z"08>Z#04>Z#800>Z#h0,>Zܐ#0(>Zؐ#0$>ZԐ#0 >[А 0>[̐ (0>[Ȑ P0>[Đ x0>[ 0 >[ 0>[!0>[!8!hc,J@c㿘> & ""%> &#> , : S `t ? ?$㿘> & "" #> &#X,   >[!Xb? > ?$㿘> &"> &   P"b> > #a$* W ? > .#:` ,1>[T- `2@^@@" V. :``e `s`d :0 :0  d < (!`   T?͢` b$?> &"b㿐L@?  -> &L@    2`L@,L@` "`` "`` "`:  4-`*> : cX,: @w2 @z "* :`@ -`: ?2L@>[͐!x0    >ZL s0!@㿘/ ?  c > &""> !$!$`Y'> .:   @v`2L $ @z> 2D $.:    T `` 25 $T 21 $T  2+ $ *?  d e c >[!` f>[!` $ $  $,`:  $W?  $ `t @6A? .> !> &: `("%>[,`@@y ,`*t?  d"" e c " f" ot"tS t* ё: t? `t@̑,`?  c> &?"b㿐NN    2 NN "  "  " N >[!0(  >Z.`.: j:0א!@㿐?'> > !(' )>[ɐ!А@s (LL "  "  " L < 2$L> &"􀢀 >Z /`* * @@yA  .`:  a>[!` ' ? q  И f ` Q>Z}!@` `h@oh $> &"> &b   >[e!0=.:  > >[\"04!$ `  @u{`2 $@x " $ 2 >[;"@0>["`  a`̀?$* *$`>[` "' '`'` '`'`'`'`''77ڒ i<̀?= aJ.G: ,D: Ba" !̑+` * > a$ $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?>  T(Ԓ@И$*`# ؔ@ "܀"" """"" >  X R   2 >  $`> ̖   R  @  2 "$ %"` ? @t`2$@x) 2 $V  2$V4$ 2$@   ? @t`2$@x 2 $V  2$V4$ 2$ !@tq`2$@w 2$V  2$V 66 $ 2`* : 㿐N  /> &N "  " N - N    2  J@ ? @t'2  @w "  J`NN "  "  "  M@ [ >[֐"V *` ?* : `2H*`>"( €N >[">  >Z> &4"#N >[", 7  >ZW+W N ے >Z ` `>[> &"">[# N l   >ZWr c@$f 0N &4 S dذ  ϰ ږ >ZWK dN >[:#0   * e p   >ZW" eN >[# Q  * :   d>ZW fAWv ذ 0rN U>ZF 0k qJ?0fN T 0_ʐ\ N  9>ZN#>  -%>[$`  *`:   2 NN "  " N   `" ܐ t`` ``P !@ > &\>[`?p`"\>[#>[#  >[# 㿘D#>[>[x#> `@tcА@p ( H >[g#؁    N - 㿐@ F " `  `0 "`0`#\`@  hВ ?'''''쀧 '4    @`2''  耢 ?  #2   `  &  \ Șh \"0,?`&00㿐@  " `  `0 "`0`#\`@  8/    $  =  _  '''''sϔ N'   '  `=     @`2    ؔul  耢 ?  # 耤$   ښ  \" 0,?`&0m0㿐@ J " `  `0 "`0`#\`@  h '''''''쀧 ':    @`2''  耢 ?  #  2 @  `  &  \ Șe \"0,?`&00㿐@ ݒ " `  `0 "`0`#\`@  8/    $  :  f   '''''r˔ T'   '  `C     @`2   ؔth  耢 ?  #   耤$   К  \" 0,?`&0c0 @?    2`0b b> H` @ ?* ` @  * #,2` Ű  0 $ 0    x `r' 2 0 @i   `$@ b|"9@"{"[T m b}b~2f @ 't    ?4    b~te@ 't  @  ?4    b}tQ'tT    ( "<  "@ `A"D   't 2! 5  't   `vt) 2  ( `<!$@ `w@ $@  2  0`q 0 ,?`$ 0y 0` 㾰@ 82 - - @,  @iD-  ','0''' '(88@i1 Xx','0?' '(` (q> 2,` ,q5 2,` 0q, 2{,` 2q"  2q,; k H /i * * >  HА H ? @ ' '?/a  ?H 0%>  %> ,@(%,@j 28, 24,`   $+,Ho o,`@ H 0,%,> >[ !ј H 0 ",,? ?%,  #" 2(``" `p 2``p 2` ` p 2( 㿘` 'T 2 *   6<`> &# 4* &@,C 2 03  $ 0 ` -`   4`*  `-  & 0 ,?`$ 0? 0t " ?@&ԑ- &͑4``@T " 㿘@ 4 "&@ " &@ l>  @2&@` 6`㿘 3  > `  "`> 6   "&Ho ol>  2 ,J1 έ 0g 0 @ ?",H 0㿐  'I ,`2 < 2 0 2`1 $ 0 > &#> &#  T`@ `  "  `` @4`  0 ,?`$ 0͌ 0 &,&p>  a` `  ,  ͔ @ol @ `2`@  <#@eː* "**%@ *"@ *`@ *`?kЀ f H /i * * >  HА H ?А @ 'Ѐ '?/a  ?БH 0/>  /> ,༒`@$,> 23,=ж $+,Ho o,`@ༀ H 0,$,> >[ ! H 0 ",,? ?$,  #" @nݐ 2@ 㿈!>   Ē =@o 8@jǔ G 2 > &2` #"`"(& 2.2 2` " "`(&$`@$ @, ?",`0?"`0`, ́`0, ?",`0?"`0`,  r`0 # @`@㿘> :`p@ & >[黐#> o ؐ "؁㿘&  4& & && & D& @@& H 8  4& 0& (& ,& $@f# #& <㿘( D! #>\"$ D!` B   D!" D !$ D z H O$ H  $ $ " $$ $ @ V  ?$ DO D ~b$ D |$ D & # D>\ $ D!  2D H D!#>\"$ D!`  2  D!a$ D 2* H" D" D  " @ 8 @ 8   , "  D ~b$ D |$ D˥ 2 H@[ $ H?  $ H D  ?$ D˔ !T@8   D  ?$ D˅ " ! D @ ?$ Dm  D   <#@    㿘 ( @   D "T  ##> ` 4   8  2  ` > oc> :" "cp @ `@$ `$ $ $$ $`  2( H D!#>\"$ D!` @ 2  D!$ D  D ~b$ D |$ D  H $ H  "@@ $ `u s %>\"$ D!     D!$ D 2 H "@@(  D ~b$ D |$ DА}@ "@ @4  ; 2, D@    " >\ $) 2 D   $ $@"$ >\ P  $>\ h D ~b$ D |$ Dʋ 2@ H5 $ Dʀ  3 # D @ ?$ Dj  D   <#@   " D  D>\ $ D! x 2 H D 2    D H  H?  $ H D  ?$ D?   D  ?$ D2    " 2@ݐ ,  D @ ?$ D   D   <#@     }@  ( ~@ @ 0@ @ 0D D    << "㿘 (`  @``"# D3  /  +  D '0"$  D 2   " !  D @& D 2  "  D  {  D @$ D 㿘`(@c{ `6`  &`@    @ C B?@c>`0>`8 $&` (*`" *  * &` ,&`  0*" *  * &`$ 4&`( 8*" *  * &`,``&` ``&`㿘 (@ $ (㿘 f D @ ?& D@  D   <#@   " HԒ  H !>\5 D`& D   I  H` @ "   D @ ?$ D  D   <#@   " D  D`$ D$ @ ` (> o> `?"`> oc> :" "cp @н >  `4(R` @ > &"`8"` " > & "`8 "`"   4(R `@ `2 "``2`  `2``"` 4(@" D2  `" `D  2     4(@`" `D" @  2 "    ` "   㿐> &b> >\#\ Ě` L   HH$<<$$$$$$$$$$$$$$$$$$$$$84 X@  ` 2 ,W  , O #@`#0>#*` € 44@&"? (<    2!"  4: , 4 2&> !l$&! (  H L 1 2&0&@`#  >"*` € , ( H$ ,4$ X`  '` :Є@   ?'''''''' @+؀`&` i  ĘВ :̖ '''?'''쀠' 0 0' ' @̰" `'il 0`     $  , 2`@˩``" @f = ?)$ `     $  , 2 @ˎ  H?$ `4 X "  , > # ,*@$ ,$ XL 1 2` `4!8\ `Y 1U ?R$  &`  , H($ ,`4@$ X &`  @ `    P?@ ?'''''' @$ @ 2` Ѐ   !?@ ?'''''' @>\ 㿘 (   @9z 㿘 (   @7- 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    x" ` x = 3 3 3 x1  L # < # @`$# D <  "  2  " i r   @   ` @   @vɔ㿘 (H /``* !`  ``"H H0Z" |0W L \@   V 2  8 BH 0F  "@  " 4      `  8  H 0#    6   @ H 0  l x 6 xH 0 㿘 (@_ `06` `  @ 㿘 (  @5$ (㿘.   `@ 02 ``@l`  ``@l@    2@ 2` 2` 2` 2` 2`  "` "@ "` "` "`  2` 2` "`㿘> !X    > *X`2*X ">\⠐ #@$> >\☐!!  >\⑐! X ?422@ `X`> 2a> "a>\v!0`  >    "`"" ` `  > > a`">\Y!@X  "`(2``\㿘  (> > > >\V > !X` > P6!* 2  ` 0 6 `&6 `"6   2V V ?"a>\!p& a㿘 &`  L&` `D&` $ &` (&`  ,&`$ 0&`( 4&`, 8&`0 <&`4 @&`8 D&`< HhZ&`@8 ?@c ``> !X  6 * * > " a*  (`"~ V@  @2x "4 0n\ 0k e `" `  $" $ $ $d@`2` " $>\ᢐ! >\ᜐ!5$ (A  =f1 \ 7 (@X` X-  @8' ?$ $ >   a  4 $ (H$ Dg!  f \  "&㿘`  @`) > X  . > * a"*  (`"  2  ` f& K  a. "> Cb?  > X . > * a"*  (`2  "2  2$ $   a$ > $   $  `$ 4 4 $ $ $ $ $$ ,$ ($ 0$ 4$ <H$ D ?#*`@& 㿘%?@` ``> aX  * * > " a* `(`  V@` @    @d?`(%>\ 8 `` "  @  @  > a@  > a   h  b4` !ؖ ? ` 4` ư `( ˖ b">\r!@$>\l" >\f" 2b>\`"@4`? 4 4`)1>\!>\ᰀ> O"pPI">\D"X  &> >\<"!*  `0#3 4 dΔ  S   ې`?! @;4`' /> ->\+>\X  +`: 4 Ȁ@bh@d %> !.` +`: ?"`>\"?a`( 4`}( ` 2`$`  #`?! @4`j0"$``> "`  `$ `$` $`$4$`, HV$`4'㿘 ?@c` ``}`> !X  ɰ * * > " a* `(`V@` @ ! ` A @" `")$` 1$`>\t#` * >\   @4 @  "`   "$`T0 $`2 $`>\M#P 2  0>\ؐ!  ` `(  ?V@c` S  > ` `$" $` $`$ 4$`0H$`< @8 c    09 #ɐ03 *7> 5>\/>\!X%@  *: 4p@gِc > !.`  y'@ d<$p8㿘> !Ѐ 2> >\ǐ#!̀`> >\#4    "`2`4`@a4  > > !̒`"@`d> "!ā㿘 > > 4` `> !̘ > ` 2 "@""`%2``d`>\Ė `R` 2 @"`" `2R`` g#`̒4 㿘@2R> !Ā2&@2 R "G  2&@@ R @)  2`R2` 222R % *`: @2*  #  #  @ݔ  *`:   * `2 22"  > Ā1R @'   2R"S  (8@ 2( " ?"2 R`@ޘ 2R㿘 &`  06` `(&` $ &` (&`  ,d#&`$P ?@c ``V` > !4 6T > !Г,  ""L V@  @2F  > >Ð"<+  € 6> !> ' " * @*`@ *`@*`$@  :` $ " @ # .` *    @* @*` `" `@ "`" 4 @> !И"!4  !4 *` * ""!4`@@4 ; aԔ  aΔ @ ?$ Ė$ >   a  4 H$ (! a  a @! `&  @6 ,` * @`! `&  @6 ,` * @`ߔ! `&  @6 ,` * w@̔! sae  m  ` @c.` @ a[  ` 0Y! U`&S  @6O ,` * @E`  A`?  @;a,  4,`@*` 2 !~ %a    ` @ .`  @a  ` ?[   "&㿘@  `1` > a4 > !Г.  ""  2   !> !У.  3@ q`А @&i  &\c _ `> !4 @ U > ' "@ @ a4 a4> ! b" a4   `@@"2 a4#> 4 aС. "?" "" * > " 222" +`> `H * .`"("@@#@XJ*`А ? *`@ & p`?c` @'L '> !@   > !Г- "V@ @    - ` `+* " 0   7  @@*` * U` `` # * `2  2 `2 @ ` 2   2 `@2 `@ Ϛ`@D`$`ښ @?* @*``  " 2 `(2 #U` 2  4  4>\! ՘ '" ?V@c "U`s  2 ?4 ?4 M @\ܸ 5=R 9@  0Ԡ , * #>\@"?V@  @w "?ѐc蠄? 0  * @*`   " 2 0` @ ` @`*` * `4$@ L:L "㿘> !!  2 <T  $6 @62 ,` > aЕ* V bV >]r &>]k ( + @ *  @@ 2 @ *` 2 T `@԰ $ $&P%%%l%l> ( @ 6?> "`2` @ 8??@ > (6 * > ( 2  :`   㿘#> Hc 4 `@@*@ & 4`> `!ԡ4 > ܒ"@#!Ԑ"6 "܁㿘`?# @> ,`"* > Hc @ @*  ?&` $>  H*`$ ,  4 $ $ > "!ذ 㿘   > !       ! ?! @@!  "    㿈 ``> !    *    ?`"@ ` " R@ 2`f @!!w [> !   `  `?2  H > H# 8 `     ``" #  @?@2, '@̒  '4@<. @ @ #`#\ @V  > $@@ $`4$$H 4$$(&` @ 2`P `8M >Ȑ l*` €! 2@`] 8 9 7 20`] 8 2)?& ̖& >   a  6 H& 0 2 & V $$` 6 @?c > "ذ 㿘> ."* @  d@4 >]H!$ ]  # ``"` @ ` && ? #*`@'  㿘> !  `'P >  !@  > H > *@@ԑ: @@  t > ؀`? @ > />  b2    `@ `8@""`  @  >]6 P"ؠ > /> , $@,` ,5 @`?*@% 5     ?c ,  @$% 4% $ c (5 % % `%  45 $% % % ,% (H% 0@ ܓ:@ !Ԑ &ܔ P&!" @  ?Đ*@5  㿘`@` !@   #`" C㿘 > (&`!   ,   ^&`  > ?!c`? * "@*` `$ 2`$ `㿘 > !   @ 6  ? `@  3 & 㿘> H#!> ! `U! `  $! > !"2`2` `8> "!> > "a"!ԁ㿘 &` &` &` $6` (&`  ,&`$ 0&`( 4l&`,<< Z`(""`(@  & x | ` 6 @? "@>  |Р" & p& | 㿘`l *`W@`(" `H /e4* &@ @ ߐH 0a > "`DB:"` &`D> !`$B:!`&`$> "?`B :"7` @ . 22W @  `x` @2*`p" `!@ ! "!@!  ( 퀌@`@"`p@`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@ h`p &`p ` ! @`*@&`@  @ O``( "`@ `&``6 2  ` 2 `@ @ +  `x 2   `@В @ `x $ `p) 2 " `p2 `n> Z*` * " * &`p { c 0v 2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@8`@ `p2/  +`V``@` `"`p@ `@ ` `p@ p` @ k``"6`@`6``p>*@&`p 2B  >d< b`@ ^@  ?"`p@ R@?  >]   @@ @@א?   ` @@|`p 2  d" @ ̐`p 2` d` `x @2v`p@ pr`p``( # V``H 6d`p @w_`p@ [`p`@< S  @ @ ԒK`p   2`ހd  6`@`(@  `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@  2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@ސ㿘` 2 > ! `d``B ;! &`d`H@ ۰? <  9 `5 `ܔ   "$ H /e * & >]`H@4!> a&`d > B;a&`dH 0`܀6`?  2?  ` > ! `d``B ;!  &`d @a`H " 6` 6`܀ ` 2 ` ?  4? 1@`@.@?`>ː *` €  ' ! ^ ( ) \? @> a \`dB:a &`d@`H =`@ > V`܀ "2?> ! `d``B ;! &`d@`H  >]  `?`V`>ː *` €4 6`` " 6`  ?6`ܰ?0 `@#`}@? ] r@<#> ``^@F!> ' \`{@Y`z+@@+#> ``@%`e@ `u@#>  ` @ B` @`@< h  g@ #> 3 `@/`@ -#> !> ' L  D bܔ! @@ ֘ C! |  ,` hx ` ! ! " h@"7`n@R`@? `@#` @`^@`a@@" h `o@t"@fs@.w@ @> ' "}@ 4 "~  @ ] r@-Β@Ӑ@iƒv@ b@ge@  g@  `@`@ 0H /e4* &  p p ?$pH 0 H /e * & @&H 0 H /e * & p$$pH p@j ` ` @a  4> Z (  " >] p ( (>]O >]! @ '''''@Pg A@sE` @@sΒ!@u2 @V -*$ (> Z`("%"`($ @j " 0X# , &666 6! | 2  , 2 x !:H  x " ߐ#H /e * &  $H p@ް H /e * & p ;$pH p@Ȱ HH /e4* &#@  @   H 00 @2@@  : Ѐ€ " pH 00p2   2 $ ߐ"$p@$$$($(` |   ͒ @  @"<  ! @4`$@h-@( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $W H 0  !X l  hH / * & > ' x*`  €. €  h*` €H p@0,hH 0а H /e * & pa   * ~$$p@H 0  `  ` > '! |   , > ' h x*`  € H /e4p* &p n> Z*` * " * $p H 0g !  @a  |`"! @ W `" ! @? "@> |ɶ" ! `  "! ` $|! $x!  "`  , 9' ,s! | 1  , -2 )  & #$x@z  @R3   4 44x4  @W  㿘2  *@ *`> Z"@ *` H /e`* &` `"V 0@   @ p   0 H  H 0  ݒ H 0 㿘6  * * > Z" c* `@€V`? ?2  > ' X`&`8> ' h`&`8&`> Z*` * " * @ <H /e4* &   "2 "H 0 㿘 >> Z*` * " * @ <H /e * & @_$ H 0 `p@2    4    㿘 >> Z*` * " * @ <H /e4* &   "2 "H 0 㿘 >> Z*` * " * @ < H& R 䀢    㿘> &"䀢`>]a@ʐ  @" @ !  (    " 㿘 H /e * & # "'> '@ H 2 p p * p`2  " ̀ `& p H!P@  H  p` `2   ̀`H 0㿘 @ 㿘H /e`* &`  (`" @ R ( `" p@ L  p>*@& p6 @6 @S`> Z n*  p* " ~& p* € H` H@ *fY H 0㿘> '  T  㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @ 1 H 2  p`@@3& p @@ Ԁ €   p @& p㿘 >]s!H /e * &  p @ & pH p@㿘 ̀`@ 㿘`D 06 㿘 p"` @` & pސ5 22  n> Z*` * " * & p !  p ` & p  @2  | "   "˒   `@q& p 㿘`" p p & p ` & p  @2  | "   " ے   x> &"䀢`>]a@    p*@  &  & p   ' ' '''''& & & @ O  p *@& p㿘D 㿘> ߦ"'L   ऑH /e4* &@ H 0 | +,'x#   `  `  > > 'bܖ@!@H `ऑH /e * & a;>  U, @GU  &1p0z  )s`   ) >Ւbʔ ɐ ]` `W` "p0Q( N(p  @  L  H 0  H 0 #> ' H> ' 8!@ɘ H 0`" ` 2 #   # p ) #m`&ऑH 0%> 5> 'E 2  d$2 x  `:ܖ@!@ 2 2 ' !       d  @  6 H /e4* &  @H 0`4  㿘> &"䀢` >]a@_  p @% $" "  @ Ӓ H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` > "`  HȀ@$@"'>]`> "`쀢"  pH 0 > ` & p  H  H@H 0 0` V   H /e4 p* & p*   @%  H 0  > 'H 0 #8 !@ H 0ဥH 0> "  | 2/`, "+` x& @" 2!` 2` 2`  v   > > 'bܖ@!@Q g `_  @2&` Hc d` 8 ` 怤B) '> />] @P2 ?6 @ 6< H `8 H40  H@ \6 ޠ$ ܚ@  d< C 6 ܒ@<& d @$  H4 ``2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #> ' & pP H!@ H 02`0 㿐` h  *@`{&`V`ހ &`ސ> >]   `?f>ː!<* €@} w`` @"s`ސ@t n`ޑ*`:  @|0fH /e * & `p`  V`ܐ`` &`p&`@ +6` @@  ` `p** &`&`pH 0V``ܠ$  6`ܠ ?,%`ސ  ? `>]!’`ހ` `p 2 &`p \@c``@^`ސ?6`ށ㿘` ސ ې `㿐 @@̐ H /e * &  (@    @'@ { @  @@ m  p*@& pH p@ 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^l  @ ?d㿘!  p   xޔ #  w @2``@2@?㿘 @C 2`@: !4! & 6 6  (  h* h 4(  4@L 3* @*`@*`6 㿈1 > J #>]*` ,  , $4 b d@CL d@Iɣ | 2 x>] b `2`>]b@  >]b`ɏ|6 ަ@y 2 @ L1>]4"`   >]">]" n cДb? '?/!`''' @B>]Nb '?/!`''@B!>]"7h d* * " *  * $@Bˑ2 L1>] 1` "Ȑ   @@ 6 ށ Z  1   `1@ "H 4 ```+8 1`4  ?@ ") $ `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 ƐH p@ 㿘 Ƙ "V , : @ ?>   >  㿘&> & "@"> >Ԑ "c 㿘> a? "a>]ܐ"`"  "`> "" "㿘  >ǐ!@CJ!$ @ $ @ ( H$@ 㿘@3 @1 (@/ Hi >㿘`   >    -0   -0>  "!> !> "?㿘 $ . ,   v> "b@B> ""㿘> ? 2  @ ` > * b*   ^$ p p  $" ` 0B"$ p # a %$ $ $ $ $ $  ̀ " p p $ p p`2 hb`$ p%> ' !8  p `"$ p h> '`x* @€@  㿘?2  . > "@*` > ' h x*`  €@ 㿘?2  > b. * > b ` "h a  | @ 7`, 3 x"0 (%)> '> 'a2c a2_  ` W   "ܔ!@ Ka  |   `,  x2a ( 2 (6 #> 'H (!u "`0* $ (` "  (@ (  (  2 (@  ( ( 0  > ' h`x* `@@` 㿘?2  > . * @ ̀   h> '`x* ` @  㿘 l? 2`  * @> *` p!  `  * "@& 㿘 l? 2`  > * @*``    ?" `* `*``@ 㿘 l? 2`  > * @*`` }  P`v  㿘?> 2 b  . ) > b* @  @$@ ̠ ̀   h>> ' `x$ ̒`*@    w$ ,!$, 㿘?2  . > "@*` > ' h x*`    € p$ ̒ $ p0?2  . > * @@ %> 'h f # P!H + ] p `  ` ` L ` @  ,`@8 j,` > `" H `! "  H˒ 2,`!/ `  J``   d H  @ T  H   p  ?$ p Hإ 0?2  > . * @@   `p w   "l``( m`")`(  d@ 8 #"  8 p`p T @`(` `(#ܖ`(@f 5`U  d@ 8  Δ G`p + > ' ``( # ``!2 `h;``p `h* ?  ` ͔ `p  2`> 'P`! 5 "z`p`&`&` # 㿘?2  > . * @@p '` ``) 0Z= 0WH /4p* &p H  ! H 0 < H 0 p ` ` *  `! # ג` ` "(  ( #Ѐऀ! u` ? 0 * > b(㿘?2  @> *` *   `@$` "`  " ` `@, Ғ `((" `   `@, Ò ` 7$` 6  `*` * " > Z* >ݒb 2 `h i@"S w@"*  _@"Xq `h @M f@"3h `h ` @ ` @@ p@"[ `h `@U`@*S `h2`H> j!t@`x2İ  &       ?     ?$    ?$ E  `H@`H `h  ` 5 `x   `@ `h> '`x* `@@ ْ 6`  !@  `N, !  X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@, ֒ `"  2  "  `@    $ ,  0  `@ ߐ $ ,  㿘 > & @>$`:   > & @> &  & & && &  㿘  " @>  5 >  " &  ,:`@=` ' >& & ?H4($   "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 Gy& " @@ &@&  &  4 & & H 0$@ H4@(@8`2 `` ` `/`, a` $   `8(": ``0   ``HH(@"&"`  #  4   ""@ ""`4"" H 㿘H /e * & @`@`2` ` 2&`>]ؐ#$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**/+@` `8@ + "@8*  "  ( @ ( (+@   @ * +@ @ *   +@ +@  &+@㿘`U H /e * & @>`5` 2/&>]4#0$  ."& " " 4E  "  @@ &&@& & `@& H 0  > o ܀`   `@"  @" "  "@  8("8" > o   "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 000+?㿘`h ) s> "  4 > "  T 4 T 2 4T  &&  & @: `t &`&`t  㿐> ߔ 0" 'b@M 㿘 > 'a\  p*    T`V `  , .㿘`> 'a\ * R ! ` `   2  # #   *@ `# # S@ `   @(8(82??2 @("`J@("`J@"` @("`J@("`J@"` @(82 ` (82 2 @@`?22(8 08 (2J@("`J@"`?(2J@("J` 2 " ?(8* 2 J"J("J"J (2 " @ (#`J@*(#`J@:#`J@?(# `J@ (# J`# 3   3  3 ` `( ` (88 * 2 ` `( ` (88 * 2 ` `( ` (88 0* 2 ` ` ( `(88 * 2 ` ` ( `(88 * 2 ` `*  `(8: 0( 2 ` @((882 J`  `*㿘@  "@ "8"@ 0  "@ "*"@   @v 0w?# @q&> ' a\* R ` `2c  $ @$?  $?# @ > '*!\ $ "@ "x`@  " i`@  "  @ V`@ 0   @I`@  &? 㿘,    ` `@]?@^'@_ 0 㿘``,  a  ` `@]?@^Y@_ 0 㿘``,  a  ` `@]?@^K@_o 0 㿘`, a  ` `  a@ q @  a  `  `, ?#`,@^;?㿘 , " !  `  @^;? 㿘!>  > ( > 2b" > ;"`$"@pW$  > 1c4 "`$ `%> ` "```:` "`` 4* ``2`D >  $D> "T D>  "@ "#<> #> oc"#@>b-!> o#>bT&( % > " "2 :  R  4*R   >  "* "   2   : R  R 2  4R2  42 4" 4 *R  㿘`> *  "& *`2 *8    P2404*P *㿘>  ```:`  ` 4* ``2`㿘>  `> ``:` ( "`` 4* (``2`>  2`@ \:`㿘>  `> ``:` $ "`` 4* $``2`> `@5 9㿈'> > :`p#\ * @W > %> X"`4>^#\`!   > '#`#> #\cH>^`  ( !> p l > '#\ <O>  !> !㿘> `4> I6`@ݔ 㿘> `4@㿘H /f4> * '>  ` ``:` , "`` 4* ,``2`H 0> ߒc` "`㿘H /f * ' > "X  !H 0  6 H /f * ' > ߔ̗.`  2 H p@  & && 6 㿘H /f * ' > "X  !H 0 #6 H /f * ' > ߔ̗.`  2 H p@  $ & 6 && & & 㿘H /f * ' > "X  !H 0 ' 6 H /f * ' > ߔ̗.`  2 H p@  & && 6    @5@ 0 㿘H /f * ' T > ߒc̗*`@ ?2@  @ ْ   "# 8@  <"`< < 8"`8>  $#H  ( $ 0 , | 4 $ 0 ?4 > "XʒH 0㿘 K> ߤ#H /f * ' V * 4 @    "# 8@  <"`< < 8"`8>  $#H  ( $ 0 , |{ 4 & 0 ?6 > "X~H 0 㿘H /f * ' > "X !H 0 #`6 H /f * ' T`> ߔ̗*  2 H p@  & && 6  2`o  `#V @6 ` $& `& `& ` & `$` ?4`& `&  " ?@& & 㿘@  㿘@ 㿐` >^ (   2 $ 2 >^ 0:> ߪ"c 'H /f * ' > "X !H 0 "$ 4 H /f * ' V *  5 H p@  $ $$ 4  $ #V @4  $  $  $  $ @$  $$  "$ $   "8$    1 $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8$ 8 <$ #H !$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   $   8  `"  $ 0  " ?$$ $  " 8 $   =@   =@ 2&   >^ p  >^  H  > `0  "`0 > `0 "`0㿘`>^ 6>^>^ &@ ` 2  @ :#>^ 2 ڐ`ؐ" =5& 㿘 2`  2& ! ` @@ *` &= `  @ b& 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘` ``a  `@` `` &@V H /f * ' > "XA H 0 #`6 H /f * ' T`> ߔ̗*  2 H p@  & && 6  N& ``#V @6 ` $& `& `& ` & `$` ?4`&    ?&'> )`T*` 8   $`<-  &@@& ` " $` `$`t`ڀ`` &i> `,  "`,㿘`Q` h`( h@` h`   &@H /f * ' > "X H 0 #`6 H /f * ' T`> ߔ̗*  2 H p@  & && 6  eH /f * ' > #HS & $H 0 $ (  & 6 & 0& (& ,& <& 8  >& ``#V @ 6 `& `& `& ` & `$` ?4` `` 8  `;d  &@@& ` " $` `$``〤`` &> `,  "`,`&  (""@`2 "` 㿘 ` "@   @8  246``8 `$" ?ܐ?" 60 @" `"`$``""`n; h H /f * ' > "X !zH 0  6 H /f * ' > ߔ 2H p@  & && 6  2 & ) 9% ` " `$` " $  @@ 2@"@@ @@ 2@"@$㿘$   8  `s"H /f * ' > "X !H 0 R6 H /f * ' T> ߔ̗*  2 H p@  $ & 6 && & & ,#V @6 & & &  & @&   $"@& & $  a  `&  &E$~ G ܀ vH /f * ' > "X !H 0 ܐ  6 H /f * ' T > ߔ̗*  2 H p@  & && 6    " ?@&   "%   6 H /f * '    @6  8& <& 8$ 8 8" "X  H 0 #+>  4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $   İ 0$ $ `$ > ߤ# 9%H /f * ' bX H 0  4 H /f * '  4H p@  $ $$ 4   $ %@8(1 H /f * ' > #H~ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (8 $   2$ > #D @ 8$   $ $   $ 8$&@`k㿘 '!>^   ` 8`  `` $ @- 0 $ @-   @-  2 㿘`>^! >^>^! (&@ ` 2 א!8@ :$ #>^ 2 ːaX" @ ߴ&  㿘 >^!p&`  &@`  (   "      ( 2  8` `   "@ #@@  & $& &    @ Ԁ`0` 8`"   $ 0  @ "  ?&```   9  & 3 `` 8 `  $"  ?ܐ?" 0 "# ` "`  7`  "& H /f * ' > "X H 0 Q 4 H /f * ' U > ߔ̗*  2 H p@  $ $$ 4  .- H /f * ' > #H’ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   I 2$    6  "&   ~  $  $&2&㿘`I ` D H /f * ' > "X !cH 0 g `6 H /f * ' T`> ߔ̗*  2 H p@  $ & 6 && & & A ܤ H /f * ' > "X ! H 0 $ `6 H /f * ' T`> ߔ̗*  2 H p@  & && 6  쀦 21 H /f * ' > #H !& $H 0 $ (  & 6 & 0& (& ,& <& 8   d  `#V @6 `& `& `& ` & @q&  $&  㿘` `q o " 2 2  㿘s. o "@"   2@ "  2"㿘㿘`   `2   2  㿘      5 0 㿘˒ ``     2 "@& "@$ @` "  @㿐> >^ 8a#\ Ȕ   㿘> "h "d +  2V^ +Y )H /` * ! >  8ܒ @+C $  $ $  $ $4`` 4 ` $ `   $ `` $ `@$ $  @   `@u4 H 00`> j!t@  4 H 0&@ 㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`> (`@> (`> ( @&4`4H 0 㿘> &"䀢`>^a@3       @   @  |@P>  8ƒ㿘H /` * !     @ ͒ @X  2 @ Ò @N   5  # 2 @͐ 2   "   !!" %> (!>     6V  6!l "     `   @ `"  " >^!6 zH 0㿘> &"䀢`>^a@  `   @ 㿘H /`4 * !   >^k!Ȑ ?(6   ` 2  5 `  @ H 0㿘  , -H /`4 * !      `2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐` >   'Lb'H'P L L   P`:  U@ ``` '` 2`  `' `4 "`4 ` *`*@ Ґ`|0& H 0`5`8H 0`H 0`H 0` 5`H /` * ! ` Θ`8 Ӏ 2``  `$2` 9 2` 9H 0`H` '``| "@``" 4 ` `'d      (   (H 0u` = D<` *@ (L`$ !`@@! #` ? 5` ?5``@ !`|H 0 OPN`H 0P$@L > ߤ  #3> P ;H /f * ' bX!H 0 6H /f * '  5H p@ $ &6&&&&  &5&H /f * ' bX!H 0 6H /f * '  5H p@ &&&6 쀤4gGDgBH /f * ' > #Hr!&$H 0$ ( &6&0&(&,&<&8 (P > #@% @4  &h4( $@4@ $@P  L  " ?@&L  L` & %P `O"`` `` P` 2`` P ` 5`H /` * ! ` `   P@HH 0  ` ?5` 'P  P`L:` ? 5` ?5`C`P   㿈 ''H''X'`'&@ 2'X   ? !2+ r `  @  @  ~ ` 2^2& $" x      @  x   @n L  6 x H /` * !  `p  L@ k  \@ @e  Pa  ] ` X 2  8 L " 8>^!  I 6 8  =  x "7  "1 2V  2   `" 9  󀊡 # x ? 6 x ?6 x` x@ LH 0 "y x  >^>^>^!bH" ` xV `>^"`'H   R H"@c  L T" & L& T H0"@& TH "& `K&H /f * ' V> ߒc̗*`@ ?2@   "#8@ <"`<<8"`8> $#H($0,l4&0 ?6> & `"XH 0 `V  > ߢ#耥`   ؖ 'k  L T" & L& T  0"@& T` " ' `2'€'& `H&H /f * ' V* @4@  "#8@ <"`<<8"`8> $#H($0,l|4&0 ?6> & `"X~H 0 ` ' V  `!2V& `" & h>^>^>^!bp"V '!2"2   `  >^>^>^!bpc#& `& d& h   * 2  ( >^d" ?6  H "8 "82#耢`2H 0~X'H /`4* !耢  $@"& " 2  L T" & L& T 0"@& T%& `L%H /f * ' V> ߔ̗* ?2 `  "#8@ <"`<<8"`8> $#H($0,k4&0 ?6> & `"XH 0 ` ` >^>^>^!bp#G&& h& `& d& h@ Z % "@&&  L"& L H `2 @"  & H  @Q6 @OK@# 0  ,@ L " ` x ? 6 x ?6 x xH 0 2     `" 8  V `   ͐ `  2$@ L2 & `& d& h "& h` "   `  @ 쀢@2耢`   x ? 6 x ?6 x xH 0 x耢 2X`" x@"@ x ? 6 x ?6 xs xH 0㿘`  ``@`2      @ h L ,  @ 4 ,@ސ0 4 ,H /f * ' @ , ? 4 , ?4 ,- , ' ' ' ' ' ' ' ' $' (' ,''@" 0  4 ,$ $H 0   `@@ȁ㿘?#@'P  "Ϩ * `  @Pʰ¨ *"1`">` 87` *"3`@.` **` *   1`` *4 *Q`" ` 2 ``L#@4 6 `"| ` (x `` _6 *\6 "k ` (g ``$ "   0H &F  L |@d > L 7@86&  P@80& \"? ` 8`9 >  +> .`@ c & !.`@ `` 06 6 z `  ` ` @P `8㿘?#  " * `x@ vY  G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", \    "& P4$  "  07 "`&  "V0- &`  ` "@V `(" V ` #"@ 8"@6 8`"2V zV >   &` `@ $@&> -`$ 밐 *& 㿘 <  @v Dw l`4R`(2)  > (T> (d"`8 L> (t"`8 |H( $"`" $ ,2 ,H   4(H4p(p  "p`2``"`px2xH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4(  "`2``"`2H 4(`|` ``"4" `   2`8"`82,`   , 0  `&  4(R`2" R`2@  2 㿘   ;  6 @ڒ @ @@ L    6* 0{ 6@0 L   @& |㿘  6 `8e6 @ |@ L   㿘  6 h0O6 @ |@ L   㿘@ > &"䀢`>^b@ T 4T 2*T 0 @ @S >  8 8 @ 6  6  6  `6  &  66 6 <& < &  &  &  &  @& @ D& D @ P@' `   @  @9 `@ L   ݐ 6 6 㿘` >^5"&` 0  6 0 2  6 2&``&`(`(&`,"`"``   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @D |㿘 ` 6 @; L   㿘 ,!  @6 , > (R . 㿘 ,  ,#> (  @4 ,! ` u " ,    ,  4 ,㿘<` `, ? 6`, ?6`,> "  D <t @`$Qʒ 㿘 |@" @ L  \ 2  & \ 2 (&   8&  @* 7㿘`!> (    2* @ * @%/) .`  .`&  & &  㿘@& & 㿘` "&  "@!0 @n㿘  @"  >^>^>^"bȖ " @[ & 㿘`&`   a&& ` " `0@&   "& " & @ &@`` 6` 2 @/㿘`8   " R  2  2R @ !&&  "0& "`"& # "` 2 2@ 㿘 @ >^#0       ` #@ 4 4v @ 8r H /f * ' > "X H 0` 4`H /f * ' > ߔ" 2"H p@ `$`$@$`4``2@8 $` `' "$$@   a&&   " 0@&  2    a&&   "  0@&   "& " & &  㿘>^ #@     ` `# # 4 $#+   a&&  "0@&     a&&  " 0@&   "& " & &  㿘 `z `` ` " @ 2R R V`@  2D@& @B >":   8 `" $0  @"  0$  ?&0VV`@   &``  @ & ` @ &"& && `   a&& ` `0@&  ?6& >^6ǐ#P㿘 , "  >^>^>^"bȖh#&@4  2 "  >^>^>^"bȖ #+ "  >^>^>^"bȖ#, "  >^>^>^"bȖ#-  >^>^>^"bȖ#.㿘    > T# " &&   &@  0"@& H /f * ' T * 5 y   "# 8@  <"`< < 8"`8>  $#H  ( $ 0 , cg 4 $ 0 ?4 > "XjH 0` 2  >^# ( "$ $ "@& "f&  ^ > ߲# " &&    0"@& H /f * ' T * @6@    "# 8@  <"`< < 8"`8>  $ #H  ( $ 0 , b 4 $ 0 ?4 > "XH 0`" &  " "& & $   2 & &  "& 㿘 `[> `#& )> `  " && ` `0"@& H /f * ' T`* 4` ` "#@`8@ `<"`<`<`8"`8> `$#H``(`$`0`,`b`4`$`0 ?4`@"XH 0 2`   & & 㿘` ? (>^#-C  䑒   ; (- H /f * ' > #H & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 &  $ʔ` ? & `$ $$ 㿈 F - 2` 2 > &#"``@X` D G0"`(, ?",`0?"`0`, Ð`0&㿐 @@ ``@]  2 `( 0" 0`, `0㿐 @@ `(`0?"`0`, `0㿈`  `"    @i@ H o*@ a (      2!` #0` 8   6! ~d T 2   8    > ( 54 8 8 u4 8  v 2>_   E6찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6 0J쒄 p& L  2` 2> &#"` "(L ֒ `` 8' ! `!    CF0, ?",`0?"`0`, `0*H 00,?`$00㿐 @@' r`(  !!2``0?"`0`, d %`0` %`@9  2C  2=   !! 0" 0`, w`0 $0?H /` * ! #> (    8   6!` }w "   84 8H 0  ?4 `0?"`0`, >`0 ??" x @`` @`` vD1 h '2  2` > &#""(Dܰ 2K2 2` " "`('=谒 3` 2 ` 3찒 )`    ", ?",`0?"`0`, ~Ґ`0, ?",`0?"`0`,  ~Ð`0 AEt'AEm'耢 "쀢 p`` ``'` @'''''И''@6؁8`    (䀢$% ( *  ]ߔ 䀢* w  `@'@ '_ h'@M԰ ٢    '  '? '''' `! ' `@ږ   [   @   @Ė   @2F``$8  ̀`$"  ?ܐ"   ?"  `?"`  "  ⡔ '̀` ` ?` "`?  " "" '  @`2ܒ ,  ]%ؔ!Ԛ`( =̰ 耢 ?  #   mŒ `$'   T ^  0" 0`, }`0Ѐ p` z  "`0'`` `'` '`@''''Ԙ'@B؁8` Y  4䀢$1 ( *  \ ` *@ '*= @'@  `'0 ^= h ''@ ԰     ? ?''''   ` ' `@     @`ܒ ,  \Iؔ Ԓ ( ̐    耢 ?  #   $  T ]֒  |$'`".Ѐ2' '' @" `2@` ZȀ&   @K԰  F̀ @?#@27& " 1&?" ` "`̀ 2!  :  & Z`` ?$ @` 2 &@& 0" 0`, |/`0Ѐ "̀ 㿐 @@ `(`0?"`0`, | `0㿐 @@ ]`(I ` > O ``)H /f * ' > #H` $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   7 2`  7 `  `$ `( ``  0" 0`, {`0㿈 @@'찒 B` " '`  '`(`s` 2` `쀢 " 8'  `x  0" 0`, {_`0쀢 y㿈谒 ''@T  >>㿐 @@. :`7  $  (  `  @ ` 8'``! `  0" 0`, `{`0`h㿐 @@ H`(  $ `0?"`0`, : 9z`06 9`  # ޯ  `  @ ` 8'`` `Ɣ  0" 0`, z`0㿐 @@ I `(܊  @ 0" 0`, 9 -z`05 - d  2   7`  @ ` 2 - ` `| ` u  0" 0`, z\`0Ɛ㿘8F C  ݦ-H /f * ' > #H!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2 ? 7 $  30$ * 㿘: 2R`    &&`0  "`0--0-@-X-p-/--.010,,1@1p-11111㿘> " `  ^ -`   ` `H -```2B `<.`>  0 €`7 8@B3@y0 @)` & $ @@I`    2  > (& V` @ V  2>_>_ @`   T`, |`"  &` T$`, L`(`#  &` L$`( ǐ H @ ր V < v>_` ɤ 8@ À `  9`  > ( `L `     7 @   "`   >_u P `L\   `L$` `T , " " & ` `T# ,` (`L " " & ` `L# (`  [ C X@ 5U  &@V  ?` "?`L@&@?&``2`0> a $` "a `0 &(`4&&&,& &$`:&` "+&  & ``t$ ` "&   "&  & `  c `   & ` X  & >_ ` 㿐 "V P  8V "> ( "> ( >_> ( > ( 2  p" 8 W  " 7@8 8& $@f * "@*`@*`$ 4$ 0㿘  " " @ &  "  @ @6 6  2 " ܎ > !$` Y8 @cY4   ` @?? `N `@,  'x'T'P't'|@ېP 2=` d@8vtd@^0@@Y* 0@ '$8 !7d@7y d`@6t 2`$ &   & @8{  P` D`  a '''''K?  (0I* @ D< > &@@6 5`"1 =TV@@, )  `$` = 2` =  `沔 ܎ $  $  ` $ $ $@@d㿘V@V@  )`" V  >_""  "   㿘 '& R`` 2  $   2 >_ 2$ & ` ?2`$ 㿘R`   r㿘4 8   3$ W X 㿐`>  ?2 - V=   V@'$@@ `?2@K;` &  ,  :@ `? , @9?<,   (΀  @*`"  - > @?' `$" "$L %`&` W 㿐    ` ?#@2  @ 2 ,    ? ?` " ` 8`"   $ 0  @ "  ?&`74` H /f * ' > #H!& $H 0 $ (  & 6 & 0& (& ,& <& 8  ^ 7 @  ? $  & -#> ǔ 6ސ?"' #@ "     `  "` a$ "`$a$    #>  ?` `?"`  a$?"$a$ #㿘> a  > "8>   &!  "a(?#  4  2 > ( 8 4?#%> #'> ( 4  $( `2 @" T `4  (" `2 ` `@Y  2 ( 8> b4  &T* 8  ` @2   2  $@` 0 $ 0 `$  2 @R` 2 ?`( "??` @;ے ?`V= &&!㿘 >`@ 㿘 1 *?#R 2! (` 2` 2@?2  `$@  2R  ` R`  > (  (2`2`㿘 >  0 & 0 $& ?"$;m 㿘   > !0 >     P  P  2 P2 8>_  8`> aT?"aT 0@2 > H# >  @ :@ @ 0" `"@> bP" "bP> b`" "b` ` "`#   "㿐> >_!\ `#\ t ؘ > !0 -> a1> a'> H/> ""*"> d he > "bH @   @a@U !P#!5> +>   t@> #ȓ,` ?$ D$ H$ @$ p㘐f$ 8 8$ 0 >   b@:@ "P  > #"P8%b@> !T> `"!TH $  "` ""$ > bXbX $bX" "bX$ `@ t    2:: > "bD> ", @ K @ :@ %L%L ` `L: 4%L`` L: @4%L㿘 @+  0"2' 0 & 0@4> b, ",'@㿘 @ 0"2`0 &0@4֐> b, ",``'" @@ѐ 2@@ @ 0"0  "0@4 > b, ",@ ޲`@f㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@PL ``< 2`X` ` `"`p`t "`t "`p 0? 0a $ 0H /d* % @  \> "`0 "0 \t "tH p@ 0@ $ 0@4<` @@u㿘 0 > Z 0 & 0H /d * % @_H 0> "`0 "0> Z# F *> Z"@ !*`  @0  0 & 0 0b& 0@7㿘 0`& 0@3㿘> &"䀢`>_`@  0  0`& 0@㿘> &"䀢`>_`@  0  0 & 0@㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8 $ p 0@; p > 8"(`@ 0 " \ 0 ?& 0 \ " 8@Ő@? 8 > H> !T> `"!TH# >  >  b@:@ "P  > #b@#"P8 -& 0  0@> !0> H# >   :@ @ 0 ` "@> "P> @ ""P8> "`> @ ""`@ 0 "&  &  "` ""&  & "@" 0!> >!Pc !P& 0> qː $!P> "\` "\> > bPL#"\qf H 0 0 @ 0*@& 0q㿘 @A> bd> bH*  "  P2  \2 0  2 P 㿐 '@> bd >  bH*   @"d H*  >>_ P25 \21H /d * %  0  0  & 0oc H p@ ˰ 0Z 0@,H 0 2 P >  @  @ &@" $@& & P& TH /d  0`0& 0VH 0Հ * % @ݒH 0 `"`0 "`0x@!㿐 @ 0 "0> XX "@X"`"X" @㿐> H#@@ * @ ( 8>_!"& <:A 8%> X @z 0 "0X "@X"`$X"  8 8$@ 8  H H @ @" 8@& 88""8`8`< 4"`<`8 >_!8   8 ǒ  8(<& !H  'H 0$& <0 "0H p@ H 8H@" 8""`8& 8"<`0 "`0& <㿘& -> +> )> '> H /d * % `a,@> p"T"PL@#> > "> a8> !X > "\>_`""\"\Xn H 0`O 0> !8 >  "!P>_ !PXn H 0耢`, 0 $ 0 0`" \>_8!h @ݐH 0 p " >_&!?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ l$ h`"  "` "@&㿈> "> -> H"aX'> 3> 1> `a,@ > >_"T  m H?H /d!@* %!@  > H> #a@)> ɐ 0 $ 0H p@ 0@H /dq * %j  0 2 p>_! : 0@5> 8"0    ( 0 $ 0H /d * %  8`` "@: `@%"@$`$  $ "$ 0 ?$ 0)!@y> "D`@ za,H"@'"'Вb@ ?耢 f`H /d * % !@ x`Va,㿘H /d * %  0"  #>_aؖ l  0b H 0 0$ 0  ;$ 00  0(  4 " 㿘> &"䀢`>_a@3  0">_! 0 p"& 0`> 8"$`@ 0@  0@*  \& 0@: 0 @  0  X& 0€4 0 0 0 *@& 0n|㿘> ( ؀`2*@&  > cT` "` * & T *  ? ?> bh> cP*   2  T@2L 2@ ! 2 2 > cT`  s"`2 > cT` D"` 2  T `;&> cT` "` `  "`   "@$ > c|`$ `""`H   > cT`  "` cT "cT `  "`   "@$ > c|`$ `""` ?'&@ `>  "`  |"   "@` "` "$ || $ | "`  "`"||$  㿘 $> (>_" ؀`d#> > !ct@ > >  %"l@ @ct%>  $ct#|#| M ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *::$ |` $ `""`  T.  > bh> cP* @@ $@" "@$ 㿐> #|"#|"`!> > a>  ha_ > &$#Pb> >_#\"lb8 @   > x x"`T> h> #P(*x  2 :x"x"`T> |`5 |`",`X""`&`"```  # ` ` ` |@2 `@ "`||"`c|` ` "|"` 2`㿀`>_."` B ` "0` )`    @   0> b$0`,  "`,  > ( ܀`" &`@`  &`&` ?`   ; @  8@ @-H ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y[  ; @ $T8g@b ]@, T?O$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\ @Q ] `0$`0$`T@`  > "`, ", `0">_)"x@-``0" `0?# @$`0C`@,`"` `<@`P@&`㿐X L\` d>_"  ; @ <8@ y   0& T& 00m#\@h 0"a. + J &&&&  L< &`@& L1    `8`@@ `H@ >_"`0 &`0   @`0&`T u&`0`0 &`0 @*`"`&  l "ʒ 2  0 & 0& L& XL! +J9㿘`  n `0"\&`T\2!`0> @`&`T&`X&`0㿘> &"䀢` >_b@O  0(2 4 L& L  H??@$  H@ 8$ <`$ 8 0$ 4($ 0 8"& 8  $  86 H>_"$ @" @$ & <& XK + 0 0 0 *@& 0j}㿐 P \&`&`&`&` ` " X` 2  X <` ;`  T "` X@L@ `?`P' <``8# =@ު ` `@2  <2 <` < @`` *`` @+= `  *K@ + <` @S < 2 (K+ +?&` < ; @=@"  T@*Ș  T? N&` T&`&` !&` &`&`B&`&`&`    @  &`&`&` T&` 㿘 X L >_# #?   2 `  0͐   `0 -00  `0 2`<?͐`8@߸?Đ?/  + Hې `<$`8>$$$ `L$`0$`X`H @$`0@$`Lg  ֘  0 2 b   $ `8`T:  T@ >_`P3#P T>_ P.#>_# 0?a $ 0 0`$ 0H /d * %  \t "tH p@ p > 8" `" H@ H@f`<- `8@$`<$`8 8@"$ 8 "@  R ``  `0 $`0$`L$`XJ +A?"!㿘`` "  *  H2 +`  & @&  .` < ?`@  .`" `& 㿘>  `">`   @(1! >`"& @  f 0(!(& @ @  " @`  < <@2  " @   @(2  @ >& @@  㿘. 㿘  $I   㿘    A  㿘   A P > (X 8 `@" "  2    - -㿘 2 !> #  G|* #@*`"  >`>`#>` > ) "  `Ppa` * $  2㿘> )*` > >`I c     c* " c 㿘> ( b@ " b   b@   Ƞ  > ( >   2> * "c   "c㿘@A> @#> (> ("b""耢 "b  @d?`(yzzhz{|,||}<}d}㿘W` Z  "@T @ B&M `` @2`?? DB?4> 289   (  7`/  F 8`< < $ $ 4 $ $ $ $$ (\ 4   0@@0@H- (0H* ( 㿐V  $   (_  @H ( ###> ( @    @2`lH ( `lcp`@ > (#h @   @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("@$ (cp dԘ    ,` 0"`0"( 0 ,"@& GÒ (@9 2'  @F  `*`>"D €`" "& V   R` @@   (G2 V R 2G (w  @  @ " `B  & :@ؒ@^ V   R 2$@   `$`,`"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  " ` '&  "@G, (v  & "   B?:@'e`" "&  `B :@ 㿐  2'0O`B L:@@?`C>"\*` € ( "F05 @   @"  @G $"  ( "F   B?: ' `B  : @K  㿘@( "  6`6` >@ 2   ?2    @ b `B >` @?  4&`&`6` 㿐'  V   `  @ 2T 㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4>` @ @ 4   8 2>`?>`  >`ߐ 4 㿘 `@2   ` @2 ``B > /&` `@  `@  (` B?> &`  (C 8` (`: (D  : :  :  0: : 0: " ," $ $" (`B> &` & 㿘 $`0"`0& (0,"@"  cВ  $2,p,$ `@$0` ">```2$>`p!0?"`>`j!H $>`d!p`$ C\ $` $`$`  "  "``D $  @`2``: `@"$ `@? J? /2 `? *`L /"?` ""$, $  $ > #$ `J`/2  @  `D 0~@  K  $ B `'` $  ?'''''''@#а   (P`D K`$ # ?( `*`D} $`*@@_$`J`/@Đ @J`$`@-$ @`@ @@d`DX  $` 2  @#  `$  >`DB @@($㿐$`$  `` `"` `@$` b*$``$@!Ŕ`'J@ /2$`'J /"`""@$$`<  J 2` 2$} $`  =$`'$` ! `  /`* @ `  /*`2#@`$`"`$`T ?$" $J`/2``'J` /" "$$` $`*@$` J`2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @e@X`@! > # 2@$$@G` "$`!"X$$@!B "8`   >`!?@ ?X`< ?'`@*@`@ $` ` X <` $@  `*@$`` ""@$` "@$$` J`2`  $`  @0 2<  €@< 2g`@א$< ` a<  @@  @@"$$` S$``@ = ` @2 @$`@`@? `( X <`# X <`` `@ @y$2`@`  @".  `   @@@"" @@g$㿘 ` @*@ b&`@ J@ 2>`~!@">`~!Ȓ@ ? "@@ ?>`~!Q O  X <`J@I @E  < @">`~v!?  &  X <`!`" X <`" @`@`2@f  @!     @@! @Q@&@㿐> &b#\> >` @  b( uG > > p> " ,"`"8>  0" 0"`> !$"!$"`> "!0> `$"`$" > @ ?"` 㿘``" `  ` @9 `  㿘  9 㿘9 㿘> > ("b쀤``@ْ 2`$`2  ?ې!@^!>` 0  9   $ $ @ $ <$ $ `> `$` <*  $ <` @ِ  /,   Y@ &  㿘> n "> ( "쀦 " !>` "  $ "8  $ 2  > $$@" `d 2 @`h 2@ @ 2`d 㿐 > Z > pܢ  ` * & d`& h`4``?# @ `>  $* @$ ''` `'4` & dJ   *`J8*  ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 㿘> > p> "> ` !,*`  #` H /d * % a, > !$`!$>  0` 0 "H 0 >  t @@` a, W$a, 2 DH 0 >`|Ð"X&U  "  \>`"`@>`|"p` `"``" ` \"@ L $ LH 0  < @i >`"@>`|"H /d4 t* % t  >`|"H 0 $ @$ $ <$ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@!  ( &@$ <@  '@Ӑ&@ 㿘<> ߒ` "Y @ߒ @>` ?> * a, @    ` @ < <@2 D @7 瀦      < "  = $@ " " " $@"" @$@ @h@~& @ @0@ϒ 8& 8& W$<㿘@@ @! "& @>`В  \l J  D 3` L ". DH /d4 P* % P    \`2  ` `>  " 4 \`" ` `"``> "!( ` \"@ L ?& LH p@  D` & D@ې "  D? & D@ P 㿘 D 2 >`{`"& D㿘> ߀ ">`{U#P D 2 ?>`#`@.>`{J#x & D @ 0P H >`#@>`{8#H /d4 D* % D  >`{'" L "  P>`#@>`{#0 `& L>  0> !$ < 2& \ & \ \"`` \""& ` \& `"@"H 0 @$ 㿘> ߀ ">`z# D 2 ?>`#@’>`zސ# X& D H >`#@>azѐ H /d4 D* % D  >`z" L "  P>`#@>`z#0 `& L>  0> !$ < 2& \ & \ \"`` \""& ` \& `"@"H 0 `@ @LPD2P\"`` `> (`\ "\> 0\"` P"P㿘 `` `X `d@ 㿘> "@"2 `  @ 2* "  D H "#  < 2  D @ "` <?  @ > !& 8    &`㿈>(`x'''쀠 `  㿘 D  & D @!"!>ay (& @`@=@` ? @E  ` ?@@  @/@  >ayʐ @O D? J& D P >ay XH /d4 D* % D  >`y" L "  P>`#@>`y#0 `& L>  0> !$ < 2& \ & \ \"`` \""& ` \& `"@"H 0  ">  @2 >a p@M =$ & > !< & 8( @ @?c > "& & @ & @[㿘 D  @  㿘> "@㿘 @! ">a& @  Y 0,  X   <? 8f D `"b D@`"2`"  2  "2 @>ax  @(4  @    @ < <@2   `  @ < <@2 `" `>axː 2 @`@ 7#`@ @ 7& @ <{ &  D `;& < L 7H /d4 P* % P  >ax > !$@!$ \` `"``" ` \"$$ & \$ \"`` \"`"$$& `H 0 ;` ?> ,(    @<@2 " 㿐@ ?* c`@ * @ؔ @Ԓ `@`㿘 @(2 " D  @@ ` ` `< <@2  D  2 X >ay!`<> (#* `H>a`D! y`P`@`/>aaX@`@ >aa`@y`@ >aah@r`@!>aax@k`@">aa@d`L >aa@]`@(>aa@VO >a!yd` >a>ay]!0yZ!@G㿐`6 > ("쀢F    $=  2$6 \#\`,-    `% -> ("R > ( "쀢   2$ S ( -㿐 > !, ` *` * " * S&@$&@fL > @ $ $@ A 7>   > 1@` )'+>a`X > ) `xɐa`dڔ   Ӕ +0'@" $@Ő$&@   .  @* %  < <2  `  < <2`"  㿘\`  <"z $`0`4. P $`4 < "l$ <`i d  @ 18@<`XU\ U `\@$d_,`d" \`B B d@$ g,  . 4 `  >   `"@2`` "``$€@ 2  7  @"  $`0`4Ĕ P $`4 : 1㿘 `  :  1㿘 %>, @   (9 & 㿘@" < <& <! J " <!& < 㿘 " '> $  +>a    2⬐@Q  w.a $2  >aw#">aw"8׬ 㿘H o@>aw"H> `8 >   @"@   >a>av"`0v"p㿘> " > " @p  ' @c /> 5> a * "@*`@*` ? 6  )>a 0  "  0 &H /d * %  0 $ 0H p@"  ` v"x ?  `>a"vz@㿘`  2 -> !l` > (O#㿐  -\#\ِ 㿘> &"䀢` >ab@p  t   t L`& L`U~ " t㿘> &"䀢`>ab@pӐ   t??& t>at" L`  & LW? t㿘`IH /d * % >a  p`.H 0@  H /d4t* %t  p >atf"БH 0@X0H 0H /d * % `l` `P  ````P &```p` 0```P &``9 %>a P &,0 0  &0 TȘ "lH 00+0 &00``0 &0"π l  p >as"H 0 㿘H /d4 p* % p ' >a 0   0 sᨐ 0 $ 0H p@ \`㧐00Ѡ`` >aH 00   p` H 0>a#(j0H 0㿘> &"䀢`>ac@@o `\ >asq#H&`\ <? ?  &`D&`D l &` l`"`  l& l&` 㿘> &"䀢`>ac`@oj  \ 2 >asH#h!P#!@  `"  "`   "@&  L`"& \ p 2& \ # L x`" | |"`| | x"@& \ P`2 L>as #x # P` D  \`" ` `"``> " 4 ` \"@# \> a$` \# ``""`㿘> &"䀢` \>ac@o   0"@`t`%&`tc ` "`   "!P!& 㿘> &"䀢` \>ac@n  !P#!@  `"  "`   "@&  0 2 L L`0 l p 2-@ $ L x` |"`| x |!"  p <   > ) > ) 2`@ :`  `> )`@힒 > ) @@ & @ "` $@& 㿘  >at#> ("쀤 " @_   $  $  > ( 耢@4"& $" (`" @ 㿘> ("" $  @8  2 $ 2     $$@쀤     4 $ 2 > (""  <  㿘H /d4 D* % D  >`r " L "  P>`#>`r#0 `& L>  0> !$ < 2& \ & \ \"`` \""& ` \& `"@"H 0 㿘#> )!> p`  H ( (> p`",$`> )@> ) > p ( H4L(L x"|| ||x L"L> p ,*` "x x | , "|H 㿘> "> /> )"a8+> 9> p7> ))> )5> 3>b  , * `H@ % % H /d@ * %9  @˔  /H 0  @ @H /d4* %  p  > ) < "> )>bq6  j 2ǐH 0@ᡐ   ?% `H ܒ (`  QϘ  㿘H/` /> a8 > l"܀@Te H 0> )`> )2   :   > ) `# "  㿐> !4 ˖ 0$  "`H> p> p$ `  "`<"$> )  > p3 2   : :`#`  "> ) 2 :`#` " $ $$ 㿘  "X> ) ِ >     `< ?`$`< @    " `< @$`<  㿘 D 2X  @֒ 0" x`|"`||x"L "L "H 㿘 >bq ( ">b.9>bq 8 x> ) |`  :; {` Z r D ''''' f@` @@ 2XϐY  <  <@ @$ < l@  ;: "0=``!4 &`   0' @P`@@(  0@  ;: "0 `" `! t &`@  $ < ` @   !> ("@`` 2`$``HҰ @뽔 "쀤``@ 2`$`25 -  .  1!@!>b`   +Z   b >@$ $ `  <* @ $ <`@녔 $ `$ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ 2 <@?$ x <@@"&$E <@ $ < <@*@ $ <$ < <     7 "$ $ 0B} 25 ` $`> `$$$ `$  # $" $" @, @Q <`2   D ` 0 " ې2 v㿐 D 6   € "> >bn h#`%> ` 2  ŐL$  2 `B$ ``2`4$;P@ D''''' . X`l   : : "`<0`<@ @     O  `@㿘 < ?& <  " < < 2   @ " @    >  <  >   ?>  ` *+"$ $@ "` $@"@ ` "`  "  > >bm  ` )1  㿘>  $ @+%>   Җ "`<` 2` ?$`< @@z`  @ "``< @$`<`˒$@ڐ P@ @'''''4   X `` `@`㽨@ @''''' $ X  D  > <* $ D !:9(  !','(`!L@ @ 0L`( X  D`L`0?"`0L`,  O`0 > <* $ D:8  P!'t'p`!``@m!>  $ $@@F ?#P/>    `3@,*`D`` " `<@`<: $8 `!'t'p! a@$@Ð` ( ''0' 㿐`@@ 7 K (e`0?"`0`, "O[`0`@ <`  `@@ @R $ `    ` €    @ $*P@ D '''''@3 ` &`P !: 8  2@ D'''''@  " b` $  $ 㿘   <   `@@' @ Ӑ0@ Т`4є0  ` @$`` @ 0'`8 '8$`\@+ '\'<$'d 0   ; 8@ (   ?`\0  ?4>0 &?"h g0H $`\4 2`4> )2 4 "4 0("`(  ?7 ? 77   0 @4 @Q ;0`@ 4 24`@ @ 4` 2`X  <` `<  @ k `4  ?@    @ڐ0G4˒0 @ϔ0&4, ?",4`0?"`04`,  M`0 0 !:6 & D@'''''͐ ؐ@˒  X d' h' X$ސ `۔ :6'T ``  @`b̰ \ŔX Ơ`@ﰔ  X킐 2  FT` h "T'T`< ` -  !@  XdT`<  @  XT @ Ζ XdT@. T @ T@ ,`헐  ?T@ Ж cXT@  [X`T`H "`H\ `2`\ 2 \> ) "`\`0T."(  ?7` ? 77`  0T@  T\ @ఒ XK\ϒ0.T`@ ڔ\ 2T @ ɔX&\, ?",\`0?"`0\`,  L`0 X#\T `a:5 %x@  쳐 2  Ft`  t@ ےt `ɔ ` !:5 2/0@  2'셐 2   F` ,8 2, X P    <>*@`!'P`a:5 o` `j @ 't 'P'x'T'|MP ]` ( 얐`<`$ /`* `  7 '8    2  '' '  2d` @ dtd@ G  d@ .d0d`t@ F@ td  @  'P't'x'T'|P 2-` d@ }t`@e ` `^ 0  '$`  *7d@ ~ d`@ tP@ @'''''禐 : <   ` '''''ܰ & "`@ /@   0 @ <`@ 6 Ē@ ԰  *$@$- 2:`  'P't'x'T'|PP -` d@ t`@Ґ `b `˰ 눐`$ `8 !7@ dd`t@ ,\ P@ `''''' . @2`@ @폐    텞D @ IJĒ@ !  @ āP@  '''''Ր '`@ @ pĀX0 @ @ {  @ u Ĕ@ 8 @   2T I 2F  (`<  ? ``? " `  ( 02 / ` @ B '  @ B < @  ``@ B  @ C < `2``  `<   >P`?@2 ` D $  ` $ @''''>'ܰ 2$ ``*`` !``2`@`@ @ F$ $ @ D'x'P't'T'|P `@<-`  !: 3& 2'`# `@ 'x'P't'T'|P `@`  !: 3 2'` `P@ D'''''Ȑ `@ (@ '''''岐 ! <  `` `  ?''''''''@ ,а뺐`" &@ @'x'P't'T'|僐P 8`` @ >`@ZX`< & `?a:`2 `@ ?   騐``'@p0`@)@ G`  (@`@X`< ' `?a:`2L `@ ?   e``'@@  `0?"`0`, I`0`?@- @ @'x'P't'T'|P !` @`@`X`<  $` /7@\0`?@6 @@ /  (@q`@`X`<  ` /7@+@ o `0?"`0`, H`0@ @'x'P't'T'|zP K`` @5`@QX`< 9 `?2``?!<`a:1 2`> (#䀢`<`@Ж ?Ð*@ <##菐`7`'`'@@ŒT@'P't'x'T'|"P K`` @ݐ`@X`< 9 `?2``?!<`a:1( 2`> (#䀢`<`@x ?Ð*@ <##7`7`'`'@@m0`@@ Y`  (@`@X`< 9 `?2``?!<`a:0 2`> (#䀢`<`@# ?Ð*@ <##`7`'`'@@@\ `0?"`0`, G`0`  @5> '''途  D耢??'?2@?'@ @'h'@'d'D'lF@ - P @`@`X`<  + *" " * *   * *''''@@> d`  @4 '''$  M耢??'?2@?'@@  ;   (@`@Ŕ`X`<  + *" " * *   * *''''@@W@ `0?"`0`, Fϐ`0@ @'x'P't'T'|⦐P +` @a`@}`<` @ @@  ؐ`?@蠐0@Y@ 7 2(&  @'`@C`<` @ 2楐`? @ސ@"  0" 0`, FV`0㿐@@  , (`@@6  `X "  <@@@ `0?"`0`, F!`0@# `''''' 2< `,` '''h'l'h  @omb|x`< `< ` ` `<  " "? $  @ @vĀ  @@n` @ @ @cĔ|@x@8@!`籐`"笐@'p&  "& ? @ `'t'x'P'T'|^P /` d@td0sݐ 噐` '$`` *7d@ d`@t T`P@  '''''  2`<   Ā`@      @ @ʒ @Ė Ĕ@_@Ā焐08`  @@ '` 2`( v''`< "` m' `''''''''`@   ?  @4'' @: `G`耢@> ) `ؐ????Ȓ@  )`耢@2`  @ "`  X`< "` ` '  "(:` 揔 `'"@& 0" 0`, Dr`0 $ "`2$@ @'x'P't'T'|@P " `@    -Q!:  `D `@(@$ 毐㿘 2R`    `0  "`0&㿈@  " ` 2S`  `(`< 2` ?`0 #`0`` #\q㿈@ ݒ " ` 2S`  `(`< 2`0  #`0``?` #\q㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\rg㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\r @ 8 8 @ @ 8 @ @ @       8`,`d$b ;  $`(i$`$ L$`(A ` 2`㊐`'7@ ``@_`$ {#`@Ȓ`$``@寐 `? `h$`h }$`$a  D$`(  ]`<  T -bP d` !@f D`d< = @? 8 @S 1d"< 2 @ @`@  ?@Q @  ` H &Hѐ㿘 X <`" @ <` >A!*` €   @ " @x    @" @㿘` H?$ H@ p`d hl`@P'\ '''?'쀦 '' '@@$  "  @ 㿘( @`@@ > < * @ƒ@$ @ C >@@ 㿘 ( `<   2   2  2  `X " < "  @`@Ր@>@ @$B>@@ 㿘 (@8@M "K&@&` <?`>A"*` €  ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H8`( <?`->A" *` €"@0@@ 8`$ " 3&"z@ T`@!%!@    @T`@  a@  ` "   C"`㿘  (@V 㿘a`@?#%#>b @! "@@ڔ  @ $ @ ` ?9  @@2 @㿘  (lV 㿘 (@㿐> )  8 ''*` €㿈> )  8 ''''*` €㿀> )!$ 8!$'''''* @㿀> )!P 8!P'''''* @㿀> )!| 8!|'''''* @㿀> )! 8!'''''* @㿀> )! 8!'''''* @㿀> )" 8"'''''* @㿀> )", 8",'''''* @㿀> )"X 8"X'''''* @㿀> )" 8"'''''* @㿀> )" 8"'''''* @x> )" 8"'''''''* @؁㿀> )# 8#''''''* @㿈> )#4 8#4'''*` €㿈> )#` 8#`'''*` €㿀> )# 8#'''''* @㿈> )# 8#''''*` €㿈> )# 8#''''*` €x> * $ 8 $'''''''* @؁㿀> * P 8 P'''''* @㿈> *  8 ''''*` €㿀> *  8 ''''''* @x> *  8 '''''''* @؁㿈> *! 8!''''*` €㿈> *!0 8!0'''*` €㿈> *!\ 8!\'''*` €㿈> *! 8!'''*` €㿈> *! 8!''''*` €㿈> *! 8!''''*` €㿀> *"  8" ''''''* @㿐> *"8 8"8''*` €㿈> *"d 8"d''''*` €㿀> *" 8"''''''* @㿈> *" 8"'''*` €㿈> *" 8"''''*` €x> *##' 8*\''''''' @؁x> *#@ 8#@'''''''* @؁㿐 \> *h''h8*` €㿐 \> *''8*` €    㿘@  " >b[#`@   㿘@}  >b[ܐ# 㿘@s   > ) "8*` €  㿘  \ " @Z  `0("`0H /d * % ϋ H 0  㿘 @ *@&   2 @+ > *  ! 8*` €㿘@  "       㿘>b\#  㿘>b[f#ȝ㿘 @! !>b "& @ # <  @!"㿐 <@@2 -@& <ؐ  Yߐ Z`@׿"  @׻ Z>c ᗔ   㿘6`   㿐  @   "`< @ "@&@㿘      D `D*`"  * "" &`&` &`&`@&`&`&` d` C  `T? Z` ; Z `@   $ $ $ $ $ %( %( &D %( %( - - - . . - - . -㿘> `! > #> > p!> p1>c> Z#>`  #  , 2  *  HP  1R $aD 8 0  p  㿘> "> p 0  ~ F> p`P> @D* @@ >  2 `X2   ޥ 2@ $& 2 > !@ D  0  Q "`?$ $ $ $ $ @ $@" $@$  0 7 㿐        `2 N .2޼%@H " * ư  2 >c`@@܁  2 X  { %@`"<' 2( >c`H@g  2  , "   ` 2X   V  %@"<`:   0$>c`P@:   >c X >c``@.  >c>c h  `p@#   >c x  =X  Q  "`%@"< 0G  >c`@    Xf 25 А  ,`*`* :` ?Ѐ@  N "   X`֖  `"  %@ `%@㿘  `>G"p*` €   "`\> aH    8   ` >G"*` € `@ՠ $` `` !m!m  4`$@4`$`D@ۻ` <`> !H!   4`$@$`D4` <` "4`4`<`$@$`D$`$` X" d> $`$` \  $`4<`H$`$$`($`,$`0$`8$`<j$`@  R  e  ???????????? 0 $ 0 `  0 ,?`$ 0;J 0C|< @ > (2` #x $@4`?# @4`4`$`$` $`$`<`$` $`$$`($`,$`0$`4$`8$`<$`@$`DЖ @١ <`H>cXp @$<㿐` ` `  ` = @?9 -7 `  .@?* -(  ( X`<   <  -`` E  0" 0`, :`0㾐  `   2  `  `  @Ԉ   7` 2L ,`> +* b܀} > +c@x ` ``2 `, "'a  `2  @:Q "   '+/ / -֔ H B`@&=@69 41>c 3>c```  '`/ , / `'YF // -  `  Հ`<`<㿘 `< "` `   -`@ -u㿘  `  -> aH   㿘  `  -> aH   㿘  `   -> aH   !  㿘  `  -> aH <  㿘   r$ < 㿘  `"`"  &  `>G(`  ` "`  `    㿘>cXn  㿘   | 㿘   r 㿘>cVǐ    㿐` 9   $`  Ɩ g $` $   $  " $ K $`$ ` 2` 2     $    2  $9  "    $   2  $8  ! K  G+> ,) !`x  7   20  . $   &   ! +> ,) !`x  6ې   2      㿘    @>cV  2 5 "`!4`  M    Q `H@2 ` ?4` " ` >4`  #2   ` " 㿘  `` >cU! "  !4         ͐ ` `  >4 `  "~@"#       'q  "  "  ` ' qq  `   ` 'q  0"  ` 'q   㿘     "       㿘    `? $`6`  " D` ? $` 4@D   @`Β  $㿘>cV!@ >c V! 㿘 >c !(V " "  "    "     -㿘>cTא!PR  2 > ,P" 8L> ,`" 8| <`$" "`$`,2`,  <p  "p`2``"`px2x <L"    2    ?(2 `   <  "`2``"`2<`|` ``"4" ` 2  ?(2`  㿘> , -> nऐ ("> `!  %> ,?# '?` @ `2 @* * @ @ @L$`  a  ?>c$U!㿐 <@@2 -@& <֤ \ Y Z`@Ћ"  @Ї Z>c!c   㿘6`   㿘>c!@Ғ  >cS!@M >cSڐ! 㿘> H&@##&`#> ]&`aL>  > ! D!," "&`&` &`@ &`&` d`    `T Z ` Z `D`@͔  G G( G( G< G< G G G< G(㿘> p>c T@  z > !T"!T"` 㿘> "> p T   W> !T  `X2   `2`@ 2  ש > 4& 2   _ > aP D   `T$ $ $`$`<  ` 2$` >c@յc8 2$`@ $`@$!T $  "" `T , 㿘 `"`> "!X"y  Ւ &  㿘> ,"`   > ,  ` @w ``@ 㿐 5y _ "%    0# /O 0"U>  c Y [m 0w k 0@#*>ccHT0y>ccXT0s q&>   a@"o   @ @g " b @ 6"@ "" 8  ` &Q > !h>  ! "В>  h@  *+* > J`( `(>cc`T-0> ]!L> H >c"cpT * 0> ]!L> H>ccpT+ 0@^ @ "& 㿘 / _ J?` "!>  h؛> ""АJ?` "!> !؍> "!h, 㿐    ``t$@? 8`H   N .֡$3 2  `^@`. ,  G2 X ?"$  l   $ 2 E `4 `. 㿘 `@ 2!m` `   ” 㾈  ` @4Ԁ$$ X" d  $$ @!<$$*`" *  * $4$8 ,` $$:   44$ 'u! 2< <  @ - 㾐 `<   -`` 'U! '^  㾘 `<  # -`   @   @8'? "   2  .@ՐԐ㾈  <` L  8F    @ͅ  7> ,`Б,` 1 > ,b`@, G2  ?" i쀢 " `  '?/ / &    ``@& <`<㿘    㿘>  `>N(`  ` "`  `    㿘 >c`#x   R  㿘   % 㿘    㿘>cPp#㿘>  ` '$ > "a\ 㿘> !`> 6` \> ߑ* b` #>c`2@`  X2 @ ԃ  Qϐc`2` 㿘> "  0 > !d   0`<  $ <   $ `` " $ $` $` " <&Œ  <? >   > !< $ <$ 8 U ֳ+> ? 6`;%>  >  a,: ?*    "     < <@2 D ِ   怦  " " "`&>dO  @$ @ @h& @N`a\ *   $@ " " $` 㿐=  'a ԥ`D 2 >dm (>dO @ &㿈<@@a -  [ T&(&&$&&, Py& <  D  Z  X$@  [ 0*@ "@$` `X< "$< $<$Ɛ Y} Z`@ˬ$@ r Y `@ˡ$@  㿘!6`  D `  2 ! &! 㿘!>   bӐ`U&@㿘! @P@a!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d`    `T Z ` Z `D`@͔   㿘!   - -> ,#Ā`@>d`P `  *`1> x  @ $@ "$ @ 8!d@" $ @$ @` "@ <  ` 2x@@8*` € ` @?3`> ) @@   x@"@R@`" `!2  2  "@  `X <  ` ؐ㿘   `X  d"`㿘  <` X <` f㿘   R 㿘  "`"`"  &  㿘 >d  ` Oc >dղ 㿘  \``$ \$ \㿘  \``$ \$ \㿘  ` *@&  㿘 *  "  㿘  `   X`<@?  ?   X`< @   㿀<@@ -   y  s( ` > 0?"0`, d ,/`0` ,!h 1谒   0" 0`, O/Ԑ`00K 3  " -  " <@ "@`" `"`" $ $  " `0?"`0`, "</`0< $<$ϗ YN Z`@}$@ C Y `@r$@  㿘!6` D ` ̒ 2ӑ!   0 "0!(! !~ $!㿘!>  bR`&@㿘"   D&`&` &`@ &`&`&`&` d`   `T Z ` Z `D`@Ȱ  _ _ _ _ _ _ _ _ _؝㿈'蒒 >dN!8㿐   '%? I   > L .h% < h `XE 2/ "`<  O  "` L +> -`J@ "$   8 $`Ҙ$@`p $` %`p% 7㿘`"! =VV@@"` ) q 2` =   沔 – &`G``'t@ 'l  \  X a t ltbPN 2l` (t lH /` * ! t` `8 '>d` `>   *t  6X,k t` `8 "`H 0t`8 2`zt2 tx x @ @3 xtਐ @2` ``'x`'|`'` 7 P'''    ?؞P''t '''''  pl 'plh耢 ' &` @'ht'p  Vp "l  'p L@l  " 6l ْ`>l`@?2  2` 4 = `>d?!hL $  @?`  2` R`     =H 0l% \ l "tt # t㿐  ` @jͶ$ $  X  d""< $ $ @. $ $ *`" *  * $ ,$ 0< H$ ($ <$ @$ D @  !$ 4 $ 4  !4 4 $  $   @2  @ -  㿘    㿘    " M &   G  " `>Uh(`  ` "`  `    㿘>dK! 㿘    㿘  x  㿘>dJM!X Ȱ -> Hc   @ `1? `,>dؖaL   ?  0`  `4` Ԓ    &`􀊠2` @1` =` "``  Ț   '?''''''@1'䰒 2k``    '?'''''''@1ݒ 2W`    K* :I`  '  "@`   '?''''''@1 / "?`@ 2L "        # " 2 `  *'`` @Nt&` = 㿘#`4 4@2`, ( @ `,6a8`H(@&`,`4&`X  N`1  `H`,(0)6a8>d0|}4>d0w`,(} 7`H&`,`4`X " `, `,*@&`,+&`X_N`1`  &``,  @0  @JÐ` J&`0O`,(1 N`1  `H 5>d! ( ) N`1  `,( `H +N`1 2' `H2# `,( N`1 !>d! #0 ) N`1 0 HÐ#8N`1  ,  㿀 6 - '@䰒 ,> -@!  -` > -@!̒ N`1 2``H2 ``,(`+6a8 `? 㾐@’ 9! $@@  `  &``, `@/W` @I j 2` 2 `N`1  @J` ? &`> ,2   `> H#  h l(   +*" +@( , + +@ #t* + >d#h#l#p#x###\#`#d#|##I" 2  "@  `  㽐"'@  `2  "@@''`  "@ 㿘  @ `,@ ` `   "`` @/@L` 㿘 `  2`,!" `4N!: `4 2`,> !l `,@ # H    @'@ϔ  -Hʒ 9 P $@@  `  &``, `@._` @H r 2` 2 `N`1  @H` ? &`> ,2   㾀 H  4 4!        4@ɺ>e@ɵ$ ,` @ã! /`@ː>e#\H!`ߐ@ɼ , '>e `#?`l 2  `n >eHВ!`@z @u,! @p;L@kD ,!?H?`@ɇ >e` ! >e!(H>ea0`א@t!  ` `>e!8H>ea0`Ȑ@`L ,>e@H!`@R , >e  ؔH Ԓ!Hn`@@# l>eXH]!`@0& >e#\`HH!`@ l>e`!x 0@ @ߔ"V @ڐE`>e!H$!`@ >e  H!`@V  >e'>e,   ᐐH!`@ȫV @АV  , >eG!`@`@Ⱥ 㿘   -     &@4`    t t( t( t< tP tP tP tP tX t` tX tX t` t` t` v0 u u u v u u vL vh v㿘> >e!l   > p t" t"` 㿘> "%> pt>  2 X2  ה t&@^ 2>   !l> a n Fl@  z $ "" ""* "">\"8. €!m2  $ <$ @!$2 $ <!m2 $ <! !$2 $ <>eEI!"t " ""  @uŔ l 4 㿘 `""`> p" x"  &  㿘   `   24Y  2  > !l`$ ` 2 K ?` F>\"t*` € g; q4 r- .&      ɖ -㿘  @"!   (” "  > .@@Y J?` 2&?.@& 㿘 @   2 㿈 <@@5 - "'  "* " <%  < & <  b &!  ZȪ Z`@ْ"  @Ւ Z>e" ʱ  $`㿘@  > (#܀`   (  㿘 {  h@M> H>  > %cc&`Ԗ Dؔ c#@ &`&`&`&` &`&` d` q  `Tm Z `i Z `D`@  { { { { { { { { { { { { { { { |` | | | | |p || | | ~ ~ ~  \ d          ~ ~ ~ ~ ~ ~0 ~0 ~0 ~P ~P ~P ~P ~P ~| ~| h h $㿘    <  2 "  2   (2     "   ($  ` >^(`"`   "       㿘   `   㿘) `>^(`  ` "`  `    㿘 >e`"` ` `D`㿘  O  㿘  E   㿀           א !> H < $@ 4`$`$`@# $` <`H@I<`$`4*`" *  * $`$$`($`8$`,$`0 ` >^"L*` €,!?`" @4` 4`@ $``$`  4`$` $` `K*`>^" € "> " 4`$`$` 4>ebDj: <`6<`H   <`4`$`$` -<`H 4` " $``<`$` <`H - #Ȕ  *   :  P !  <`H<`>eBv" 8  o    n㿘 > "  `%@? Ű ` 2 M .2% `  g 0`@ `   >e`#@ĥ `?`   `>e#@Ě `?2X` X   > -# > -#Р `c @ܒ  c X€ c cX V `@j#"R@ e LXD `@XC R` 9> -#> -  2c ` @1   " X€ ̰  @ 2 X >` %`@    @ 㿘a `    㾐     ɰ @  7 B 2   > -# - @> -c̀  "  X€ " `` *  '  ǝ/ / H    ̀& }> #  t q=  K>^"-  €  >e"'/j ,@J/  '/>e#    '/>e# T 4/X!`  . '/>e "X!` - '/>e"7  /#`@4>e *  '4bBy // ̔   `  = =㿈  `  > "`4>e b >e>ecBF  # Є #* ((Ї8 #2   0 ( ( < <   < (   㿐`X``  `<  <`>b *` €> `!  ` ?3, ` .> al  , * > Zc"* `$@j l , @7? ǐ  `D  S@7Ð N , > Z* "c*  $@  @ $@F```B0.> Z#܀ * > !l`` ?`  > Z, !"@*`   ȯ , "> Za* @`` x     >e?#@  2  > " " >e?#P 2<  >e > Z *` * " *   `ٔ0  6 (` ' `> Z#܀ *"> Z*" a* ` @`   `h@   `  ` " ``"*' ( 2@L >䀢 M J @  > @] &@ 8 `?'#\#` ?" @"@8 H䀦 " 0>#` 㿘   ; 㿈    >e>Ґ#p 2 <> " "<>e>Ɛ#  >e > Z *` * " *    `  2 6 > Z ( c܀*"> Z*" a* ` @`   `h@   `  ` " ``"X ( 2@z>=` H`"F@  @ %@ 8   [ '?$`@%@@8``HC@@!`쀦`">#G 㿘   < `` 2>e* * > Z" c* `@       *> Z*"@ *`  @ *> Z" a* ` @  @ =ڐ#㿘 `< 2 `> Z *` * " *    㿘 > Z c $*`  * " *  @@ (   € 㿘 < JH /d4p* %p  >e 0   0 =n 0 $ 0H p@s0ڠ` >e ȐȒ p` H 0>e#?0H 0 㿘  p   F> 8" `"> Z@> Z, "@! *` €  "    "     2" 㿘`  <`/ `U>e֐ ` !  `  `! ` " 4 @!+4 * @*`> Z"@*` -``U`  `  J`A Ę 4 @!4 > Z* "@*` <ː#``㿘 ?   >f 2  >C `>b@(`  ` "`  `    㿐      #\   㿘>f< 㿘>  ᘐ 7 > "a  6?@  *@2 ?*  6?` ` 2 ?*@㿘> !> 6` > ߑ* b@` `2@`  X2 @ g 2@0`2` 㿐> > "a  "`<  "<  `<?     "``` " "`$ $  & `<? `  "<>  a<" 80\“@)> `<6`? @'> ` > : ?a,*  @`       < <@2` D א   `"@`"`" $@>f; X`@"`@ @h& @&&! @*   $ " " $  㿐2  'R } &㿘/!` b```?2&`#&``ܔ?2&`?#&``@ ?# @ʔ?"&@&@ @ x `  <@@{ -Ĕ  t T&(&&$&&, i"&`< "]   `X@$耢``0J*$ $   C"* <ܐjܔ;  0*@ "@$  `X< "$< $<$Vؒ Y آ Z`@<$@  Yذ `@1$@  㿘!6`  D `  2 N!J &! 㿘!>   b`&@㿘! @P@!!   "P& DT&@X@ &`\&``&` d&`h&`l&`&` d`   `T Z ` Z `D`@Z   㿘!  㿘!  㿘  X $> ." `     't>f ;   . x 3>  $x"  "$ @ 8a@" $ @`$ @` "@y<`  ۀ ?"$ ?&⸀  `>f;J `XU⸀ "  ``>f`;<! ?&'t ?!x}"` ⸀`  `>f;"!(`X-⸀  x`>f;!`x@8*` €  @?   x@`"@|@<`  2 ?"  a2 `2  b2   `X ?"! ?⸀  `>f:Ɛ!&⸀  "  ``>f:! ?"? ⸀  `>f:!Ӑt@⸀` "   `>f :"㿘 " G> . X `d "  ` `>f"H:w  X`b` ` " ` " >f"x:` #"`k " ` " >f":J  ?#"`  㿘     㿘  ` *@&  㿘 * " 㿘  "`"`" ? &  㿘  \` $ \c $ \㿘  \` $ \f $ \㿘 >f`"9 㿘 `  3> ."` $`  `>f 9ؐ"X"   `>f 9ɐ#0$$` 8> !@8 26  @ @%؀`' ! ' k`   > &(@  '&@  㿘> p | |"? 6"> p @l >j > )"` 㿘> p .    "  " >f    㿘> p .  `"  Y"㿘 @ 2` 2   ` ` ǐ  @ @2 (@ (  ?& (`"  "` "@@"   "?  " - &   "?|& ??& > 8  "?o??& > 0@> p |,  & " @ " &  (`& (|㿘 㿘 }㿘 < 3 ???`0 2 `4   :`02`8`8`< :`8 @g 㿐a\ ` ` `>f6# " `< <@" @'     "'e '􀥠@T 2  "` #> p #> p"? `";7`"74  #> p,Đ `|`$` 2@`  2@``X2@      `2```s@2`(`( 2> >f6d#" "*`  4`@ $?"$!` >f6T#`(`> _``(>f $`(   |"` $`( 4?$`@` @` `"` =` "``(  ?$`(`ݒ    $`    $` s  `*@ $` "`` % @2   .> ! ؖ `   hd  Ԑ H`"`@ "@`< <"`<??$`$` <`8<`0$`$`S`  $`(`$`,$`$ $`(> " "? 4 $`@   $`    $`   `.*@ $`$` $`$`> p |, $@ " @ " $``(`$`(㿘  (  ?$ (`"  "` "@  " m " g  " a  " [  "    &  p   ?''؏q !֍ ؁ c  ր@  жت )@'''''' * ?% '''''' (耢`   㿐@ P`(` `$`(`4 ֞ 2`(  ֜`( $`(  @.` `( `$`(`$  } h`$`@ $`$㿘\ `'    '  ' `*  '' '  `2  '  ' '  '  2 p0 ' p#\˜ ""   |'7|  S׈ : &` |@Ր#\ `r0̀  * 0` >׮   `$8% !@`'` ْ ` '9' 't'p'x'|` '`'_'lp` ;`l `֒`l@lMl 0"t'` 4``I lb.  l  H`" Hl%(l㿘` H?& HY㿘> "@ (  ?& (`"  "` "@ (` & ( ִ 8     N  ؀   㿘> ! 8 `"А@" &@`&>g3*  &    ۔㿀`'u  ,`'ǒ  '* ' `"`,"'' @'  B`u@@  X #\#`٘  " ,`" ,! 㿘 , ʠ   ,m & ,㿈<@@    -B   4 P&(&&$&&,  &<      ``$ ``    } $  $$ $z $$ < 2    g  $ @ "@ $ 8 !`$    X <@ "  X`< "< $<X<< ` $<$ Y y Z`@"   ">g  >g0 >g0 >g  @ P>g `2  x@k  Z"@L? $@|@0   `` @ "@㿐!6``@2 - %>p  ,f`D (`\   "@@ g`Nc!_ $!㿐> !"5  2 , " `      #\#`   `    z@ ( "(P!@ޒ!    X  2[\`&` d&`h&`l&`&`X  T TDPX&@&`&`` @dT&` `@^T&``@1T&` D@\` `dhl`&` ` ` `@ &`&`&`&` d` h  `Td Z `` Z `D`@  㿘 `Q (`& (㿐@@ @ "' X' v&@i/ @ 2 Xd 3"# @2`   ` €A " & < 2& `&  >  X   !  b $ ` ``'''P'`( 2 { %`(`$`( ӽv @` @`( $`(`Ѱ  `"@  ?$  ? @2   1   ؀    >`2= `~$ 2 $ &`$ $   [ .` @ ' '`"@  ?$  @ ` `    'n `3`2  ?$  "f % <`# `( ?$`(Y``( ` $`( EDA'   X #`#\   ") $@ `  @2 ˒    J`. @>g /^㿈   `' ( \ ( $ ( X  #`#\ < 0Ѱ 㿘 >   b  - ( 2 )   㿈``  )  (  ( $ (` X` `к ` ` ` #`#\ 0  㿘    ` ,  `< 2 $4 ` ` ( Г" $ $ $`Є 0 ( r㿘  ` 2& `$`?"`$& > )!8*` €㿘   `  `( 2    f &` !`͐  W    Xa` ` I ѭ `8      (  2 I  8 26`? ? 2 <      `? ?ݘ @ "  @ 2 ` 2  `X  d"`㿘`  ``  <`2 ``` ` @ % !  ( 2  `` ` ``?2``? `? ` ?㿘   "> ߐ`? b`   ( 2    Ͼ  )    ` 04  4   ?G?0 84   <   ?7?㿘 >   `b>g-]  ( 2 f  υ     0   4  ? ?㿘   " & > )"8*` €㿘   " & > )"8*` €㿘   " & > )#8*` €㿘  `  ` " ``?`W  `( 2    w : 㿘` ` `  ` >g,ΐ! 0 ( Ӓ\ ( $ (b`( ƐO( $(U` X    & D +0 2   X k` 1`/`㿐   ` `>g.!0E  88@?  2:  `͔` @2   ϼ   v ` @2 `    Y  Ϡ 0*   Ϙ 0  ϓ ` '  "`( 0 5`( $`(  㿘 >  8!        T 8@28` F`   "` 8@` /| ( $ ( ``8 2 ` `i ( $ (o   ΃ 2 `" I ɰ0 АT` O 㿈   `.  ( 0 ( & (    \ "  0 X #`  #\  0  㿘` ` `  ` >g+_!` 0 ( d ( $ (`( W( $(`     &  0 2 6  X ` ``㿐   `  (  ( $ (     "@  㿘 >   b ( 2&  & > *  8*` €㿘   "> ߐ`? b`* & ( 2&  ̒& > *! 8*` €  㿘   " `?( `` &  2&  & > *!0 8*` €ؒ 㿘      (`    㿘  㿘   . ` ` (  `D   ˯ " (7 $ ( ( "  (>g!>g!*8 > " "  ( 4 @@2 ($ (>g*&!>g $ (   ՘ `" "? 4$ @ (  $ (㿘   (` >g*!> " " ( 4 @@ ?$ (>g)" ( ?`$ ( G  ( `$ ( $ ( }$ @ 㿘 >   b`?`- & ( 2&  ϒ& > *"  8*` €  㿘 >g  "8+3  ` `>g"h  `>gy"p  ,   !>gl"x  2  (2  㿘   "> ߐ`? b`Δ & ( 2&  p& > *"d 8*` €̮ 㿘   "       㿘   " & > *"8*` €㿘  \  " & \>g)" 0@    >g)"& \㿘>  > *`" * "ᤢ @K%> "ᤒ @ё4` <@/@˒ <* .@(@Ē * > 2!Ta@>  ,'"  !n!m:"`> / > / @  @" `@:*  '48D* @4> !6&% * ,  , @b.6@㿘 6` &k& g2`**`" " `*  , **   d@> a'> =)> ?"2a2     !`"!n!m`@ ` > / > / 6  ?>g")  ?  ?*@  ?, @*`" *" * b $ ᴓ*"@ *`@  &@  d* "*"@ *`@*`@*`&  > /> / `> /  (   > /> /⸘  ` `+``    "*@ .*@ ``  > /> /⸘  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?> /  .@ `2 @ .@   $ &   ?? "? ."?   > /  .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @  0?,@R   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?V? ?(("@ `K@ > /  * @   7` 3 > /   @   #`  > /     ?@   `  ?<璂  @ ?ca @ (( ` *` ` 2?R` @?(( @  (  /">( ` 5?< `  (  /%0 ` (*`8( ?< `  (  /" ( `   *`( ??<    ( @0`㿘`? " .`` ?` "`."` ` @ 㿘> a> 2   ;: G > "a 㿘> "6@+> )> #a! * @ "  @2 2 2 , `  a> >  a0(   2  2  2 ,"   2 @ 2" """@   2   " "㿈> "`tc 2``"`<`  &> "$@   & = @x >g8   ͐ 8"` $ $ $ $ 4`$ $ @$ `>~ "$ 0x "`0` $ ` $ ,`t#@&`<@## @ "@, d`tc 2$ p`<$ p`@`$ t !4 n4 f, e4 h4 jS4 l@ 찒 p X  c, d , e  * @4 f  * @4 h  * @4 j  * @4 l  * @4 n  * @$ p  *`  * * $ t 0`t    *` * $ p{ d  " < p?c @:  >g`T*  $ t#@%  "`< İ &㿈  X`<2 >  H H *`" *  ' * `%'`  &  n l  d . d 0 `   j     h f e  ?&    ? d`&  , r @ 耢 2l X<   d * *  e*`  g* f2 *` i* h2 *` k* j2 *` m* l2 *` o* n2 *` s* p2 *` d  w*` d  t2  *` d耊   u*` d耊   t*` 0 tc ` p*` p* 1 0㿈` @ `d``0  t#@>g` `$#`  ` @S۔ `t@` ` T@ 2@  @; "  `0o`p?''$`p `@  T@82@  X@/ ? \ T" *@ D  @  T \6@ "@* ` ` =0C@Sr``H `@"@\$`t` $$``  ` N ƒ 􀢿 @?  T2@$`$`쀢`  t2@ ??@ڐ㿘 `@   0t#@" d4  d " t. @ 8`>g"#@T@?2@ 2 " P@   @    t (   & t $& g 㿘 d [&㿘 > (c    D >g#QGِ "w&  =$  㿘> ( c   ``D >g#1 X   , `X <`   ?ј  , X  Ő X`ݒ 㿘 h@` l  4"@8  4  8@@ &2&  h@'㿀> b `0 "b'?2`p `p 1' `d ) T`t.@ ϰ  \ @"2@& \ <".@@&2&   T`t.@ `"@ 8 ' 2&   `''@&@'> b  "b > !ȕ* `" Z# t2?x  @ g쀢 "  ?j谒 W t H   *`  * *  ' H  *` ' t/2 t 2 ' t ' t2 ?8'  ' t2@ ?? k  T \"@  D?*  && $`x$`|T0& "I$`?$`  x    "(  " " x?  :" 㿐 x X P ) | 4 *`   *   L :4 @?24      4 4 * " 4 *`@ .8?& |  x$? & x!  H S* P2 * P* P* * |2 * |* |* @  N @"%   6   4 `<  ' H`<`H @ ,  & 4 @0㿐 P 2* $ P  * *@# @   @" P$ P& 㿈`2`>h  8  >h p!  `L`@T``?  70)`t#@  H  *  *` *   H ` * o2 23  3 8 &`b?`t#"' R#&K耎 H  * /  < / 3 `H* 7 `H*`H '* < H  *  *`  * ( 3 `H3 3  * `H * `H *  &`d'耢  㿈`@ L?  0K@ 3 ?? #v` t?#1 a4\蒎` H   *` <  o +` 3  H*`H * `8'5`3``H*`H*)  @ H<  *  * @@ *@ ( 3  H3 3 @*` H@ *` H@ *` '@ 􀦠2q  $ d 㿘6` *@` L?*2`/ `"  "    * @" ? 8㿘   2`* `(  "  P & P `?   2'`2'@ 㿐`   q@ :`  qbmI  L`9 @3 @$ 4` ,  `  * ?@, 8 ?t: L` " @ 4` @!4` ,  `  * ?@, 8 ?O(` "     X㿈'?֐@& 耢` ? "0{ P6`  $ P* ` * *#  t?#@")o" R@ #@,J t` `H   *` 3   <@`H3 *@ H@ /*` H  ** @  H !*  H@  @ (  *`+@  H+   * H6` @*` H@ *` t@ 6@ ?8@ `( L@(p 耢`n 㿈L  2  '?," L 2 *L \$P!@q@ h 쀢 2t쀢 "V ? "tE08#@  H@ @  *  *` *   H ` * o 22  2LP4 $P*  * *# L(  㿐p  0 d >h_  > "`""p ?> !Ĕ"!Ēc   `0V 0 2' '?+ p&@& p 2  $p V     ?$J$F' d  `T?`\ `D" `*@ '``@ !`\`T "@. ``w `\`T T P"@ :  O ?$ T T?2 H>hH  H@ <$ @& ?`'`2p P  '`'` '  ''@?'  ''' 0"@ d 2` ? ` @ 8А+ ] . T/  L ( "̀` `C ̀     & T f̀`   ` ڦ"@` `J .2   J .  #  'ܐ  "    "` `'` '  '  2' 2 'Ԫ  Y?Cذ i؀J H ``2?'` '3l A &    $``'?'b @ @ "% $?'% $T% (ؤ ` 6`  + 'Ġ Đ"* @'  2"` "` , ` `Ӓ  % (% $`̐(`$`+ ?`@ Д   *  ct    * @*`< " ܀ "` '# t#@ "<`2 -#8`` u  p ܀` а "U԰ Ԁ `"@   5Ȁ`0 -#2` { `= t p2܀`m ܐ"԰ eԀ` "`([$` V # ~ܐ԰ `z0À`0 -`n &`00 p ܀`"@ۖ԰ 00  Ԕ?  "`@ 㿈`$`t@ `0?``"@`T 2 '     t ?H 0`T`t*@ &`t`$`T2     `$`X ` ?~찒 X`$ `X`H @   d , , e, g, f2 ,  i, h2 ,  k, j2 ,  m, l2 ,  o, n2 ,  s, p2 ,  d` w,  d 2 t2 ,  d  u,  d  t, 0 tc 2`(p,  p, `( <x `(? 1&`(`$`X@!谒 L`$&`$`T2@   @?`찒 6`$`XH &`$? Ψ [谒 "`  d p'`t#@`<"'  #ɖ 㿈 0  ͘  =`?? .H# %>h#>h `" 2쀢`@ a @  H@  Ő  0  㿐`d ' 1' d "i `ppb a`00@"`t>hq!0V #@>`<N9 `d H` `  >ha @̔ " `<  `c`t*   ` `*` * pԀ ( `<#`d'   `d Ֆ?`\`p`T?" *@`D`@ ``   B 2>h!p  㿘 X` ` T  \2 "@  @* * `2  T T \6"  <*@@  \ D"@*    ?ɘ   &  X H  '㿘  0 㿈`,$?0 &`,  *`?  `X "*찒 1` 2- `X( ' `T?4   ?`v 0`XH  `"Ơ $"    㿈 0 ``  C A  Z `4 2?: ' H H@   @  _ `ͤX  T㿈 0   2/ ? 9 0"H@ @   @  "` `  ` @ * @  Ӡ     x  |  <@@"Mx`  ` @    <@2 - ` 'x<@"x ``` @!  0 ` *@$`x x`[| @&(&&$&&,  < "  > Z `܀&  `"<< !!`Ő N 0m <@@2 `@c  P "K0Q$` $`4`` @ $` $``"$` p`t#@2$`@t @v0't``   $`tp YMp Z`@|$@ x YBp `$@ @qLN |㿈   ΐ > > # 5 `2@  &    `<   ?  x ' `h ? 2`( "y``  ܰ O  "y? 2  0 ; # 0!ׁH@!$@   *  @4`  * @4` ,`  * @4`   * @4`"  * @$`4  * @4`(  * @4`* ,`$x`2`"+  + (*2  $*2  ?8 O`"2   *`   * * $`,  *`   * * $`0 * @$`,$`0`?@X2``0 @8_ ` 2,``" 2W `4 2S   * @2M #  $`t$`$`  *`   * * $`4  *`  $`` $`x A`t#@ # 2 O`@@2 O`0  @ݒ@ 8 O`@Ғ`04`$`0`,$`,`4``"4`"`4$`4``tc $`8 " !*  #@ $*@ *@ $`<`4x ``8@$`D & %* @$`x`4l `` `*`8 $`<@$`D$`@`0 `D @" `4$`H`S$`L$`px /`  `?`*?* 2  ?/  `t ///  ?#  $`t$`$``t/2@`*` $`h``h@r$`l?$`\?$`X$``? *@ $`Th ON'`x`9$? 2[>h Ha@  2%$`x>ha!@x  2$`x>h!Ȑ!@o  2$`x#@h  2 $`x ! !*` ! !* * $`|'`L < 2  ܑ* $`$`$` 2`< ` $` ` $` $`d` &a&`d  &`h" " 쀢   ?` ` "_ <\ ;&a 㿘6`   a` "`` `  ?g`9 <6 ;`<*@$`<$a㿐! T  `&@㿘! D`@ &``&`H&` P&`P&` &`&` `T Z ` Z!La | `D`@`  㿘 < " ` <2`  p ` @`f `` @ 2&`@x + 㿈!'''' d  > 6>h!А`耦` _`  2' K 㿐!`` 2& `&  2@ "` "`㿘!`  `0`4&&  f< f` f` f f0 f` f< fP  p`  $ t@h `$2p>h"@& *Ȱ 2X``  ! >  H/'' H h *`' " '|*  0 *  <''l'ޔܖ o'hԐ /`  ڔ _  ؔW 'd 2``@2`   d "` 㿘     㿐 `D 7` 2>  H H *`" *  * ''  $  &  n l  d . d 0 `   j     h f e  ?&  㿘 !m `d `0!   㿐> H H *``0" *    * ''` %2  $``n`l躖 `d ,`d`0 `` `j 論 ` `h`f裖`e` ?$``$ `d` \`p T?"  D*  `p`  \` T?"  D* s  <m` 2 $ `d !m!4`0  4 `d @4 4`0 ` ,$ `0 $D$`t <`n`l`0 `  `j 輖$`h4`f `e $@,0$4$8$$$($@ `d 2$<@$@$<`0``$ `0`tX* h0 䀊 " t =_ Ȑ"  W  Q "t@ B 2 t@i = t 2  (  ѐ ,':`t '  B  2+``@ ((``:```@ E@`TB B?@?4"@   䀧 պ  Ӏ  '̀ `T?2 ?';  'ܐ@`\% @V`X  @ P @E @Ԓ@E @̒@=4``2t@ 8 ``t 42````@- 2 'H@<T"@P`\T`T"@ ;   ?"`T`T?2 % "b 0a``?}ט  `X`` "  t <  B 4  &t  @?Q @?-Hؐ`~`` ~~l  &  `T @:܀ J@ H   䀈? " @ b %= t ?@ 2   `J   㿘   `?   4`?㿘   < ` U    㿘  -X  X >    ' ''Xa` d "$2X>h"@ X@  " X@԰ +Ԁ Ԁ 0f   `K ܒ `d`" J`.  ` ` @ @Д  $` 'Բ   ` ` $' +/ðВ  `pp2  $`" `:Ԓ 2``@2>h "Xǔ 2`Բ   `!`d  ذ B`հ Րΰ  ɀ`   ` ? $>h H"` Ѐ 2 >h 3"B ` : $' @>h "+ ` pN !`Xؐp l Ö$(Đ$$-  \ ``,`$`,$$) `ĐT 3 `ۘ  `? 3;` X @$` E` "'`&`p`2\>h "T?" D*@@ `{ "|  H s` *`p2 *`{̰Д `75` ?$`Ё `p `0`$`t@ d   ? 2p @>  H < H h*`" *  * 'h'l'ޔܖ N'Ԑ /`  ڔ >    ؔ5 ?'d  \ T" D*@  `@ }H  H@ ` H> /# @  H+`d2 +`+`ؑ2 +`+`֑2 +`+` +`ڑ2 +`+`ޑ2 +`+`ܑ2 +` t@ `p <" 2+`;+`:+`0ؖ2 +`1+`.֑2 +`/+`-+`2ڑ2 +`3+`8ޑ2 +`9+`6ܑ2 +`7 t@  d+`d+``p+`4 `p+`5{( /d$2>h Đ"MȰ "d /''`'` '|` d@2a H `  "> S ;㿘    ,'  " B` @ B      Ԑ 㿘  -{  p`?` '   d  0 ' @Ē!  ` "$ `"  'ܑ2  .' `"@`" p 2 t#@i<2f @  @'2]؀@ Y{3 +`{/'`ء5`:  I'>h#c t2 '\<T?D" * ΐ '  /   >h#/ 7>h#  /7/  ? 7@  ڔ 2`` E `" &@ݲ`  $t:` 'В@ T@@eؚ X%@ ` "@ 8  t"  8 艘䴒 ?yn䴒  @" H@@  @ k 2 ` ?'Ԁ   |Ԑ*u'?q'Ԁ , ` `ct*   ` `*` *   \<T?" D* \TD" *   '/\?TD" *   <  H$@ :` '/PԐ  /*@?  ? '7@    `` &@`અ` `H` E @ o z   2``"@""@ $< t@ Вe @  b 4`2``8 `` "@y0" 㿘   ť 8㿘   8 Ś`㿘 `ņ 8㿘   `0` "  2  2" \T "@  ;  v  㿘  \`<? `>h h# T P@2 T`0\ TT"@  ;@ U ?$ T T?2`  H@ <$ @ T?2` H /d * % }H 00 > * ` $ Dch 8*` € 㿘 >h`#0 p    >h#x?  2`  >h>h##  8 㿐 `  t #\   4 +``0>( `  " ` $`    `     g f g g g g g f f g f g g g g㿘`>"l.` €  ..  . . .  h H /f * ' > "X!H 0`! 6`H /f * ' > ߔ 2H p@ `$ &`6`&@&`&`&` $@&``+&`H /f * ' > #Hn!&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` 2&`  7&` &` `"@&` &`B  `;  O%" `"`"` 㿘 4  . 4 @t   " >h#   >h`@#2"  2&   "@& 㿘. *  ݔ #> $b0%> @[$,b0@@ ,  "```㿘?> 2 b,  >  . b0*  2  @2 `> 0!` & @&  㿘?2  . > 0* @H /f4 * '   wH 0@ 㿘?2  > . 0* @ 2`  @ H /f4 * ' ?   $ 21$ $>  P-$ $+$ $ >i $> `P?  >i!  # ? #H 00I     )$    6 "   " $  $  $ $ $ H 0 " H /f   H 0 * '  $ $ $ H 0㿀?2  > . 0* @`2`5  `0 `  '`@ (8Mɐ  (  /H /` * ! ` H 0 "" 0" " " 0" " " ,㿘?2  > . b0o* @  5q@ "i@ "`"h@ f@rj@"` "@O s@t@"`8  w@n@>   ~@" br@" "k@bp@" bu@}@"۰  bm@>    v@bg@9 0 "l@x0"f@"` H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' ;H 00| vH /f4 `4* ' `4   @ )   ,`4H 00] "[ X ` "U  @0P@L >  @ @$`  < :$`  ` @ǒ&` @a> n-&`,&`0(&&,`66#6@ $`8 ?$` $` $`<$`D `$`H @  $`L`D ($`@ `@&㿘`  (@ 2L H /f * ' & (H 0-@b1,`  /`Β #@  H /f * ' & (tH 0Œ    㿘N@ .` ` А ( `>   0@   8.@ $@ > "(`"@ ` 7 @Ȓ 23@ 8 2 1 2  @ 'H /f4 * ' @   H 0 @`2` 㿘  㿘`2? ?2  @> *` 0* H /f4* '   6 "  "  H 0 ? $ >  P"$ҒTH 0 ? 0  > (Rb0( 2 > 0d X"8 " (b0(H4 X( X  " X  2  " H  <?0> (0(@" H4`(`  `6` H㿘  !>( ,& , (@ @C#0 2 ,㿘#>i 2 ` @㿘`   ` @` #> ,& , (@I @b 2 ,㿐    @ 4   ?@ $& 6 `2  0 r& 0& & & & &  <   @` D H< LА T X& To  " ϐ <   @` D H" L T X& TU  @t$$@"""  2 $)&  > `P " ` & & & & $& &  <   @` D H Lz T X& T 㿘  ܔ &   ה & & &  㿘  " (ƈ   " Ƃ  " (|  ( "&v &㿘  ı  2> >i "( "@""(""" "&""㿘> "( B"(>"/> `+> Z 5%ሢ @ 6 c > "c`@ `,@ 2` '> %>   `,@ 0 `      2 & , x  h x x x x x x x x x x x   x x x x x h x x x x x x x d x x x @ x x x x x  x x x x x x T x x x x x < ( x x d x x x | x x x x x 0 x x x x x x x x x x x x H x x x x x x x x x x x x x x T x x x x x x x x x x x x ` x x p x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x x  D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   " *  2" "   * H  (?? `!> L*` €    B2  t`   K2  ֖  [2 `   #  6    @ 2ڰ  <@ @ *` *  *     @ 2  l@ @ *`   2 `   #  6 yJ w@   2 `   #  6  @ @ ^* \ Z  * U@ * P@ * K"@ * F"@-  () '  *# !  2   "  (  *    2  "  * "  0  *2  "      @X     * 2  ޖ  3 2   )  $ 944    Ҕ*` `?㿘!> p!|>bTf@㿘> 0!x> 0`|"!x `6 4%> 0 '> 0 ᄀ4-> axᄀ@ -> * @6* "ᄒ *  @|!| " ᄒ4 !|F %!|*   @| 4 3 $ax* " `2 > 0!t&  &  & `& & & @㿘 ؀  @L @  =@(   , ( B @{Œ`(,`( , `0> 0!x> 0 =*` 4,  <>a|4 , , # #$`$`  `$``"``&  $`& $@& ؠ$`,  *㿘> 0 4!|*` &H /f * '  @J  ` "`&   "&  4|*`" H 0㿘H /f4> * '> "8  @  H 0㿘H /f * '  ܢ@{4 >    ,`" @*`$@   2 ,H 0㿘> 0!x`!> "8$"8"  & &     & >i 0" ""8"8 & "8 "` "`$"8"8& 㿘> 0!x`!> "8$"8"  & &   Z  & >iV H" "& "8` & `""`㿘 @     0@   @  *   @  *  㿘H /f * '  8>>> 0 ;bД,46 8& & & @n , " i "   > T > ! #>,  ` (  , @i@G `"  "`> ""<  "@ #> !|`"`& " `   <`@"`@$ @<"@ t  2 4> 0!|*`& "  g >     0"  * @`" €  2 0H 0㿘> "8 , "%  `  2  @ @  8 "   "   " @ے    2  2  㿘> "8 " 8 "  "  `  2   `"   @@    2  2 8 㿘      > 0!x > > 0!|. : > "8`5` "-` 2$    @   @`* " @ "   2``2` > 8`` " `    2``2`  㿘  C ` "? `26 ` 2 @% "/``"'  @ 2! #  ``   @   @`  @  2㿘 ,`D ( `$`   `D` ?@ &`D"` &`D    $ >#㿘> &"䀢`>i``@c  8 x @̙6 8 "  AM   2    Ē  0C4   `& & " & @> ! #>,   `( , 㿘> &"䀢`>i`h@  8 x`@O6 8@@B> ! #>,   `܀( , 㿘B  & && 㿘H /f4> * '> "8  T 6   6*` 4 6 `" @  2T 6H 0>  P㿘> "8 "  @| 2    㿘0a@ a$@@OKܐ  D !J@ 8 a2@ a1@a@La@"` a@"aI !F@ !F0aH@aG@a@"% Da@"6` a@a5@"` 0 !6@" a~@"  @` 0!K@" ` && <ʔ Dа:  8  H /f * ' H 0 " 8 8 2 8H /f * ' H 0 8?bR!   4 8 8:r x$ D:h @    @@f@!c 8:R u  R  g -! "$ ! "8!! "` 0a"a"a "a!` a a" a% ` 2`  .a#` ` @0a a "   8aa2 86 8 `H /f * ' @@H 0x@! > "8 0   !  `  2 &@\ > "8>`;` 0!   c  7 ` X ~ ` " ~  2 ~`  @ 2  ̀  ؒ -  `@vE ~e "@"&@㿘 ` ` & & "` ?& `@   x`" ( 8`2 ( 2  & (a 6 8? & ( 8 > 6 8   8  a7ذ ( L L L L L L L L t L L L L L L L L L L L L L @ L L L L L L  p 8 A A  ̠ 2"8 `4  @  `8?$`8`4 "`4`x " `0`4  @y`0@ $`x 2`4 A " `\>  H@ : @ A @    ȟ'`'' `>#ؓ*` €@  "v `! ( 8(沔 @ (7֠@: !"7`0`O ` K ` G ` @  8(P M沔 @i  "F```'8# `$"   ܐ"   "    $$  ?Ҕ   $ ~Д !\~̔ `7֨ ~Ĕ ~   7>i p ޔ ՠ /@```'`8# ```$"   `ܐ"   "  `  &` &` ?p <  $3 ~n ~j  ~d  0!\~_  0 +   H   0 @z[  2 2  HY   0` 7 ~< He @j Y H /f4 * '       @&$>  7 2" &  &  &  " d  & "  dH 0 & d l & l 8$ @H 0>~㿘`` % ` `  = `*"@28&  24&h!"݀@       ($` (@`  @ "@`&` &`   0 4&&&`` "@&` &`&&&㿘`@ @㿘 8`2 @ +h> 0  ` @"`  2` `  @yp  > 0!@yh  !"6 h & h `  & ` 0``   ? 6@k( ,   !2`@2 @~  t & t #  4  8! !\@y*  4 h") 8 h `0] 5@:!"݀@=`0T> D `"DvӒ > #> ] *aD ~ > ~d > " > D "D v > #> ] *aD ~q > 1~I > 1# 8 @50> D@ "D v > #> ] *aD ~Q > S~) > Sk#xf4 c @ ^  ` Z*@"@U "? ?& & & 8 $#@"   "   ?`&&  =\    &:@2`2`2`2`2` 2 ` 62 <0&H /f * '  @`<"0 & 2" "" "H 0> p> 0ᘘ :  0 *@ `  *@`*@`> p*!㿘!\      .!].!^.!_.!`~.!\.!a> `  %& . =. >& @/. < ؐ!\  =`{ &!d , Ȗ 㿘!d`""`"@ ) 7!d2]  ?>i @  (2 (2    ?0G@ 2 * 2   *@㿘  "    N /"" J /{ 1 2  > 0!{z > 0&! ^.@.`.`  `.` .` )   3  3   3   3> 0!{U > 0!{P  .`.@ .` .`  .` {@.` 㿈H o *@ g     H 00Y 耊 2 adH 0L  @w  2  @w  2      & H p@.  7   H 0  7z  z  & & ad & ad "`&adad& ah`&ahH 0 4㿈H o *@ g     " adH 00> @v  2  @v  2  2  H 0$ ?  & H 0  `"  "`  "@Β 7ah?&ahH p@ 4 p p p p p و p p p p p و p $ $ $ $ $   d D D p p ׈ ׈ נ p p 0 x ֐ T , d d d , դ ؔ ٸ ڜ ٜ ܬ ܬ ݘ ݰ d | d ޔ d ި    ޼ < < t t | | | | |    ( 4 @ L X d p |      @ ( 4    $ 0 < H T ` l     ؁㿘 8   ``  & ``>iaؐ   P p`& p:h& P0`<  "! |0  !  >i b     P 0!@"3>i #`!H  !@"<! !@*#@".!! !0&!``! +  3  @֚  >i bH   M  t & t Ȓ@d0@! =@\09 7@03 1>i! @O0+! 2P 8> D `"Ds > #> ] +*aD0.! 2 k>i /bh  5@ t & t@9ǐ0\> D `"Dr > #> ] *aD z > z > "=>i b    5 P 8 0`"/ PH /f * ' `` @&&`` $`H p@ >ic    P` 2" $@`$``$`H 0 㿈  H /f * '  8`@@ 9QH 0< 22 `@6 8H 0>i ؟@H /f * '     ȟ''`' 2:``  * ` 9H 0  1 !d!h@6`  2!\ 2`` '> 0 aȑ* @ " !\  *` 2`!\```'`8# ```$"   `ܐ"   "  `  &`&`  9 ` ` `` &`2! 8 >ic( ߔ  X & XH p@ 7 ` **  ** ! (2 !2!` 2 2`8y X & XH p@a /`  @  `8^& " 7&` 2" $$ $$     @&&`8@  7 2" &  &  &  " 8  & "  8 X & XH p@$2 d @ d & dH p@ 㿘#> pb !> p>ĒbT"ٟ >  *@ *`ٝ">ib  &! $b > 2`. <& &!|&#&#& &!h6!6!&!&!@&!@ S@d@-㿘> p" !! "! 2!!"@ 2!> pٙ"!а"0 ٔ ُ㿘    Ē  !p!\!\!p7  ` ` & & "` ?& `@@H4!\(!\  !p `?H 㿘H /f  !pZ K € F* ' !p    &!p&!t$ !x?&!x 0@  2!\! '!\    &!\&!`$ !d?&!d  Ѐ Ɛ  2     & & $  ?& H 0㿘H /f  !p & € !* ' !p`! "!\! !\`  Ѐ 2ߒ  2  H 0 㿘H / * '  2@ 1@z@w @#p @"  8j  !@e 9@]@"I[ 0:@S~@"N @Q  8@?Ȑ*@6 8 8`   @ @`? 8@  `?`2! `! >i ܟ@` 8 ?6 8`! 8! @`6 8>i ؟@0"T(& @H 0 "@!H 0㿀` 8  \>icP q 0V ``>i@c`#\` #``#d` #h^ @A 3 ;>i# 066!`!@&!!  >i # 8`6!@!p! x6!&! 8@  6!>i#r 0  @x􀢠@ 㿈> >  H\"@ *`" *  8 * H /f * ' > "XԒ H 0 " 4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $ N   $ $ $ `52 *<c"*43 3 3 # # ?2 #\ >j#` `#d  !x!|@ !l `&!l5d&   $ !t 2" &!p!x&!t &!x 8$  @  d   & d㿐/  82   ` ԑH /f * ' > "XC H 0`" 4`H /f * ' > ߔ 2H p@ `$ $`4`$@$`$`$` `]/ 2  `$`$` $` , ,,4 , 4tL`.`@x2 @n  >j#\`8   ">j@>jU `!x!|@!l `&!l4&  X   & X$`!t 2" &!p!x&!t &!x 8$` @` d`  & d㿐`8`  >j `h`Ԑ 0  a*`@ @ #\>j `#` ``*`2`@4>j `@4 ?` Ī>"D*` €`4  >j  ܒ``Pa* @   4    * `>"(*` €  @7 ,@S 8  @+0 abh* "  @ 86@ >j ` E` ( a `    e>j  x```Pa*@`X>"*` €bh+`a" @ 0H@ܔ  ,@ 8@Ӕ  8bh+`a" @ɔ >j ` ` ( a   >j  /``P ` 2   $  a*@` >!*` €bha+`"  8@  ,@ 8@ G 8 a*@`ܚ >!ȓ*` €@l >j a 월`    0đ+`a"@@U  ,@瀤 a* `>!*` €  @: 4@0@2  ,@N 8 !>j`!8@ ` W a* `~>!*` €@ 0v0 !@]0o0 !V a* `  ^>j!xr`Z`P`4V>j0!bL  >i`d#>i`ܟ€0F$>j!U`+  3  060 !@ b\@2*`P` '>j"`70!>j"81`bL@26a0>j "P `#`a&a R `P &`P㿘`8 a *` !>j "p@Ϣ`뻐  a* @  "bh0@v 0 a"@ @o  8@㿘`8 a *` !>j "@`뎐  a* ` >"p*` €@F 0@A  0@0 @9 0@4  ,@㿘`8 a *` !>j "@g`S  a* @` >"*` €@    0bh * a"@@  8@0@ 㿘`8 a *` !>j "@.`  a* @` A>"*` €@Ҕ   4@̔ 00@ǔ 0+@”  abd* "a &a  i  ,@0 bd* a"@a  &a  V @ 㿘 a+  bh"@ $ +  *  !А@  *` , !b`sZ@㿘`8 H o *@ g aa !>j*` " @` *` ꎐ  *` ?  $  *  "  0;: @= * 4@8 % 4@4 ! 4 * `#>"*` €a &a  Қ 0@  8@0u 8@H 0㿘`8 a * @!>j `@8"@5   a* " *` * !ҳ@  >". €;> %ܔ   ""l""H""P""`""d""L"!"!""X""T""h㿘 8%ܠ ``@  @&"H&"P6!&"L&"X&"T6 8#>i >jb ޔ !  "!>j#!`Ȑ &!`€`>j# `㿘 8 >jc( 麔 >i Ȑ 8 @"! @! 8 &!6 8㿘" "H  ?&"H!>i &! /㿘>i a㿘>i ֒㿘 8  5  >jcH l s ` p!>j%>j" @@ ! @韐` @ "   0F C  ` H0 ` A0  ` 90 4 `"+ `r#h' `0 `* @#@ 2 "x ` >j`#x `"x 2 ! >jU# `  &!>jL# `o$ `@ `% @ ` >j5#-0`!3 ͔  >j>j'# >jc ڔ ` 9>j;>k" @@ @#` @ "3 `  "L ` `S 2{ ` ` `*  `*` * ` "L  q>j# m `>j#!"L 6!8 222,`,`,`T,`  `  `  ` J>jƐ#G `>k ,`,`,`6,` `*  7&"T>k貐 3 ` ` `* @"x@" "x@ "@ 蝐` "x2 ,`"y,`0"#@2 ` ` " >k艐 8 ,` `n_ `@ `% @ ` d,!"l  &!>ki H-0`!3   0(>kY X! >i#V >i ܟ@6!&! >kF &!6!.0`!3 t j  㿘 8    U >k` ޔ D`` @>i %>j "@@ @`@ "!  " "H#`2!`"H&"L ?&"H ?&"H  "  >k "H ? &"H>k @`&@` ǀ >jڐ#   㿘 8  B  }`>k` ~ l`` i`'>j"@@ 7@結`@ "J`  -M`2K`"H FE` 2C&``*`* `@*`@ "L@ 8@ `>k猐!p'*&"L(&"L>k烐 $`"` 2 &```*  >k!r:$"$8%"H&"P  &"H">i>kd >i ܟ@`&@` ``>jR#  㿘 8@   > 0교>i#C > 0!ؠ  , @ `"  @  , "H  !   &!!@ !>k! Ք> 0!ؠ , @ `"  @  , ! > 0!ؠ , @ `"  @  , > 0!ؠ  "X ,  `2  @  ,`! @㿘 !>k &!@ Ǡ!抐   )> 0"X!ء,@ ` 2 ` @@@,㿘 !>k &!@ !d #`@㿘!>k !&!@  P # `@㿈"H "L  o&"L / , "L 2 2 2 , , , "O, "H  ,   , "P 2 , "S ,  "H  ",  *0 2`"#@   , *2 ,  0, b#2    ,  !+ 0 &!.!`!3 o > 0"Xؒ   *`  ``* 㿘!   >i ܟ@"!""p""t"!㿘>i! 㿘>i! 㿐 8 `@    >ka( 奐 0  >i"t"p `&"t&"p>i! 3㿘>i! e"t @ 㿘>i! Ԓ㿐 8   0   >kaP i `4  1 />j" @ I 坐` `   >j厐#h >j刐# k`  $@`  ր >jq#- ` `!3   >jb#   @l >kah  [  X ;>k9>k7>k" @ Ba 29   * *`  *   ` ""t@ #!"t  &"t >k!@ , , 2 ,  ,  j  $@`    "t    2 2  2 -@-`-`-`-`-` >kސ!Ѐ >kא!-  ``!3  >kȐ!. ``!3   `?㿘 8  %  / >kb a ``  %>j"@@D@䘐`@ 2`"p ?&"p`&@` 뀤 >j䃐#  㿘 8    R`>kb  ' A`` >`)>j'>k"@@ @]#`@ (`% 2#&```* `*`"p `*  &"p@?8"t  @x`>k4"H`&@` ɀ``>j&# U "X""X㿘"X &"X㿀"p  @  /  ,@  ,@  ,@  2 ,@  ,@  !  &!.!`!   8` `>kbX 㑐 0``4@ `  `0{\ `0v ?$? `!>k0 " `!>k0 " @"#``_ -`@2`>k㝐"@Ӓ>j㗐 `@_ @_`" @@_@_@` "|/ @`>i#d #\a#`#h#l  @Y07`>kb  $ >j>k^#*``@2`>jV# H /f * ' !0"x ?b# &!"H  "X  H 0 0H 0 @0>kc ߐ  >k #*``@j2`>j# 0>kc0 ̐ 0 ?$?`!>k0 #H @="#``ⶐ *``@.2`>j `0`!  `>kcx ⠐ 0"@] @ >k@dÔ >k c⍐ -`2`@>k̐#ؒ @E* @2`>j# `"@!@0@"#``>k#\ ch -`@2`>k⦐"@ܒ>j⠐ ` `h>l`  O 0`@^ @^`" @@^" @^@_@db  !>i`!>l`P#\ @Y  ,!   `>i>l!``#\ @G ! #!>i!Ԕ  (@0@!`@>l``p#\  *``@q2`>j5 ` "!"!̝㿘"x0"#@"H  !>i! 8@"h&! 㿘a >i! 㿘 8 H o *@ g   !>l!@ ! ᭐ !? &!! !>i! ,@e 0!   "h&!!>i! 8@S H 0㿘 8 "h" &!jZ"?c >i2 !,Δ>  j ̐>l! Ѐ` >l >l  V " >l>l ᔒ0ᑐ! H /f * ' "X! ` &"XH 0 0 H 0 ! @?㿘 8 >la@  ɸ""X>i ?&"X`ܟ€p"@ ii&"i$`i$`$` ! /"| .!&!@! #d>i#\#`#h!#l  @㿀 8`  #>laP ֐ 0``4@    0؀ 0` @   `$ !>l0 ! @+ #``ऐ *``@2`>j `0!` @!@0@ #``>l#\ a ,`2`@>lŐ!@>j࿐ ``  4/@b"   @b"  /`>l`P !>i!P#\#`#d  @" ,!    /`>l` >i#\#`!P#d  @p! !>i!P  (@0w̐"0 >la '  N@`" >j>kd#,``@2`>j]# H /f * ' !0"x ?`# &!"H  "X  H 0 0lb   N@`>k!#,``@l2`>j# 0>lb ΐ 0>l`b(`  Đ *``@<2`>j ` "!"!ȝ㿘"0 #@2 "x"H >i"h&!!Pl "x0 #@>i!@"0>Òa"`㿘a >i!PO 㿘 8 H o *@ g   !>l!@~"X! j !? &!! !>i!P ,@" 0 ! >i!P H 0㿘 8 >lb ? >i!@㿘 8"h  &!>i!T>j` , H /f * ' "X! ` &"XH 0 0 H 0 @$㿘 8 >lb  ǝ"Ǜ"0"X>i ?&"X`ܟ€p!" .!&! @"|/ @! >i#\#d#h#l#`#p!P/#t  @㿀`8'T 'XH /f * ' > "X֒ H 0 " 7 H /f * ' > ߔ 2H p@  $ ' 7 '' ' ' k  '  **  * 2 ,`T  X @d@2 ' '  4` @@` >j ``8#\ ]` , `@֓2`>jޚ `axa|@al``&al% &``X  &`X' at 2" &ap$0ax&at &ax`8$ `@ `d   &`d㿘$  & && 㿐H /f4> p* '> p" M >i !`"D! 8 @?`2!! (:!! 2!>l 9"!`"WŐ!p!@!  4!!  !` $!! !! 0!"L ' $!,"\`!  ?! 2!H 0>  *> p@ "*`        2    "   `"   22"`2"@  2 "  2"xa”# t @#@#@ i 0!:@2d cl#x@Y @Y @Y @Y a#N!9@2J ! TD   0#@#@29 ` 0#@#@2. X"x@YS D6"x"|c. x x"c' `"@Y? D  6"6"c" "c   㿘 !>k !@&!ސ > 0!ؠ , @ `"  @  , > 0!ؠ  "X ,  `"  @  ,`㿘 ` (>#*` €1>l&"1>l#"1>l "1>l"1>l"1>l#1>l#1>l#(1>l#81>l #H1>l#X1> p!>lch㿘. 06 `# b#4`"1>l `   ` 1>l'#p%#1>l"#1>l#` 1>l1> p 1>l 1> p #1>l ##1> p!>lchݷ㿘 ?`>#H*` €1>l#1>l#1>l#1>l#1>l#1>l #1>m  1> p!>lch ݍ㿘 "1>m  1>m 1> p"1>m1> p    ( 8!>lch n %>h* >m @>m H>m X>m `>m h>m p>m  >m  >m >m >m  >* >m >m  >m  >m >m >m 㿘. 06 `!"1>i `#  !1>i1> p b#" 1>i 1> p!!H1>i ! !а!*>lch2㿘>m!ð .`  !>m!ۺ *`  㿘?.`#`@#>m!>m ^ ۡa `ۜ!*  @㿘!> p"6 6 >m 6 a ܺ    2㿘??7>ɪ" >>Ȭbئ#|#>m!\ ۔  '@W\!\ a0> ""@ ܋  , <, >$$ @4 8$ $ , =  $ $ ,b ,  ??א!\㾀` >mګ!8`,`8   ''' '&`4! @"`T!4  3 A`T $`T`d``@$`d`Ѐ "`>Ȑ#|@2 ``ȟ''`'```'`8# ```$"   `ܐ"   "  `  &`&`  ! ` ` `` &`2 7`"H /f4`* '`   ````@&&`!  7` 2" $``$` $` "`` $``@H 00b  >m `> "  > S#x g!X ߐL /H /f * '   @ ` # H 00 7&`  2" # > D  , @ # # "D Yߐ > #> ]*aD a `Laq `L $`L``` $``H p@ 㿘 H /f   { " € * '  Ѐ   2  ` ` & & $` ?& H 0`e`@"   >m !p> " `> S @4`cx ɒ A0IH /f * '   @  ` ,# H 00.$`  2" # > D , @ # # "D YD > #> ]*aD `  L`֐  L & L` ` & `H p@0j` "`T 2@  1@ @"  8 @" A2 8>Ʉ""  /  /" @ "  " " " "" " 㿘    2"`>mت!"` "`"@ "`"& 㿘 `` ``㿘@ 2 & >m!8 >m؂!㿘 { `xv0!50 !6"$m `@j 2c ` @2&2&X &&@ P&M& ` `&`&`&`&`€`   *  4 ` .$@` &2 02   ` *`$\ "`  &`  㿘 8  @%>m  2  z 2 㿘 #< 2 @2 $ & "@  ꀦ> 0  @2` @ 㿘. * "*   '>  7$H!> $"L@T!"L@.H0 >>%` `'>m$!\ E !(  2 $ @, <$ $!l`$4 8$ $   $ T Ժ L@ߠ㿘!| 2!H /f * ' > "Xo!$!H 0!`' 2`H /f * ' > ߔ 2H p@ ! "@!" !$"!2`!" !"` ! "6!\H /f * ' > !,#H!"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8! "!\ $ 2 !!\>mw"( 8  4 8!0 $ $!|$`$!x@tB$!㿘> "`ua: f`h > ` "L> YbH ``H!t OQ "N 7&`&!t`& HH /e * & `p$ &`pH p@ H /e4`L* &`L"Q &!`` @ &!#x۔  H 00&!&!H 0   㿘S ؀`'. hH /f * ' $at& Waa$a $a$ax $a| HĐaaH 0X@ ?\ "㿀    ̟'`'' >m ף"H t / $ t!t  2p 2  8 @2 8 A@ ` w 4H /f * ' !`"$ H 2   X> H" 'H " 'Вb@ ? $ !!t`@I$!     @&&`  7 2" $  $  $  >   $  H 0 X $ X`H X$`H`" !t`H $!@  H 0 `  X  H   ̟@ H 4- + L H" "Q%H /f4!`* '!`   %!`%!d$!h?%!h"  l % l:  €    2    % % $ ?% H 0 T-> ` Hв ` `[q@@`  8@  !@r  @* T`  /[N !`HH%& H`  d `% ds> ߬#/>  1  ` `? $  d% d K    ݐ @   d % dH /f  Tx0* ' T* 5%.  "#8@ <"`<<8"`8> $5#H($0,4$0 ?4 XH 0 2  "  d-  \`% \ T `% d% T㿘!H /f * ' > "XA $!H 0!`' 2`H /f * ' > ߔ 2H p@ ! "@!" !$"!2`!" !"` ! "?$!H /f * ' >  #H!"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8!`  `0`$!@$!|$`$`$`$`  $! 㿈> `ؒ`B d:?2 !`p 2  `` @2 `! S$!  8 `&$ ` 2 $!! > !H @6$!!H @!  $!H$!!  0+> H$!   ܀ "! !x 2!x! 2 !x! 2 !x $!  ?$!!x!" ` T` Y ! @ @*  p 2 8 O*@ 8#@ !@r6! ג0@Ҁ p2 P`'͒! p@r%! $ P 84 8ؐ  T`"\ L ``' 8# `  $" 4   ܐ"   "    & &  /       & } *Y) H /f * ' `T %H 0  L>  $ L`H X$`H`" H /f * ' > " @ `" P p`$ P$ p0 &  2" "> D`"" "D R > #> ] *aD Zc 0Z< H 0!!x!|@`*@$!x$!! $! P $ P!`$ $!x$!$!㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / 8 )6 8 `"# /  /@N 0``&`d$ `L$ `T$ a$ a$ a$ a$ a$ a$ $a$ (a$ ,H 0 ]t ] ` ` ]t ]t ` ` ` ` ` ` ` ` _P㿘>   bP ->m+>)>'>%> 0$!t`Ӆ t%ܔ  a Hx$ @, <, >$ $ $ $!`$ $!$!$4 8  $ GS!  `ڠ"x㿘>  "P!``"xP!|   ``"x!| 2`` 0'%$!%4!!ܒ $!x@N$!" w  $"$@n!$"$"!Ԓ "? 6"$!$!>  H$" $"㿘> &"䀢`>mbh@r  8&!| ?6 8&!T !  &!&!"!?&!!@ !  &!&!"!?&!!, !  &!&!"!Đ?&!Ā!Ԑ &!!Ԁ2!Ѐ  &!@"&" &" &"&"" ""$ &" &""$  &"$x Q@! S@ "a8  Z N@"@.?0倦@ "0ax V@(?0 J@y?0 `G@ `F@R@PY@?0  M@" `K0 L@&?0a&at&& !:>  @H /`4ax* !ax @ @@!H /f4ax* 'ax<?c $axH p@~  !:  w> $@(p4ao l& !: fb$ aH /` * ! @m H 0L  !: E 4A$a!: < 8  T 0ـ > 0"Ѐ`" 2z  < H /`4b* !b  a@$a€  $bax@@>m"xr` 7H /f4ax* 'ax* $axH 00H /`4b* !b  b @$b€  $bax@@>m"8` 7H /f4ax* 'ax* $axH 00 ax@@{>mؐ"ڒ`   ! 0 L@2 a&!: a@  H /` * !  * #`@8a@H 0a H /` * ! > `Hb "&b" &H 0F "*    %SĒ ؒ 00   Β &    G@bbH /f * ' ""H 0    㿘H /f * '  2@ 1@1@") @"!n @" 8h 0!z@ "P!{@"[ @V  @S ?Q6 8  `  `I$ @"F / B@ /@K 8!&!&`!&`!&` !&`!&`"$ - &`"$` &`"$`&` "$`&`$"$`&`("$`&`,"$` &`0"$`$&`4@J 8" ""!`€" "`4€,H 0㿈@!| "- 2`8 @= 2` # 2`  ``ȟ''`'`?Ȗ*@6`>m`  !` !6` *  "ϣ` /   2" ````8```$"  `?ܐ"  `?" 4 ` @  2&` ° 7?&``<* * ** `  `&` `` @`!x@>m"T`@Ð 2!!` *@"  ̂ 2"  " v "`>  H$" `*!  H /` * !  !ؒ`"&`Y$!`@  ! @& &` `|"0 7&` 2" "" "$     @&&`^  7 2" $  $  $  "!  $ "!H 0 X!` $!$ X@`T`d`$`d$`TH 0 *㿘> &"䀢`>mc@3 !Ԁ l!   *`@ `! !"Z YO $ @ #  ! @ `"0 7 2" &!" "%        @&# א   7 2" &  &  &  `"  & `" X! `& X&!  $ 2 &!؁㿘H /f * ' !x> "D*@ &!x#"D Lǒ > #> ] *aD T 0TY H 0㿐!    $!$!& !Đ?$!Ā   Ѐ   2     $ $ &  ?$ 2 !  € C  $!  ` `*  @! `  -01 !!x,0"$( `  0  ` 02 @i̖  p " ,` / -,@,`,`,`@Δ 0 !3  "0!x" +!x@' '   !x! " @   `@`!x ݐ  `א !x 2!x 2!x 0 !" !x   & & !x  2 ` @,`,`   & & 㿘> &"䀢`>mc@Ƕ > "PH /` * !  '!x  ! "`H /f * ' $!xH p@ !@`"x@SH /f * ' !` ` $!$!"`!?$!H 0 `߀`H 0㿐` 8`@`` ` `` Ş ` `*  @@ @!x@>m# ̤0 @?`>А"*` €!x H /f * ' ?# &!xH p@ 0!x ` @ ` 2(""~@! @  !t rH /f * ' !x &!xH p@ 0[ Y@" @#\$ !t! KH /f * ' !x@ 0*@&!xH p@ 02!x`/2"")@&!@ 0 @"(@ H /f * ' !x* &!xH 0 㿘" ""!@&"" " @&"㿘H /f* ' ` 6`&`! 2" &!!> D @ &!&!"D Ja > #> ] *aD R 0Q H 0㿀!!x &!@ ' `   >m#Pˋ@` ` `*``@ ` @?А*6`H /f * ' !x(&!xH p@ D"B8!x  <" `, 2!xʐ ` ` `* : @@>m#h >H /f * ' !x (&!x @&!xH 0 !x !x@ "`0€  2!xI !x `  h-"$  @hz H /f * ' !x 7&!xH p@ -J/!x F"$ B` #\` @h @!x@3>mL#H /f * ' > "XH H 0 #/>  4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $ $ $  (M`H /f * ' > #H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      8 `   $ 0   " `  ?$ `"`0 " `$ `$ `$ ` $ `&` ?6`  !,@,`,`,``N !  $ ` `"@ &`&`      8 `   $ 0   " ( a$  ?$( X$2V$   `N`  `  $ H /f * ' V`> ߒc̗*`@ ?2@ ` ` "#@`8@ `<"`<`<`8"`8> `$#H``(`$`0`,``4`&`0 ?6`@X$H 0"! !x "$ ` #\` p@g5 6  !!x@@>m#~ 0,`J ` F H /f * ' > "X H 0 " 4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $    &`  &`&`` *" a "" W "`>  H&"`*! !!-  8 ! "`x0k> `` "D?&`&` `&`#"D G > #> ] *aD OR > O* > "! H /f * '  @&&` "H p@ !x@@>m#Ⱥ  p & p 2" ""`"H 0  L  ``& L& `!@0  P!` &!& Pp +  | > 0   2  @*   @ *  ** ޔ  >*>m*#Z㿘!@㿘> " !:a ^H /e4`h* &`h  `؀ !| H 0@  4 2 !H 03 `">ߟ@>ߔc)!\"( 6"\@C&"P?>>>ܔ∘ &"(&"4&!&!&!&!|&"H@&"L 8`@6 8` & H^&`ؑH 0 㿘H /e * & F  ؀  . h& !|@ H 0 㿘H /e4"L* &"L   .&"L"P "!x '&"P!x$!\!x ;&!xH 0㿘 ؀  z H /e :%> 'H 0k H 0c* & "%> '    @  H 0C # !H !| h " !H 0+ " pM (!  $!$!$!?$!H 0 `  " 㿀 p     @2 h  h  " | @` @`` ( p0> ߦ#̑H /f * ' > "Xo!H 0  4 H /f * '  4H p@  $ $$ 4 &$ `#(& H /f * ' > #H6 $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   "  82 `   $ 0 @   "@  ?$ `@8  x$ ` z/`K: `" ` #` 㿘 ؖ !|s? P@_  U@0X@ Y  W@ "  T@M  O@F!:7 KH$"("(E& !:* >;$"H"H8& !: 1H /e * & "(J̔ "0"4*  $"4$"0$",H 00"(J 0 i   R@@ڐ> 0*  @2 (2 `* 2 㿐a| H!AbL>  "8 H  ?a ~`&aH?# 6b`> ߶# U@b(@ @ 2`*  `* b( `@ @ @2 *`  *"`@ "Ha$@&a%+@&H /e * & H }i < @c ,H 0a` &a@`? s o b`b(8 ;`*`   * `  }//|H p@݀H 0Հ/b` 8 :` `;`*  `*  },@`` ,@,@` ~,@`H /e* & H H    :?0 * H 0 $a &a耦 $P$ H /f * ' T* 6ђ  "#8@ <"`<<8"`8> $ؐ#H($0,4$0 ?4> "X’H 0 "&bLb` 6b`&bLH /e * & @0  ax$a\{ ax$&axH 0㿘H /e * & !| T (#H 0㿘 ̀` ؟@  H c` p    @ !| 㿘!|H o *@ f !x {&!x̒ H p@㿘H /e * & ! r"P> ߦ# 2` H /f * ' > "Xc H 0   4 H /f * '  4H p@  $ $ 4 $$ $ $ 3&H /f * ' > #H) $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0$"$H 0㿘`؀`Ka|@G> @aܒ`B :  $aax@@>n `"* `2` "``p'> Z`n*` * " * &`p 0  `p`̐ >` &`p@0 H /e * &  axax@ $ax> 1> * a@  * axax $axH 0ax@@ڒ ~2axb\bt 4b\@ϒ?ax0@  1<b^ @- H /e * & 0 $ax@>nb^ 8ʒ``Pa` $a$`P0*$axH 00 4(bT @>n H¬`H /e * & `Paax` $ax$`P$aH 00l` ?  "` bPbT@ 2@$bTbT! " bTbP$bP"ax axH /e * & ax* $axH 0`05@ +  bH*@'H /e * &    }  $axH 00 *$ax H 0b\ @ bP 2bP#bP 2 bPax@@>n `&` bP`  `$``$&`$bT`<c4b^ $bXax`@@>n x *$bX *b\`$bX4b\`  &` b\ 2b\  @ax@>n `ؔaxb\ 2b\ "b\bX*b\ bT`$bX4b\  " b\  2ax@@o>nbXJ *`faxa*2 `  4b\ax@@Y>n2 bT`  "@`82@` ``$`0 `  "$ @+` `  ?&@ 4$` @ 2@@ 2 @ax@@(>n n`#ax$bT` &` `$ ``$&`$bX` > 0 &` bX*@b^`*2 $bX* 2@ (4b^@$H /e * & `Paax @ $`P$a$axH 0ax@@ 㿘`"b"t*@ &"t"t `  >n !"t@"b&"tp ">n  >/pq> 12a( @ + @  +  +   * >+ + ޒ  0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@CO  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@C$`&`㿘6 & 0㿘`$L  2H   2D  6  2?  `!> h*` €#  #)  "] " Ϥ ,  *@ P    @;+ P .`   & LV  & L&& . & . 㿘 L "E B 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . S 㿐#\#` 㿐\ #\#`㿀`'H`*  ` '`? ` 'T' H"T4'TH /f * ' > "X  H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H I"$ `T@ (&`H /f * ' > #H̒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8` @ $      8`"  $ 0   " @?$@  ` @,@``,@`,@`,@``2 ,@ ``,@``` 5` % ''쀦 '@? `* @,P@ * @`@  `  :$ , P@@ @ `-> ߚ `#̸ '耤`'7 ,@`@* $@$ H /f * ' > bX& $H 0`  2`H /f * '   5 H p@ ""`"2` CT" %$ H /f * ' > #H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ r/ `@ * ?@ `'-` .` X@*`@ `T22#2`T26&`%`% 4@2 -> ߤ#̸ 耤`'7 ,@`@* $@$ H /f * ' > bXi $H 0`  2`H /f * '  4H p@ ""` " 2 CT" %$ H /f * ' > #H( $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ r/ 耥`$@%`$`  %` `%`$ !% *> ߤc̸耤` '7 ,@`@* $@$ H /f * ' > bX’ $H 0`  2`H /f * '  4H p@ ""` " 2 CT" %$ H /f * ' > #H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ r/  耤` ' * 2 ,@`@ z  $@$ H /f * ' > bX, $H 0`" 2`H /f * ' > ߔ 2H p@ ""`"2` 7T" %$ H /f * ' > #H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8       8 `  $$@$  * ?@ `@ `  -`  `@ `<%`@T`%`<H@ H"`4`8` %`8 %`4`H `D `%`H%`D㿘` ``*       4   `& 46 ` `?V`S` `X#@ @ *@*P  * @`      :" * P @:   #` @ *?* `.  *  T@"2 T1 3 #  L& + ,  2   @2@, @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . 㿀  'L&`"'  '  '` ?`4 ` ` $@ * ?    D>n !(5 4H /f * ' > "X H 0`" 4`H /f * ' > ߔ 2H p@ `$ $`4`$@$`$`$` `2'ڰ $` "H /f * ' > #Hp $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`@`$`   ?`82'`" ` `$`0`   "  ?$@ ( 0'***!'X`R'? * '' F2 *@'a' @`0@`2`   E>n @!X')'@ @@@ +>n W!x>n!Q4 @  L,   ' >n !3 @ <`$$` H /f * ' > bX H 0  6 H /f * ' > ߔ 2H p@  & && 6  E& &$@H /f * ' > Hn & $H 0 $ (  & 6 & 0& (& ,& <& 8      8``"   $ 0   @" "   ?&" ``, V*``P *,`*, "HC, , @+  P@.-    :# +  P@*X`*` `T23`#2`T3`2"L$ *@+2   "',  @`2` `$ $` $  @ $$w$ " H >n 0!H `@D$H<@ $@$D$<L"㿘@q y 㿘{< 㿐`29   23   2/   ` 2*   & 2` "  d y^  >>#lc& 8& <#\&  ?   @ &  H@3̒ 0{  㿘@ z 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @& 㿘 @&㿘 `# `*`@ &@4H /f * ' > "X H 0  />  4 H /f * ' > ߔ 2H p@  $ $$ 4  `&@$   (& H /f * ' > #HĒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   "  ?$ `6   $  $   @- `- - -  : - -  $($$А"@$($$   $``$  "$    2(" ($ $" (  $ H /f * ' X9 $H 0`" 2`H /f * ' > ߔ 2H p@ ""` " 2 E' %$ H /f * ' > #H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 $$     82$(`"   $ 0   @"   ?$$( А"@$($$@  >n0"(>n"P&  "R( M  ($$ 6@ 2P " @PT`$P$T@ "Xy&@X\@ $X$\HL@ $L$H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@9~ &`㿘`24   2.   2*   ` 2%   ! 2`   d w!  >>#lc& 8& <& $ @  &  H@1 0xȒ  㿘@Đ x 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @y&㿐'@` ` `" ` `$@ * ``*     "z >n 9"Xt &H /f * ' > "X H 0 #9>  4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $ "7 $ %@H /f * ' > #Hu $ $H 0 $ 7>  ( $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   "  ?$ `6   $  $@  -- - & & @`    & $& (     2 (`"  (`& ` & ` @`  ( & (   -  $ ( & $& ($ H /f * ' "X $H 0`" 2`H /f * ' > ߔ 2H p@ ""` " 2 pH /f * ' H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 & $     82& (`"   $ 0   @"   ?$& (@}    >n 0 ">n"P ] "G  ( B$@$  H L P T@ & T& H& L& P'@ @ 㿘` # *`@ <:8 &` ?& & ?& &  & ` & ` @# "@  >n 0 ">n"P 0`2` X \ H L@ & L& X& \& H 8 l l  h    L ( `  t    d   X 㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@6$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  > 1< 2 > 1"@0& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @@L  2` ( " (" 㿘  `8  `` 8f & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` > 1"?$`` 9> 1  *& ( |?* :``( *` @6 $ q&   "  ` "   |2   q`& `2u  `" `> 1"?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ ;0@ 0 @֖ `  D <*  2? D <@-ד*`B` ` |&  `2   2  % ?c ( ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @>@& @7C@`@$`$@㿘 $ D*` <*  & 42? D <@-K*`> 1 |a*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!  `0`d`p``8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 06m h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@̒"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d & T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \ `# @ l p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @  d<& T )` ` ) 0 d  @ " d T  0   d" @Ɩ  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @O & ` T  0   d" @ d& T  `?x>n"> r> r"(   ؞   +  # a((+@ ?` >n(#\* > r"   > q * $@ +   (**@ ?  *"; >n#\> r" *> q + "?,@  ` ?((!*@?  $`2? 62> p"2  ,   2 7耤 !> p"2 ,  3  7ꀤ!!> p"2 ,  3! 7怤!> p> p"2 ,  3! 7> p"0@=!> q"  4`@T 4@  `㿘> q"`Fbbbb b& >o>o>o& 4H \ )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@5C @ & 59@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ 4$@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(>o   *v $  * `"?  * `@$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)"">o  *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@̖ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> p"0d⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &b0d #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Vz+w+""    2 2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> p> qb0@Ɛb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  +2@ " > r & a( @ *  2 `> q#( *`>`!#( @*)` #( >`!#( *`@ 2  | '"2# d>n Tc\" *)  @@/@`?`" "2@ 64  bb  `?㿘☺@ > q>n@ (@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> r(⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> r("@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@>n\+> r"@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @W $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  > # *@  "` ?㿘ǒ 㿘 "? ? `>!*` € ܔ  & &  @   `" &  ">o`p 2    >o"  &  " "   & &  @ ` &  ">o`   * @(n  $>o` $ `@B`      @``  " "~  @Ҕ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   ">o` &  "" " ? ?`2   " ?"㿘` ?@㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "`G $$ "@?㿘 8 " <&? 8  `$*`(  2  ( @ @L @I (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ p 0 4@` $ "? ,"` J>" *` €?  *`` 4  `&  `/`2  `4 $@&إ4@b@耢 & & $& @&``$  &`&@& 4? && &  &4>o&!8&`4& $& @&``$  &`&@& 4??  *`` ?c82   >o&!P&`& $& @&``$  &`&@& 4Ҕ? ` &&  q `& $& @&``$  &`&@& 42D  , ` 0 ( @ "?"`22 & 4@ 0 4 "@ ,? ," ` 0 ( @ "?"`2 & $& @&``$  &`&@& 4u 8' " %%@&     &?  *``  ?, `& 4   ! >o&!p&`& $& @&``$  &`&@& 41?@ ( ` `(  & & $& @&``$  &`&@& 4? & &4&   2  @> 1 "8Ϩ?  *``   *@ *`"  & 2  4    > 1"8* *`"  &  &   @ ?2 & $ `(*`$  && $& @&``$  &`&@& 4 &&  4   ! @  >o  @,  y?  *`@ ,   *`    $@ * "  & R4    @  ]?  *`@ + 4$@  4 @ ! @$@ 4   >o&!&`& $& @&``$  &`&@& 4E?  ( ? + "@ &  4   ! @    @ג  4 #\&  `   !`''#`@ܠ ?2 & $ `$*`( && $& @&``$  &`&@& 4@ؠ 2 @@& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@ @  @f @c 0 4@` $ "? ,"  `I&  && 4@ 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘@ (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <% `@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?" 8'H\'L'P'T''''''''''''''''*`  " H  !":  `   , `" @*   ,``"@8 " *,  @   /`,` @?"  '' "@`  ,  *`#`" H`@*  '?'p ͮ / '@"¸ ._H . @``'(`(`  "? " `@*8 (''' @  p@t`? ! p"" //'*` $4@, ""4H*`'  / /L    `/'LT" *  `P/L" P* '4@ *  ?, * ""   *@ @" @4 @2@ *@? @  %*.? @ E 8/ ` `2?㿐#\#`    ??>o# & @Ғ>oc&?㿐`\>o>o#\ᴘ"0#`!q ??>o#/$ -@@>p`$ %?,`>o>o#\⬘#$#` R ??>o# $ 2 @@>p`$ ?@@0 > 1> r (#"> 1™   ")> 1%> v-> v'> v +> v"`"" Ub>>"Ȓbx?h'pH "? 6"  *```"a a *``a"a4  *``a" $#\>o>o! !ᴘ"0#`ۚ "? 6"㨐 $#\>o>o #`⬘#$ Śc %"b?$b%&@&c& 㿘  ? *`$`( ? 㿘 (    * * " " "㿘 0 4 @` $ "? ,"` >"4*` €)` '& $& @&``$@&@&`& 4   @e  0 4@ ` $ "@? ,": $   $ $ $ @ >o`  *`@ >o`+`@   * @  @$@ 4  $ $  @ $  $ $_   $>p$ 8&`& $& @&``$  &`&@& 4? @ >o`Y  *`@ >o +`      $ $@ $ $ $4  @ >o`H  *`@ >o`+`@   * @  @$@  4 $  $ A$ @ $ :$ >p$ X&`& $& @&``$  &`&@& 4H? @ >o`  *`@ >o +`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 ( @ "?""& $  ( ,   ( ? $ $2D  ,  0 ( @ "?"22 & 4@ʐ 0 4 "@ ,? ,"  0 ( @ "?"2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& <  ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <@&` & 0㿘04@$  "$" ##@""""4 , >o. .`(  ( ( @`x@>p8  `!d7`(`!   7 (   (>p @X@  `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 㿘?6  ` f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@#@#񀦠,`㿘. * !>   $#@Z** #@*@ *`@ #> *`@$cD#@ <> !> >b"Ħ )>pD @4!\!ǐ D 5@$@, <> 0!t+ $ @4 8$ $ $ $   $  , >$ \$ P$ X$ L$ T$ `$ d , 2 c@Ѱ!㿘@c: "?> 2 @ @ .  > * cD* a\   2a\ 㿘?> 2 c@  . v > * cD* !\?# @6!\H /f    Đ    !l* '  !l ގ  ` ` & & "` ?& `H 0 8 "1&!`!\$2-&!`H /f * '   8 @  `2  !\2 @,   2H 0&!`̐ `8?a\` A2`892a\2/" `8"`8a\2a\`8" a\" `8"`8a\2a\`8" a\" "a\ 2a\2 㿘 H /f * '  a@ a@a @% a@! a1@ a2@ a@" 0& @"  / / H 0㿈a\ " ݨ @    ȟ''`'```"`8```$"  `?ܐ"   ?"  `` ?`&`&`  ݾ `" `` "`` &``" , "`’` H /f4 * '       @&&`=  7 2" $  $  $    $  H 0 \ %$ \H 0 T d`$ d$ Ta\`@?# @4a\xa\  a`  adgahal ? > 0@  *  (> D(H( "}@"dw@"z`@"d0t\@"@0n ]@"!v"~@"<0b@T [@\"@ *<28["H" <282HS"8 H H 28:28H 9 "\\+2\? "\\!2\?2\""""` "d  "h "H   H  㿘?> 2 c@    . > * cD* !\ ` ? @# @6!\H /f )>pH 0ذH 0а* ' )>p!\ " !>p!! u !\  Ѐ *  2!  ` ` & & $` ?& `%`!\!`@H 0 # €  `@6!\!! un `"!\H 0`i`_^`> ߦ#` @ 8 ``jH /f * ' T`* 4`, ` "#@`8@ `<"`<`<`8"`8> `$3#H``(`$`0`,`X`4`$`0 ?4`@> "XH 0 `"` `I" P & P㿐?> 2 c@   , . * > D* `c  (H /f * ' > "X( H 0`#1>  4`H /f * ' > ߔ 2H p@ `$ $`4`$@$`$`$` ` ߰ 7W 7'`T` O> ߨ#̔ 8 $` `i$``7H /f * ' "XВ H 0` 4`H /f * '   5 H p@ `$`$@$`4`` 쀥`` `  "PڇP {$P" "`, `"` ?" `?"`0 > "  > S#x \ /0SH /f * ' `` @` #`H p@\ 7 $\<03" ``#@"``> D `, #`#`"DV > #> ]*aD  L L $L`` $`H p@㿘?> 2 c@  . 9 * > cD* H /f`* '` `0  > ߑH 0 bDl0 H 0  H 0  㿘  Ѐ + Ѐ    `"  €  !\`@?# @4!\u.!\  !`  !dd!h!l㿘. "* *  Tx %> G$H!> $#L@#L =H> >>b!%>#>p d "/ !$!$!4!~4!4!4!4!!z$!$! a , <> 0!t%ܐ , >$ @$ $$ $ $ ߐ ,  L Ϡ!x> " @H / * '  H@"`4<@"i`A S@ P@@@E@   !@"*`8 @"` =@ɐ?@v  B@)G@  0S@P@~ !N@"L` T@!M@  q A@АF@"g 0 B@Ð 0!C@>@ W D@O@D O ]Na: I "C `0 2=   t2 22  `< 7 `8 ,ؒ @ Z`8' `4`87` ݒ   @ E`8 4`87` ɒ  Œ    2   SP    `<    @ Ȓ    7$ x, `$ $ t$ d d$ h$ l l$ p؀`$" $ؐ$ $`0`\̒a: ͐؀  t @  2 t " 0| t` "` "@@  t@ ` 2 t0c@В\a: Q " `0  2     t2  }  Rה  ΐ@ X $ t$ d d$ h$ l l$ p`$" $d$ `\ca: d  t @  2`"  "` "@T_  2 t > ;  "6 `022 ؀ ".  t2 "'  x& \.$ `.% t `5.&`\a: А " `02  ؀ ? t2 ? #@ "$ x `< 2 $ x`[a:  " `02 ؀ "  t2 "ٰ %, `@ nѰ[ђa: Ґ @ǐư`[Œa: Ɛy " `0 2 !"@    `[a: @Ӓ"&`[a: @$ `[a: $xĐ >  xy v& "`8@ې`8 n @j `[ha: i "] `0 G2W ؀ "S  t2 "L  ? 8F ! ` @`@  @! 5@  0[0a: 1 "% `0  ؀  t2  @ @ `[a:  @H 0㿘 0؀  t2`"  "` "@ @G@ RR & 0 2 tp!ؐ     ! `  `2!` ,`'*,* В  @  t`@ ܔ  x' \ (/ `/ t` 5@/ ?,``(?&`  'ޒ ! 0,` '+,* В  @  t`@   xa' \ (/ `/ t` 5@o/ ,``(?&`  'ݒ ,* &`h `  `  `0 2 a؀``t 2@`2`d `l `   ` `2  ?,* "* ` -w` @ G`tؒ`@ B  /  ./ / / / / / / / / / / /`$ @/ L,` .?&`  ʦ`l ?,* "* ` -6` @ `tؒ`@   /  ./ / / / / / / / / / / /`$ @/  ,` .?&`  ʦ,* "* &` 㿘 8 @%!܀ 2 8 O  &!ܔ !ܑ*"@ p&! 8! @ 6 8>  ! vx㿘 8 @ v! @c 8 6 8㿘` j  ` 0H /f4`8* '`8 @ @R   X   @ ԗH 00`  ԊH 00| @ a؀Q t 8 @"H 2  @&   & `X`7$`X .      沔   2Q`X $`X @@ 2@"@    ` @`$ @ 2t )H 00 @ 8 @ @ ˔H p@0 H 0 㿘> #L 3%> *" *  H* @@)H /f * '  ` ` $ $ "` ?$ H 0 `Lӑ*㿈 8 @ , `& L & L ``!ؒ@& `  t2  x " ` \   `  ՘  x  2 x?#@     " x @  x "` \ ` #   @2`0`"&  8 x @   `  ` ^i" x @ b ` ^ ` ^Z x @ Q d@ J @> m` # 2 h28 h & hH /f * ' @H 00J @!؀  t2  x  l \   l@ 0) @ "`@? @0H /f * ' @ vH p@㿘 0    2 ?>p!(6 08 @؀  t2 @  # > 1b@   2  x@  "k  x "  \ c a _沔 .  W ``' 8# `  $"    ܐ"   "    $ $  Ҏ  %     $   H /f * ' @& $ H 00 2" &&`&H 0> D "D  0 > #> ] *aD   <  < ؀ Ӕ t <`2   6  t& 3 t x "  \   ؀ "1  t `< 2(a\@ *   x ` @  t&  <`  6  t 0`@    2 t ``' 8# `  $"    ܐ"   "    & &  Ѽ  "S      & "J   H /f * ' @& & JH 0,  2" &&`&H 0> D "D  \ > #> ]  *aD       㿘> &"䀢` >pa@@ !؀t`4`4 "x  \ x "w2`8 # "o`8 @"k` ``@ ` $` X`Z& X@R 2Tl@ "M .   р   沔 x  2е X 0& X @@ 2@"@    ` @`$   @ "`@?  @7@72{tz㿘! x沐 ,  p`"A!``'8# `$"   ܐ"   "    &&  Њ <  &3 ! * t`8 @""` 2``@& ` &` X`& X –   X & X@ 2 t㿘!܀  2  J  &!ܢ !ܑ,``c"@k&!@!ܑ,`@ ' !!@w  JĔ  q %  , $ , , !ܕ,`@ $! "`!" !ܒ@ S$ `@w   "`,` $``",` D` !!@<  J  6  , $ , , `$$ `"!$`2Ϣ!!@  Jk   ̔ , $ , , @ $@" $@$ ! &! 㿘!܀ @!ܑ* @ "  @    4    `' `ṕ* `+ ( `* @ `! 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘!܀ "1!!!@(,!@O!!@%!ܢ ,`@"`  "$ "@!  K&!!!@瀢c$!!܀` !   8  Ks &!܁㿘H o*@ a@  H 0㿘!܀ 9 !ܑ*@$  2 `? * * "*  $ "! &!K/ ݖ$!! >  !N p 㿘!܀ / !ܑ*@`2 2 $ "! &!J $!!   8 !J &!܁ 㿘!܀ 1!ܑ* @ "*  @   2`"  "` "!&!Jƒ ! 2  8 2  !J &! ܐ 㿘!܀ , !ܑ*@2 $ "! &!J $!!   8 !J &!܁pܰ ; ` `? ܑ- @ "- Т`2"` ''          /` ( @ >/ -`?&``(( ڬ #$ܑ-* &`㿐` (?  (":  h 5@/!"݀@+%8, ` '  g?c*   #2  2 (   5(!"݀   㿘"    `@  2  ` 2  @  2  2  㿘  H   `"   k `(  g `!` ,  ,  ` , $ p" & p ` , $ h"& h 㿘 d " l d d@ & d& h I  d 2 d l  l l@ & l& p I  l 2 l X Ơ ``' 0" U  ?ΐ  l2İ @,  /ؐ/ْ  Χ 2 3*& l0+" 1  `?ΐ   l @  /ؐ/ْ  ΃ 2 3 l u   l'̔ w@ذ "s  $ 2o   "k   ̀@2K H > HH; > ȕH '   Ȗ B 8 ̀@ # ܐ ' $ " &Вmɐ @  Ȗ B Ȁ 8 ̀@ # Ԑ@' $$" &ؐВm p ` #\Ę @  @ '  㿐  h/'T!"݀@*e`    ֖?c* "2zT #2uT 2qT( hT T T  h!"݀@TP T` JT`  I   'T> a`   @"` T<  > a`X +"`X2 < a` ""`  "  'T> a`  "` T@~_* `7 > a` "` @T T$  8 2"@ "  "ͣ  8@ T x  T"`T TT`ـ `  ג 'TT` T`7 T@~@7 T` '  (  'T> P `B :T @ `> P`B :T<`B:` 8@ " (  T T  @T``$T8  T`$"  ?ܐ"  TT?"  T`?"`T  " T  'TT` T` T` "`T F   T``$T8  T`$"  ?ܐ"  T ?"  TT`?"`T  "   'TT` T` T` "`T     TT  V 㿈 ($ %   C?c* "耦 #〦 ߀(ۀ ̂ }  @    #\#`@0`@@Q`(``&@``'8# `$" 4  ܐ"   "    &&  $ I  &@ # ``'8# `$"   ܐ"   "    &&      &2) 7 H /f * ' @*  H 0 H 0a2W` > a`D "`DP㿈` `ʔ` ````@&&2  7` 2" &``&` &` "  T` &`" T X $ X d`$ d$ T`d&`d`l &`l`8$ `@ 㿐沔 ɱ  \` @`0!t&`@!h`X>`8@6`L "!p6`D`&!6`D!x6`F!z6`H!|`]6`J.`O!.`P!x`D  `0.`]@.`^` @, XH o4'*@ g' t 8 @2  H 0 0ހ   @ H 0 0ΑH /f * ' > "XxՒ H 0" 6H /f * ' > ߔ 2H p@ $ &6&&&&   4H 0 0& && /Ē B?//*` ` '@ ` '/ƀ/ł`@ 2`* 2`* 2`* 2 @2 ```````777/'7//////777//////!\> 1"  &7 ` &      @&&&  7 2" '  '  '  `  '   8$ @H 0 !`!h !l!d`? `8B 2` 8; `86 2` 8/ `** (`&   `  8 2!h `8 !h 2  !l " `Z`?㿘>``$&`>`6`Z@`2!x`2!z`2!| ` *!㿘!؀  x  @ "  \ Y 2 x`!h  !l``X`Z`? 㿐!p tH /f * ' > "Xwn H 0 " 6 H /f * ' > ߔ 2H p@  $ & 6 && & & k  & & a\ &  > 1"  4  / B//?*'  /'/ `j H /f4`8* '`8 @/ ` `` ``@&&   7` 2" $``$` $` `` $`  `8$`@ H 0 Ɛ㿘@@z㿘!؀ d  x \6 2X \ "T !h@ @ 2L!l @(G`"C` 8? `  @7 872  ` @80  @``@ *&8%`  8 ` @ 82 Z `@8 Z`Z@* 8  X`X@: 2 x`&!p!h&!t>!``>!``` &!t㿘!؀ = x 5 . !`@) !d@$!t @*8  !h   !l@ 82 X!l @8  X Z@8@ 2 x!`:`!t"`!h`X:`2`Z㿘!؀ ! x "!p, ^ , ]n " , ^@ $@, ]@ 2 x㿘`\ @  `(@ 㿘`\ ``?  `_ "@ @ @`(* \㿘  .!!@Ԓ   !  2!@ɒ  .!㿘!@.!㿘 *`]_'D!'P ' x `t 'x "tP `ڀ   "@ƶP  'P   B2P B2P 2P* @2P 2P `  P/D@PPؒ & 'P  &Р ԅ,`' 'd?ә,d'?`?'|բ 'l'?h'T'\?4\d?X4`+,ܠ ޕ-`|-?xT?P \* X + x,`d4 @* |'t*`T3P 2`* 4@t+@| \   +. +ׄ ?  ذ  τΆ @ ??'77777 /4D//@ P Ç 㿘`\ : -ǔvn 2!p "!p@!! " !p@!!@ !p@  0Β 㿘`\   㿘!@[ 㿘' _%  !~!6!x!6!zd6!|@B!w!@9 㿘`\  Q `(@, 0I @  `_ @!؀`" `x"@`!h2 @`!l2@ `2`x 㿘c!@ *!*!㿘 `^ 㿘!ؤ !  x " t < 2 ` 5*  4 X  \\@m  6 t 2 x2 \@a0] ^(!+ ]+` _ ` -  ;  -`     a ! !~!6!|!>!`6!x6!z>!h&!t&!p.!@.!@!!Ԁ  >(`!c!Ԁ 2!>  c!!؀ ! x @G@K 2 x@@d 㿘!؀ "!Ԓ |@\ @Z $@X (  !Ԑ  c!@K!@I!@G!㿘 \  .`_`$.`]@8.`^@6`(@4` 㿘㿘> `$.`]@.`^@`(#  !~!6!x!6!z(6!|@!;!@ 㿘ɐ!آ  x A 2<  2 x>!h `!~!6!x!6!z6!|@Ԑ! !@˒ 㿘 26`Z6`X!h`@!l`@ .`Z2  ~㿘&`} * _* _p`t8  '0 a6Ѐ 2 `\耊  " `\`\ X0  Z0`\ S㿘H /f * ' !آ! ! ! x  2 x!z@] "!!@U "!K!@M "!K!؀ "! x " !x@= $ ڒ 2 x!؀ " 8 x "!|@) ( !@! " 2 x 8 @>  b}!H 0 22 22 㿘 .` !* @ 6   㿘 =@  <@J aQ@":aP@+0AaR@5aS@'090!P@ "!8 !R?@-T@*0*@ " ! !S@0!6!~!2 . 6!  * 6!~ *  6! *  6! 㿘. *  ;N > `"#T>pyG!X!>  @$#P#P @'>)!L>+>a ` %>pTx" z> 0at$ $ $ $   $ z}  5, >, <P`@!pl$x 8$6 8 Ѐ )  2   " 8  & & $  ?& " 8`8 A A`$` X`& X А € ޒ ` " , `< >p`b ,xА! "`u9`  $  &4  Ē  a77v7    2  P & P   $  @ؔ  `d $`d b"``l $`l` ````@&$   7` 2" $``$` $` `"  T` $`" T X ]& X & T`8d2X `@S А ;6 8㿀 > cP > *T * @ !l2.`!v2  2 &U 8  O  ?  !777 ``' 8# `  $" 4   ܐ"   "    & &  Z       &   @-  ɒ? A A"& ? , " LtN L`$ L 㾘`  `  2``P  C$`P` @ /> cP > *T * @`!l2!v2  8 A A"` ?&``6 ` `` &` &`&` ,  ''' ,s L`$ Lk 㿘`< @ +al < $al` "`@`@ $`@>p $`@!`x``8?  @4`8`<,`<`H$`H`  $``4> 0|* `4 *`   **   ` a\  㿘!l @> 0!|% 4& @&!l*    * @*!\@  㿘 8!!| !l}{  !| !|  !l}n !| ?$!| 㿀> " !2@@  8!!@ "!l8!1! @"!l @ 0@ "$!l!9@2 00a!@a:@Y 0 " `8 4`8 ` z@0v!\# 0q`"o ` `@?@4d `-$a _$`@`BJa: XA  QO  \zF`8 ?F4`8 o@B z ;  64!v`8`@^4`80.@ !l >p ؖxL!v7  C!l @ !l @\ 㿈p 4L  8=  `A !d$ !x $ @   @  2`z!x $" $%!x!l 1| 2 `""`"@9 㿈  ` G!d @W  2  @P  2 x`4/ !l2|~ %!x  2`"  "` "@9s  2   >p>p>p!a8u"ђ㾈!l'$` $`!x$ $` '  $` 24``"  "` "@9< !x 2 R` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @E  2  @>       2 `  @ `> v  8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` p` 20j: "  :  ,@8 `V`4 `Q K``"` 쀊 `@ :@ `" ` T4. `2+ 0 @8  "       "   2  "  2  I    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&&"  *`:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  㿐> #` @ " @> #X , )> v> vc#  `#@$#-> @ '> 1 #L? "?#$@4 ̀6$Xn , 6#"@@#$*@X#` #@ 2 T`R`  05z  I `@`0 0#ӔXC` >pbHs 7 0-   "  $L  :  `> 1"*`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  㿘> c\  "c\  5  >pbxsB  @  6 .  " & & & $㿐  `     2` ` 8`=  ,:  @뀦``"T g     2 2$  , $ `2$`$` $ $? . & 6` $ `4  ` ` ,  @@8 T` 6 @`2*: ` "`T`&`@ 2 `T &``2`` *V: @ "$V &$&`P-`T:   0J  & E$ `T@@21,V: @&!4* "  ` >pbrX Ӑ ݐ 2<`V@&$&㿘v 4  @@T" 2 `        2  `"T O >p $`bq  >pbq 8  ? 2" `T V 8 4,  V 2 >  & 2> "@\""\2 >p qb   ` C 2 & 2& &   `  ```" >p`2``">p "`c q  r & & & &  & & `2"`"`" ["`   `2"`"`&3 V  @ 2$"@ > #\ & ? " " `2##\>p>pc@Pq1 "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘V  6   `2  "   V ` V  6    @   2  "  㿘  t9  2  "3 @ t&> vc`,M `\ * " " @8*` 2`$`\`!> v# `>/# ` >0# `>-# `>-#>1# # ԚbHp$@$` $`$`$` $`( 㿘>   !> (`@4$#`2(#``*`>pcpp 0)  2; #> v $c>pp6##`*@춒@ #`> vc> v  " " *  **> #X >pp#㿘  > 1 7> 1"y "$   `4 4 > cXcX $cX" "cX$  㿘  "``"  "` "@3 㿘  ` ̜ ̜ ̜ ̜ ( x 8 ͔ ʹ x ̜ ͼ ̜>  X㿀> #X'T'X'P'H'L H  @@2@ `" `@28  "  @ 2.  @ 2$沔 G  LՖ   ͐ఀ    2 L͸ h0 ̱ఀ  0[ 㿘 `  k -    \ -J`U.`>2"H €  M I "F 96C "> 9A0 '8 1 8$ + 9 `€"  $ #E   2   2   9P& >pn#> 㿘>    "  $* €  2 㿘k> !㿘` `@  `4  @ &`` 2   X > !*` 'H / * '  `3 `€ .> +cd`"' 4!" 8̒     @ ' 8 $ 8  4"  ` 8 $ 8> cd`  "` ` @В 4'Đ@  H 0㿘`  `@  `4  @ &X > !*` 'H / * !  `F `€ "A  2= `5' 4!1    @~ "' 8 /$ 8 " 4"( @o 4 ' ' 0' @ "  4 ' D' 4 @ > 0 8 $ 8  > cd`  "` `   @C 4'Đ@ ! H 0㿘 2 8>pm#Д?-& 8 4 )  > >pm#cd? "cd>p#o0@  @ D`" ` ?"`  18 15 㿘 2 >qmq  ?1& 0& X > &"䀢` >q`@iw p*  3l) @'  0 @2 @﶐ 2  D@ o 2 A=`` "`4  `4 ,  j'''''' @``4> #h> 4cl "4  @˔ A  `'@< > cd "cd" $@^ 4''''ܒ@9  -㿘` `  ?  ob o)oX o{ 2| "   8 4?` & 8 `  2 D  D " `   o "`@ 4''?Ȓ@V㿘 ,   `" ( ` 2  (o5 " (` & , ( 2  (  " (n& ( ( 2& (    "  "   ,`" ov& (`    $ $ d& ( (`" 3 , ` & ,㿘H /` * ! `> a* @ Ӱ /`$ 2&` "  "T`(0=0”`` 2 `    " `x>qk (: $`x  8 ?$ 8$`x`4`D ? $`4 > cd "cd&`8  $`80"  2 4  D >&`$ 0&` H`&`  &`$ 2`(5 m`(  -  c 7@ `$ $ 4$ `@a` /F R 7`  `@ `  `  2  x "  /% /" .   $ $ D $ @P$ PT$ TX$ X\$ \`$ `d$ dh$ hl$ lp$ pt$ t$ |& 8 $ 8H 0㿘@ ?    ?    0 "  ?  @8  `(   -  2 & 6 T & x & 0^X.  x `8 ?"`8& x 4   & x P 2   T" `T8& T 㿘@.@ @`.@ `     .@`@ *@ @3"X ' `0     2} 7 Ēc " 8 D?@$ 89d 3b A L$ D@ 4 ' '''̒'D```   @ 8 ` $ 8`24`21 "- 8 D?!$ 8>qkǐ @ D`   D` ?"` $ D $ @   &   @ɔ㿘#> 1b؀ " > >q>q>q h`pi#p"#h!> v#>9apR>  R $b؁㿘> 1"؀`  +   @j && &  & > hh`&  "`"h& "㿘3 `"  "`   "@` "`&  `"@ "  €      , -d   ">q?& k-   2  ` "`  " 㿘 '#>q `"  "`   "@`"  "` "`  "@ ` ?"`j`-%  2 㿘>   T ,>q 2%  `"  "`   "@`"  "` "`  "@ ` ?"`jȐ(,  2   +-   7@嬒 $ $ $ $  $   "`  & $ $ $  "@&  `  "`㿘>  TH /`4> * !> #h`@ 1``"  "`   "@` "`$`  "@ "  €      W , ` ">q?$`jX!P` " ` @ & ``2`H 0>  Q\ P P 8 8 8 P㿘`    * & @! `* (   > `p ?"`p >  p" >  p"> p` ?"` p`?"`H /``* !`  > "`  G `>  ;  , H 004  > `p  "`p >  p`" >  p`"> p`  "` > 1"$ p`"  @6 H 0P'L'P'T'X'H  '  `  `    2` 7` 2`>qg!x`K('`@ '  )ڔ  ' 7 ٖ > 's +"`4&@G 4 'L@הĤ`' ` 8[ Ȁ "  8S Ѐ " Δ  "I 7 @ *B 7@ ` "< 7 '  `3.a: "- ?`'>9"*` € V 8 D&8Ȁ   F  P @S$`8?"`8"H> a* @2  / ̠ "  " 8 &8 c  π0 ʀ0 '0''H' 0"@`"'` 'D'`8 "'D '`46' @ @  (  " 7]* @ 4&P&$T&(X&,\&0`&4d&8h&<l&@p&Dt&H~& b zȀ   m E "i " `؀` Ȁ   "i3 -$ D؀ i 2  Ȁ  4 "  "  D "  D   D` Ր?"` $ D  ' $ @ $@k P D "   Ѐ 2$ H P * $ P $ $ P - "& @&"   @ >  `4  ) C0/ 24 Ā  > 12" @e` + "@~)֒ ` > 1> 1> 1bQ܀  4   `" `" @`" `" ` "  `" `"` " 㿘@g  :  *" ?  @ *㿘 J  @*@  &@T`-  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @&ݲ    && 㿘   L  T L$ >qed!  .- H /f * ' > #H]h & $H 0 $ (  & 6 & 0& (& ,& <& 8    "0  & & & @᭒`  ,`-@@ &@ ?   L``,`  ,4,  㿘 &@    L  T L2 `,` @*@&@ ?    6``,`)%`$  &   "(l  &  &&  & ,,4㿘>  `` @ "`"`@> 1" "`  22> 1> 1 b܁`>  `@ 4   D` 4 <4 V 8 $ > 1"$ > 1> 1 3 `>   ` `c  -> 1+> 1@Ȓ 4  `  `    @' `'`''ࠒ ;  4 2 `$"`"" ` > 1`% '0'' "`  424" "" > 1" 22b.bܢ```@    4`@V @\ 4 @  0' ' H''  D''8`'  ` "1` ,  4#  t#  P# $ T# ( X# , \# 0 `# 4 d# 8 h# < l# @ p# D t# H @`4# 3 # # # 8` "`&`&``@ 4> "8"f ``" 4@2Z `U @'Ԓ l``C'` ?<44 T8 D$ 鼐 $ ` 2;+`@ `2(`'` '`' A```` `42 `"`$""`` "`&```Ӏ '''2` x  f `a  @ߋ '   ''''H /`4ؐ* !؀ %   0> ! %>>`` .`  `@2` ( `0JH 0 &| 䀦@ '"  &  *` * " @ &         l    D   㿘b@ ( .t-* "?  .L$,   6 &. . 㿘  (b @ @/@/h@/@`.`"* * ? @* "?  "* * $,   6 &. . 㿈@?`    ',@   B @ &` `@2``@2  ` *  @@ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 3 @` @ ,``@``@ < @  ܐ` *`@D` Ґ 2   ?* @8 Ɛ "  * 2`?* 2  2`, , , ,  @ " * 2   2 , , , , ` @?#,2  4, ,,  , `  ?#x+ 2  3 , ,,  , ``!>?"-` €`` ^@\`2`` "2 ` ` "2` `` "@ ?* 2  3 , ,,  , ` 2` `珔$ `@  `."@ `@.@ `@ ," @.@  4 "@& & , , j     & `a ` p.` `.㿈  #\@  @` & 硔&@   1$㿘\p"3   ? # @/ 7 *" *  `*`* /h `( ` 2 * @`․@6   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` *`*` 3     + `   `0  "@    # W#   @"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` " `2    *  @ 6    ` 6   6 &@ " 6 6` @@`?# @3`@ @3` 8 6'@ $ ? ` ' 7 㿘!> #|!\@1 , 1>q/>C->C+>B)> 0 !a]!t&l@c  $`@$`$`$`,`<$`,`>a'$@`3 \Ԗ \!\a\㿘H /f * '    ` & ` & & "` ?& H 0 `c 0ہ㿘] `&"`T @" 88 @"  8 @ @2   8"@2 82 8 㿘!>  ؐ@ۭ!\  ,!Ȥ 1>q/>C->C+>C)> 0 !`Ր!t⌒\a  $`$`$`,`<$`,`>$@`$`@_ \M \!\a\㿘H /f * '    ` & ` & & "` ?& H 0 `ܐ 0ہ㿘֐ ` "`T @" 88 @"  8 @ @2   8"@2 82 8 㿘. * !> 1$#l   * #l*@ *`> 1@ "#h@*`#l />D 4>E?c0 #>q a`_   % /. >. <& @.!&. =& & & \& P& X& L& T&!d&!h`6 8_  , [ cl ۰!㿈 8 ` 'Dd h Q 2   D@ഔ  Q       D 䓔 D , " Z 7ʀ /> 1#x`D ` Ē  D` ` * @  D`@ڀ * 7 'h$  d@    7 'd$ 7@7``$" :p` H /f * ' > "XU H 0 " 6 H /f * ' > ߔ  2 H p@  $ & 6 && & & 2 `D`" 7> & `& ` & ` & `&` 6` cD  *@ @ & & `@&  ` * &` ` `*`" &`  &&``@&` &`   ƕ*`  a4 XD> 1#p`2 D`R" D`   JD`( `;" /``8`$"@ܐ"   " `  &`&`  b `` ``  &``"V `2 D 7` M"`D`"E  / ` @f - 2 * 2 . .  . `7"d2 . 2 2 . . . h@* 2`. 2`2`&. . . > 2 #.  . `* 2 2 . . DTl`"TD d ` @ d@'  D`X "`X㿈> " H / * '  f@e@m@"8  @@ 1@ 2@0I@ 00!g@ 8 !ji@* !J@ 0Ӏ@ "< a!h@|ʰ 0!K@"adð @ /,a 7,a" /  /`'ْa: `/,a`7" 8 +8 48?Đ*@486m $$al`'a: @$ad@2ad$ahad }ah yal``8 ސ?"`8$al@ual 2 8$ah$adH 0e 8 [48@d   // ad@[   //ah'/ 0C`'la: = 29 / 25 / 21  2- $ad$ah`'Pa: !$ah$ad " 1ah  1@   //ad'>> ah'> > H 0㿘!l@ !h  $ , ,  8#!h `   $ /!l``@2  8`8 ?"`8 $ $!h$ 2`  ` ? ( ? 228 * 2 㿘H /` * ! >  > 1|CŐ> "4`!> ` \@ H8@x `2`H 0㿘> 1`0 `L> H `"H "H!> v#>G`C>  C`4 `@ `< `@!@8&`T0 "` 0"@ 02 `4` &`4`4a&> 1` `@> `<`0,`@ 44H`@&`\ <``P `T!@ `| @ xv&`T@" ` ``@ @l  >q 8`@a` `<,`@`4Y4  t  &`L>qaZ 0L> > "8<`#"8"<@ $``4$&`4> b4b4 $@b4" "b4$`` `D`H- &`\`@ ,` !\ઔ > 1#`> "@&`@> b<?"b<@``"``@"&`L`4 ;&`4` "-ޒ 㿈 Q  5  `%  % @֔% > 0!p (4  4`(  4 4 , , a `] `Y `U   // 㿘!> 0!= "  ^// /   / / q/ `"`L @R 2  `2 `\>qaY Y `0>  H ( 8  2  8    0B 8 2?  "$ $ `\ 2 `\>q[" > `H&`\`\"* `4 ?&`4 `> H" H> 1&`\  @  $ `D!\J`  > 1#`4`\` &`\&`4$  㿘> 1c V H /f * ' c c $c"`"`?"`H 0 >q 2 >qY-"P  ے  #c c   *   @  Ȓ c h@@  c  c x`   ` V  Q > !|H @0`"< 0@" < H@2< ` @  |H  H2< `@2<`  `22  \H @    > 0a@  !>q'"X!>q'"@X 0܀!>q'@ߠ"ȢbX ' @ `?@ ~ z0v 5 `@ڻ L4@!>q'#@b}Xw 0Y@#>q'"c@!>q'@#bf X`  $\@" 0`" 0 #>q'c@{@ bGX@ 0"  `, Y \ > > 1H【 $\4 ?$4 `%  % 0B   5 1 @V    % 0     ( 6 6    (4  // 㿘 `2`8>qW#耢 $``0" `  2`*& `4 ?"`4 `    㿐> v * @ , $ 4 = 28 4? dd"80 `"L`   !>q'#@W   -㿘`H !\`>Ga!&`&`㿘      *   h@@0㿘   /  > 10) ' 0%#` > 1#  #> 1c > w\ @f  > w` R > w `M  $c> w9~ 㿈   4  %  % @R% > 0!.   54`  4(  !\ 4 4 , ,      // 㿘> 1#` . > 1> 1 "c"#'> w%>r#> ??c`2 : (7; #"?c %#> w ܔ > w ה   3㿐ƒ㿘 2>rWސ 00>rWڐ 8 >r%>r#>rWҐ@? W͐`H 4>rWǐ P㿘 >rW X>rW h >rW x >r $  W 㿘 >r   W 㿘>rW  t>r \  4W 8>rW! >rW!  >rW!( 0 @>rW!0 @`">r>r!@Wx` DWt!H D>rWp!P D >rWj!` H x>r LWc!p L㿘> !>rWY! >La  0>rWN! 㿀  `/ `8 >rU! 8>rU!ؐ@; /7 ` ' `'   @          $@ `  ( ">r?c     @"   "  &, 2 4 @c4$ * @,    %                         ߘ ,      , "1 2 4 @c4$  , 2 4 ?c 4$ ,       ? * @ 2i >rVw!, ?# , 2 4 ?c 4$ *@ > > > > > ;h ;x ;x ; ;x> > w D 㿘> w   2  &    2  8      """ $ &  ?㿘> w  "  2   8    """ $   㿘> w    2   "* 8㿈> 'L'P'T'X'H"H ` ""H "H``^$`0  ` :  2 ` $` "& & @N; H`<"0y  "@& & `H``H0gH0d  $ 8`^ `2Mv  0S"`"`8 @2D > !|'' ` ``t`<`'`'`7 `2` 2@8 ? " u&`@ظ 2 &`> ""D `` ``t`<`'`'`2`0< 8 2 `$ 0 " > !|'' ` ``t`<`'`'``2)@8 "@@ 2`?`>M"\*` €`( &`@] &`> ""D &` `` ``t`<`'`'`2`0 "8`<` 8 2^2Z ?@> |`" |` 2`<`"|`0& |` ` 2`<```t`H`@@  ``"uH@ 2``nH&`` "`` "` d b `&` `"[ Y  "8`S<` 8 2" `"0D?@> |`" |` 2`<`"|`0& |` ` 2`<```t`#H`@@  ``H@ 2``H&` `" `` >M"H*` € &`@(c㿘H /` * !   ?8 &   8`2& ڐ?@  )& @l 2 & > ""D& H 0㿘    8 ?   8`   `@ 㿐> bD Q H /` * ! > !|$bD'' `4 `t`< '+  ? $   2  ` @L   @G  $  $bD ` `t`< ' ' 2 H 0H(> w  2    2H@H /f * ' > "XI H 0`" 4`H /f * ' > ߔ  2 H p@ `$ $`4`$@$`$`$` `;> #D `$`  $`$` 2* *2" ""` ` ?$` $`*, $ @K4 4 ` `  $` $` /' /  @X > bH`  "` > 1Ȁ> |`" `,`( " `<`2`, > |`"  `4`0 " `<`2`4 <  8  ?     * H"*  @"   *  @   :@2㿘@͏   . ``:` `*`?&@ #: . 㿈 !@  !@ 00!@0  " H@ > !|   2 < a@"'a@"< a a@qa@2 a0a#@ a!@j !@  aa%@` a      2 < H@2 < !@2  " 1  > >rP"2a   x x@ x$ <> a|` <$ @`""`$  $ "& D T d $$ $ , d8   , T, U$ $ t8 5 > bl /"bl   \  "    H ``<` ` 2`<`H 2`<` ` "  5 1 a@a@"H8a @0a@ta@00a"@" 8  !@~a!@ 0a#@a%@0 D& H& L& P&8    T& X& \& `& d& h& l& p&   T' X' \' `'$ T$ X$ \$ `  $ T$ X$ \$ `  $    T$    8 2 $ T$ X$ \$ `@ a$ 4$ h E    2  D & H& L& P& H@" 0 @W0 $ d4$ h8$ l<$ 4$ p8 "! 2@B  $ T$$ X($ \,$ ` 28`"8@0 8  !   $ T$$ X($ \,$ ` 8&8 03᧐ @  ` "`&  "@ <`" @ @"`@> "! @ <"@ ?$ &    - 2 >rN" !@ "!@"ɰ -0!@2İ - @" 2  2  `  2  @  "  8  !@ 4t!@"  -0!@(t - @2 @ @  "  //s aj@  @0ct @@ 2[   !@ R    `2 t  2  09 1!@x D DԤ8  T Tԝ0@ʸ!  h&&  @ʯ @Ԍ  D DԈ8  TԀ T d| d a㿘@Đ㿀H /f * ' `D &`D'`H`L&`H''&`L `P&`P' a  &`D&`H&`L&`PH 00WH 0  &@`D&@ @ ?0 @ ??&`,`4``,&`h&`4 &`,`,`d`4 @ @ &`(n&`0D&`$8  `4`0`,2`(&`X2 &`8 @  &``U   @T8 8 '@ː㿘 X H> !| h @h `8  "HX @2<  <2h⦒    $ 㿘` 2` P `8   `X`H> !|`h 6  h. `8  " H X 2$ <  2  <`8 ` ` m ` $` 8     _    $  < 2 h`8 ` `  L ` $`?1 /`2`> 8 @ "1 > 1`8"(`` "$`c2H"X" 8 " 0" (2  2`@ 2`8 xH /` * ! > !|` ` 2`<` `t  $@      $ 2   $  Z&  6{  2 @H 0R  && & | 2<2 &  6H 08 t & t "`t"t&  ` @// ' a1؀  ` "`  " 6H 0  pH 0xH /` * !  ? &  `"  "`  "@ / '  a2 6H 0㿘&&   " & 6 >(0 *`0 *  * 2`~0> p( 2`~> p0(@ ` *   㿘 В    ^ 7@4 > 2 c> 2 > 3> 3, $  , , , $ 8H /f * ' $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  ` * " 4  6 `  ` * @$ H 0  & ?$ `2$ Ȑ!$ `$ Ȱ 㿐8>     '@"@|B > !|` 16  0    ` ` '`V`` ` `< 8 `6`'@   -`ְ 1 2"-`2  0#: İ #> `b 5 @  "  8 @  0b5 @ " ` 8R  2` 0`&0`266`  > 1> 1#cހ :b  # "X   > 1> 1#c֓- , 2 2`@9 , 4@w&@$, 2`" 4)>  ܰ 10[?* 2`@46 : 4   " @#0 ܐ866, @@$@, 2`$@ 49>   10$ * 2`@ 46 ( 4  g " @0 ܐ66@J 㿀 8  ``@|p `!"` >rJ"H " d  " _ / I> !|" 0  ? H2  0  8`" 0X&  0 2 0 8R` @ @ 2  0쀢 7 1'3 `'`'  @f 6 " 0" 0 2  6 2 `| 12` 1$ 0 $  @4 4 #\#`    @\ 㿘 8 `>!!` & `& `& & & @6 4 8 `@㿘 8 p"` " @ @ " ` `!@љ 0@ H /`4 * !    ` "`"  "@ "   ` "`"  "@ " @V Ā " @V @YH 0H /f  "@* ' ` "` "  @ "`"`   @ "`H 0 ɒ 㿘`  @ʼn&`  , , 64  0$ 㿘 8  @2`@}0   @o&`  , , 44  $ 㿘> &"䀢`\>rbp@D ` /``+'./ 2 2` `!2  2  8 "  42  62   0 ` @2 `㿘` `` `!2  2  8   뀤` @`& @@ 4 D'`0'` '`4Ԗ `4  ``  `00ڲ㿘 @ ک& @㿘 @ .2  6/ 2 @2 `v  `!"  $ 2 ( 2  , 2 0   $   $  $  $@ʍ  2{   2  2   2  "    2@  2 @  2@ @  `   `  ` = @V  2D  42@ 3` 2/`` 2+`` 2'`` !  `!2,    2$  42   0" 0  0 2 `````"  @6 ` 2U 6㿘 @ 7 @@  8 `#2,             . .  &  &  &  0&    . .  $& 㿘@ ` @28 8 9?"8&@2@@   @ 2@  .`.` &`` @ö @` `@ 8`"`D 2  I4  2 4 I 4 > !| 2  1c &@< 8 2 D" D> !|  2 <  D 1'  DH(  `!"14 46    @("   @(  46  (" 46   ()" 6   @("   @( 4 6  ("4 6  ("H 㿘@.6/  7 @  *  1 `!2( 2$ 42  62 0 2@ `"  "` "@ &@" #@&  2 `  > 1#` (+ >r"2G3 㿘` @. 6/  7   *  6 `!- @  2( 42$ 62  $@p  2 `"  "` " &" $&  2 ` > 1#`>rGe",`>r2`G`",>r"G[2` y y y y y( y y0 y8 y8 y0 y8 y0 y8 y8 y8 y8 } } } y yh || } } z } } y@ yT { } } } {h } } } } } } } } } } } } } } } } } } } } } } } , D \ t 㿘> 2#< ێ> 2"c@㿘` * > b "b?@ 2%`!  @*           > b` "` #  @Q  8  @ @*  8  `(8' W  0` - H /f * ' > #H=( & $H 0 $ (  & 6 & 0& (& ,& <& 8    i`  &  ܐ"   ?@& `( >rD#> " .` ``" *"` "*  `2 *2* "* B2*Ē   2    $?쀢 : >rD#( ? & & & @& ?*@  #?*  2* 2 "  "U $0 㿘 @|㿈'L'P'T'X'H ` $> b` e"`@8 @ :   2 > }b "@& & @>K > b` D"`  "@& & (7> "*  `" `(, >\"*` €n>\"t. €   _b Zb Ub    `#b  *`@`<  8 "<b  )2 > 2`C0@6b` "` `*``0@ 2 b` "` * > 2 #D#  >  h > 1*` *  *   0b` "`> 2#(`2R/  # bK/> 2#,`> 2#(` `  # b`Đ "`Ā`e @/' 1' > 2#$`` $Zb> 2> 2 T" cT"   `sFT n /h'  2    8 2X " X&    b6 `"* `@O# 0K   > 2#8`?b`#( `  `*` @`8 b` )"`> 2#d#  > 2cT"`> 2 #D"  ' ն쀢 > 2#<`> 2#@>a ٬b쀢 #DZ#D @0x   ` *`' 2   ?  " >  % a| > 2 H@T `8  T H@ T  8`" < X@2 <T  "  ` E 2& Hؐ@8 ܐ * /"q؀`2 `t> a`T y"`T   H`D "`t`8 ?"`8 H % ``- @ դ       $ "@8`  D 2  Ԓ  $ $ $    (  `@ހ   4     *@   $  "5 @* @%  "`&  "&  Ȗ  |6 @ 㿘   , "@& & 4`@<"@4`  "@& &    @  㿐@XT@ÿa* &. . @#㿘`K ?`E>\#X*` €> 2#,> 2#$> 2 #(> 2#0> 2#8 3> 2c<5> 2@  c<`  &@۞$c< ױ&@ *㿐u  "3  4 $> 2 0    " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t> 2#>aa ӽ 㿘> 2 #D < %PT  `   * $ > 2`@ @> 2# P c*@( !' @ @   "PT "Tx 㿈 2 4>rA#8  2# P   ' ''  'Ԋ 0>  `n> 1* *  *    0 "& T㿘> 2#0> 2> ")8c4`?㿘 2 4>r@#h      W 0㿘.`  .2 .   ,,`6 ɫ2 @ƒ6 , 4 ɣ@{6` ,`6 㿘B%?'> w)!$ @ #c4  > w> w212` > w-2`$  ` 2 !> w 4 ! > w2` 5> w7> 23> w1> -> 24   @W*  ` #$ @Mc4 $ ` >r# ,,`2   , @;4*  2` , 2  @` ,2`z  @  H` ? 6&`56㠁㿘> 2#a/  > > w`H!> w|!> w $  c 2 @/@ $ i -> w> w> w ``) @ʒ!?4 `> wc> w @ &5c> w`> 2㢔 . 6   d | $ < t T l  , D \ 㿐>r'1> w (cA>x"K7"""#g""7777> >rc77777"X7#\   6}     > 1>r?Z##@ *"@ *`" *  *  * " * "> `h: > > `*@@ 6*@> 2"  @/> 1#+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ > h@``2 `4S```:* `4@ #> b> 3 "` | |" > 2c䀢 > 2c> 2"c> "p@w @   +``2`*` (  #  +``2  > " +``2`*` +` +   >r> c @ݐ">r> cȔ @א"0> >r!hc@є 㿘!>rH /f * ' > ` ` """`?"H 0 ` ` >#@ 0ց㿈> !|`q'D> !`"!  !!  'D  `$ D<  @ `X P"`X2 <` G"`   'D` ;"`   "   D  8`D`p %"`p` 2 ?   t `" " t @8  `  "`"` `t "`t @D` "` ` "`$ D 2"@ "  "S D CeD D>  `@ *    > 3" @ID  D@' "   8`2k  < 8 . a|D     <  @2< t`@  ` ``@ 2``2: lᄀ42> 2#Ԁ`bD G H o *@ g  ( @?  D#\ @K H p@ ;D@ 0U ?@D`    'D`  C"`  H /f * ' > b(   H 0  >  %b(H 0 >     2  @2   @2  @"  2   "2 4 *` `" `` "``H /f4%b(* '%b(H 0 0  * 4 *  f %> 3`> 3 `  $`@*`d $`dH /f4%b(* '%b(H 0 0> "X4Ԓ  `d $`dH /f4%b(* '%b(H 0 0 `$ *D" @" 'DH /f4%b(* '%b(H 0 0|`@ $`@` * @H /f4%b(* '%b(H 0   "4  ΐ < ` l9 7 )5 3 1D  H o *@ g  ( @=  D#\ @Iޘ H p@  ᄔ(D`*"(04>  "4 `h @ > 1* *  *  D  0D> |=H"8  8 40 ", > 2쀠`"!<`2<8"<X`8 `0`(2 <`  `2`2H 㿘`  ` *`  " & -&     +> > `` &@" "`&` <.` ` .` `6` &`   &` &`3 `2` ``   `  `   + `2` 2> ` ` `  `@` ``  (`````  " ` >  `2`"2`4``  +`)> 3->  @ "@ "@/` @``"``@"X4 ?` % `  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  q `? @c *   > h`@c"h_ ` !> &@4"X> 3` ?`"`   4X ?$ 2 5``%` `%`@`"``"``@"@[  @ * @& @  *  "@&   @& > `"> "X4B> 3`  ?"` 㿘 "'> %> 3q ` "` "X4& ? $ `"  "` "@ 㿘H /` * ! H /f * ' > b(   H 0  >  $(H 0 >  > ! ? *`  `$` 2 H /f4$(* '$(H 0 H 0㿘H /f * ' > b(   H 0    $(H 0   "> `  > ! ` `P$` 2`H /f4$(* '$(H 0 㿘 2#>  `/"`> 3 *` > 3  : @?> h   * ?   `> 3 7> 3`  ? ` @ $`Dw ``Q`ά%`2ʬ%> 2#܀`"    $;ǐ /> 3`% ?  '@% `2 ;ݐ  <@'Ԕ H%   < , 8 @ @ ?  ? v  o;{  H`@'Ԕ H_   _,X耢$逢` 2   *` ? {'E% А?:   "   ($g $c   ^" ;  #H   M ;  /'̒ ̒  /% ``  > 2#Ԁ`@B 6 4 'Ԥ@ !>r#'8   ?  ?  $   *"@ 5  ֘ > a`P  "`P㿘> "H?` #> ` #> `8 ?"`8> ""D  , $ ,bDbD   D| > 㿘> 2# `@>s 9`+ !> w =x2 > 3"`$?㿈   //'7ؒ "D  4 $$2: 8 0 `> 3 8B4 "8`"+ 8` "#` 0  @2     `@I 2   8 ?$ 8   2``2`  8 ΐ?$ 8 㿘!> 3   }   H > 2#+ `& >s 0 9-  > w`<* #  "@ >s9 P?  *`*` `   @   %>s# "@9`@$@ > w# 8`$>s h8 㿘  @` * "   "`&  "& @* @@ $@(> 2# `   >s`  p`8 ` ! > `' 2 `> (`~-"(0Ā`  , o> > "H,` -> `@    8 ?$ 8> ""D  ,,`D$D     p 0` D4 ~  " @ @ `*` @ @2> 2 4 0.> 2  (> 2#؀`$`#> 2 > 2 D#4` 0 > 2 4 "` 0    >s  89> 2#D`  !#\  @y > !(` "(> a$  #"$, ",(A >b!* €  D    T` @'ؘa`L "`L }o0㿘` ?`>b"*` €> 2Ř#> 2#> 2# > !l` > 2#> 2#!> 2&##` !> 2# > 2!c$#䀢 !> 2# ; #Ē $#!> 2#> 2c􀢠#& 0> 1m#> 1g#> 1a#> 1[#> 3U > 2O#> 2I#> 2C#> 2=#> 27#> 21#> 2+#> 2%#> 2#> 2#> 2#> "> "0> 2# > !h  - ֔ ֬ l t | Ո Ք T , , , , , դ դ դ դ դ T T T T T ռ P P P P P P ̼  ` Ԥ t t t t t Ԥ 8 8 8 8 8 Ԥ Ԥ Ԥ Ԥ Ԥ P H H H @ H @ d  P 'L'H'P'T'X't 'x/o`  ``!t>s5 t `>s5  @є||'tt  <* @ &6> `* *` > 6&8  "83 #$@ *  ~ `/o@U @`4 "8@" @8 ߐ?"8$@@   ,,$"7W 2 7{ >    @@.< 8 2@ "@`> !| , @ ")<"% 2<@ 2@@@`2`T> ! TX A`D`@ @`t "`t@`4 2`0< 8 H& H /f * ' t  t``$"`>s 4B $` @5`( t?'xtܒ #\ x @Aٚ tH 0x ?R "'xtH 0F c `$@  t`@` @ t` @j  t`2`O 'dH 0t` " @ 8 t` ?"` < 8 #o 2|`2@@H @`4 "8@" @8 ?"8$@@   ,,$"6J 2 6n ~>    @@.< 8 2@ "@`> !| , @ ") <"%  2< @ 2@3@`2`T> ! TK A`D`@ @`t "`t@`4 2`0 2H& < 8 |`tR !"2``    .> ! T At  T 8@ `"  8 2  `2  > ! T 3`" T'x  > |`" |` 2`<`H& |` ` 2`<``t&     2 t  "` " t@> t` ?"` t@ t 8 #t02t'ْ "t 8   1'x2 'x @@t`!` >2`` `@ " ` P  ` 6 ` H /f * ' > c| 8t   A'xH 0_tt 2  H 05d@4 2 > 2 A'xH 0Bt#䀢`S@Pt LH>  H H:` 8 2?t t:Ē /$@ H 0`2@`"'`4 `'  /'/''' `"`T@`  (`8 Ӑ?"`8$@Ԑ ('xt  <2t@R  'xH 0xt   t 2 ` @?_`xte A`    0 " @9 t`  ?   0   @) t` ?"`  7:t  At'xt| @1*  "6  0 2 6  >  " a`x "`xt@+6 t > ;cpa,  "a, > b`0 "`0 t@'xF@ ( @'x@4  > P  a @T 8"T> a`L ;"`Lø Ix @G (0'x t`"`x   t@'xxRt 'tx @> a`D "`D@!x``8 ː?5"`8x ( > 2#䀢`t@Sx&㿐  * &۰ ( "'@g ?& '  > > #̲aH /f * ' > "X) H 0   6 H /f * '   7 H p@  $ & 6 && & & > &#D  & $$ $  $ $ `  #@6 @ = `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 x<  =&& & `  `0    & `x`&`x4 @*g4 `H &`H h$ y%``@44` `0 ` >  %` a`x  "`x> a`< 7 "`<@*64 4  㿘 ?` c @ ` 2$    $ " :a H /f * ' > "X(' H 0" 0H /f * ' > ߔ  2 H p@ $  0   :>    `       &  6     ?`& & D &   $&   @& &  &    & 4 㿘  * ?쀤'`  $)>s ,@` 8 /!  /!@$ 〦 " ,@  `㿐> ߀" `  Т # & 2ʰ`>m |*` €`@ "   2  `>m h*` €.`e.`l`` &`` ?&```` &`` ?&```` &`` ?&```@آ "֢  2Ѣ  "``"``Ţ " ``  ?&`` ?ߐ &`` ? &`` "  2  8 ` H /` * ! ```"`"``"H ` H /` * ! ```"`"``"H > 2`0= ,`08> 2# 63.`:6 2, *.`# 6&.`:) 2 .`> 3 6.`: 2 .`> 3  6 .`:  ".` `& @:`<*@ * &` - Q  wV 2F "`   *  `    @;k `'" $  뀤 @;_`" `   ހ @;R`" ` Հ  р @;E `" ˀ 2`Ţ  2   @>   &`  n     7 n&& 6 6  v"%" Y`2"AS`?* 2  ?VJ `9` "`@:`<" ?* 2  )VJ `#` "`@:`&" ?* 2  ` "`@:`" ?* 2  F n  ` "`@:`" ` H /` * ! ```"`"``"H `  H /` * ! ```"`"``"@H   * s`>l#*` € s" '` "$  $ ``  s ' `>$ >l#*` €6`e4`l``1 ``2 ``2 *`@i r ' $ ``  2   $ " `  "` `` D" rȐ ' $ `$ >l#ȓ*` €` 2 7` 2  7` 2  7` 7` 2 `Ā2V 2@  @ $   3V *㿘 `sD`&`  `U s8Q La`   F `&`  :`@ `$4`  "0`   `- )'``2$@` ?&` ,`  `$@` ֐ ` ,& r 㿀@   X 5 &@ ,$,4?`>m *` €"  2 > $!|`  `H2`<`2`  T8@"װ 1$"Ұ  2ΰ  ,"ǰ  2ð  8 ,"  2 <8 @@ 2   /' *}" " 1 @> !|`  `H 2`<`2` p T8@l @` @`@  ,` @2`@2`@ `f 0b ;ɐ,` "@ Y 7 U4"R  2N <8 @@ "D   > !|`  `H 2`<`2` "0 1 @ ,` @2` 2`@ ,` 1 `@ ,` `$?@  ?4 -  @@@@˒ 5&@㿘 p   &0  # -0+ ``"` @`> !|`""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     , @ ާ  , y 5㿘沐 rz  ` 4 `@$*`4 O 㿐  @ +   " ͠ * ` 7 `  <c7 `   0 , 2      Ĵ0 2@  ( 㿘> #<p 㿘>  > 3#<  `|#<"`D `!2< m`"0 @240`"  @2, ` @2$沔 q  L`|s q# 8kఀ  8<2`L`|U q0 Nఀ  0     h > p> ! 0 4" 4" 0㿈 'P'T'X 'H'L ` ` J`  ?`#@I ``" 8`  $"   ?ܐ"   ?"    ?`& &  p  "    "   &   .`6` m.`  6` 0.`&` /&` ?#$ p- (@@  "`  `@ 2 <@6`pn  > $6`> a`\ "`\  , @㿘`  C  ?o쀢" 5k3d1 0' `" ` 8`  ` `  ?$ ` o՞\ o  ' "  `  "@  - o 㿘``   ``2 `.`>w# € "`>s(!@ > 3 > 3 D x> c< q`n, m` "i 9  >s(!P*_ > "8`"U 1? 8O 1 "K$ 0+ "F 1C$ 0 = > "8`2 6 1? (/ /$ +'`   8 2 9    -^ i>s(^!`o`㿘> ;> * "@*`@*`"@ *`P@ d""@$@4 4 $  t!XT t@!XT``) 4 <"4 p 4@ <4 p $ $ $  $ $ $ $ $$ ( $ ,$$ 0@ (4 p d    \㿘 x` 8!> "X   > ;p`n"ܰ  +> ; ``"     `" $)cp``` " `$!`@` #`` ; Bn;`X!p0q"&`@&`cp`#``Ȓ ; B;`n `"  "` "@X!M "$  ` " $$ 6 " "2 pΒ $ 6` $ $" & $ $" $$V d $N  "J     h ->  L `&   ` `  $`  "@ x`"  ``!"  `@  @    " n)  X``   ͔ b   㿘H /f  > @ 0>* ' > "" .`2   '<` @"  R`d 2 6@ "b2<bb<`@" R`d  2 ; cp`| 'L "`|'P'T'X'H  2`'''7''`'̀`     `'0 ``0`(( mt0 W`  pÐ   "+ j    " ' /@Ր5  2 ?߀ @ cp!( `"  "!(@ <* `B5$& cpa( B"a( "'@`*`*  `2  /` 2 ``?#@ ߀` 2 `` 2 `` ?#@ р` `  ` `   @p ( cp`  "` @ 2 * Ԁ"cp`  "`;' @ : p7  cp`  "` "     '` '$ 2 `@B @2  2   ''''  > "`u` > '"'ؤ2$<cpa   "a > "``  > "   2<cpa "a> 3Vd  "d '@*@''8  &  7 2!> ; #4 < > ;c"c"" " """" " $"$ w`> ; ` @in` "   q 2  h ʀ g < 2 * * @$ ` '$ ` "` "$ ` "`Ā "`$ ` "`` a` !$` k,kd$d 46 `$$`$(` $,`$$0$0$̐< 6d`P@ uq H o *@ g  ( @&@  #\И @2?Ѐ`" H 0JN A@1-  2@5:   $H 0/` 2 !| ""`!|` "` 2 !x "$!x` "`Ā ! $!`  "``"`""@$H 0> "lVd &$>  > <2`@, :` ː4 @ L"Vd  Ē #\@  &Ԓ@& ` 2 Vdp@ &pcpa< "a l&H&DԀ"@ $P"@ 4P@*PVj 2Pcp!̒` "!> "lĐ"@ @ D`(" ," > "l@ 4"@ cp" `` <`B ;`#`x` |``!" `@  @V |z"@ &&jl@20 ?਀ 2>  2`@Vh8:` ਐ | @2nP 2jPLP"@XT" 4 4^P  cp܀ " @ cp  Ė & ;`B 8 x`" ``!" `@  @  j LlZ@L͐Fఀ  p > 3 Ȁ` D&pA> <#&p |;pP@'L"XT"@@ 4 `& Ē"@@ & Vd 1&  ǀ À q . j@2   2 ``@    @U  # P   ` F 0< 8 ?' Պ؀ 8 hi  1 J m ` @&` , ,`<$ ` $ `$ `$ 4 d* $ $'(','0'$ ( , 0  `$$`$(` $,`$$0@T 2$$$($,h$0耦`! ` @&` , ,  $  @4 0 $0ؒ $0hŀh@ߐ &t@В 7'  #\@ؚ  p"` &`&@7&> 3 `&&&&&&  > p  &pcpa0 "a0>  > 32`p@̖` :`&&p6d&Ē T4cp` "` cpa "a"  "  ̔  "@  "@  > 3 ̀`p@84@H =0 , && Bp &`&&&p"> 3 &> 3 ̀` Ѐ P  p  &pcpa0?? "a0 * " #cp`}1"p  ` `6dCB.@.A  -(> "l@"@ l & 6d &@"@jg cp`ؒ < `ДB;`ؘ '#`и? ?&&̀ " 2!D`Ȁ <> blH" 4&DԚcp :`` aB #a#`;;`" <  &`?6?ߠ?Ԁcpp&pԸ?`` < B #` ;``` < B ;`#`'@&Ԑ"'"6?6 Vd  " @zcp`" @ " ?cp Ԑ  ,# В : ؖ B ; Vd 2Đ"  }@@N'  Ā@ pcp &p`" ؒ < B; ؐi Ը?"'̀ D@  L"  > bl&H&D ( L@ހd?* : `>z!*` €> 3 ̀`p@ɀ = 6486dcp `" @Β 6v p [ Vd cp  > 3`{"p  ` `6dCB.@.A  ږ&> 3 ̀`* @( p@!cp@ cp 8 l@ 2 p@ &p&&&cpaL "aLcpa4 "a4  @p*@&pcpa8 "a8" 4Ԁ  26jocp  $ `j> 3j * :`@ V6j  l2 @@ 6j( A & &3p &p&( `!P`B < `$!P@Vj(l@&&(p l&&&p `!P`B < `$!P@Vj l@$ &&'l@ @x&ր@ 6j > 3Vj '@l  'l &Vj @ 2Vj&@R :6j@K&6jVj@&6j" cp` ?"`cp"   ̑<`B`;  # > "lĐ"@ @a`(" ," > "l@Q"@ @20 ' 2>  2`@Vh:`>l t@ĒVj  @?# * 8 &"|x`" |``!" |`@  @N |@  |" &|~k  ~f"& ਐ {"@ && ,&Vd "$    0E/ 5 0@ >   zr>  > <2`@$ :`ɐL )6d' 6d@>  2 :*"@ L*`zS  @ ô>  2 :*"@ L*`c  3 @ @ , Ԁ %  Ԁ @2 &@cpa "a&&8&&8 ' ":"6Vd 42L> (` (6-?Ȕ@ " $&L"  ? $H @4x< ?.<ր@!@ Ȑ"@ 4&Ԁ 2Vd vVd rĀ@Z VSp  > 3 Ȁ`  &p> <#&p|ԄcpĔ & ;`  B 8 ` x`" ``!" `@  @  d6 LfLzzwఀട fy p`&p  @s d ? "AVd <  z pĐ `&p&Vd "    ( > "6d6d 6d@>  2 :*"@ Lz*`y  2 :*"@ Lm*` ""T `?  > ;*ԓ:`4 X  > ;* ԓ:` L `p @0 Ucp`@&p0v> 3 > 3> ;#,ђ` C @  # ;   ` 1 0< 8 *' u؀ #    @   Ԑ 'Ԕ   @  0n0,"x 8`T  > ;* ԓ:`4 Ԙ 0 > ;*ԓ:` ɘ c# n㿐\V7`P>z!*` € 2I@ D`b @@ 2=@ 8  p @& p`@8/.!C 2-@ '`G `C  >  p!& pl@&!H&!D 2@ 2@ " @ p"& p@@&$ @`` $  ` $  @`@" X ܘ  #?䀢 ''`` Đ" 4""`"" ܘ  ܐ"  & @ɐ  Ā   & &  6 Ė "" ܖ  Ԁ n   Ѐ'$'  `䀢 `" 4 ܀" " "`䀢 $ < "`"`  ܘ `''?+ ܀  䀢 ''`"?"`"?  $& ܖĔ  "" ܖ耢 4 ܐ &  ܘ?  + ??""쀣 & & 㿐 2  "   &  l >sǐ!p) % "  " `"@  ـ!" Ԁ `" > <  & `$ $ $ $ & &   l@ǐ"> 3` 8 $ $ " )> 3'> <  ,   $  l2" "   $+%Ф&  S? @ $ $ @  $   $  $  l" @x :$ 32 " -J )  $`$@ $` $` @*$`  $   $  $  l@J"  :$ $   & "  @&> <   $@$` l@#"> 3` 8 $` $`@$`$` $  & &  㿘 (V d $ `&@   #> <`"& `" 4 @`z` ?& <& ` &@&` &  " ܆   㿘` @< s &!(` !"@" l  l&! 㿘` >s 8  &@>sq! < < `*<*= " Ȕ ?& > ;p 0* `(:` * 20 20(& 2(8"@(  22 22((2022*84"(2f0*`R2(8882h2h  2h2>㿐> 3 xs R`T`@ J` ( `T 5" @` 8  @+"> 2#䀢` @!"  k'  @"!<`   @ "   ""@?쀦 ` @"?` * `44"" 8 @@*p !!4 ?2$l 6 4l@$4l 㿘 x l 8 ~V!0 2>dl ":dP @a @* 2``6!4 ` 6!4=`$@y6!0p "*`z@`H6!22 :  : 6!2!0V!2* :  : !4 6 h6 h 6 hd ":?)`@o> (` 8 u|` "P?@[> (` 8 uL``"hP@ܐh ,` * &!㿘``@  ``a$a(`$````l" @ @S$a`& `$a$`` ``l"@ a"@ " $a` ` > 3  &    < `  2   `  ؔ``  ` " ``<" X  !  x 8`? '  '> "l!$V h"@@ *  l&!   !@<    ! "@ > 3V d ! @`2N n> 3 V j@ &N n "N n   "  l "@    !" &!N n  `|*    6 f  `|  " 6 l    6 f 0 & @ l   `| `P`L "@`X`T" 4   q  p :i!TN n 2e!T!82` `2^!T !@ X 2W!T?!A#* 4!( Đ" " 6F!T*  6B!T p2>!T2;!T  " 45!T"0!T ",!T!"    0 >   2`@V h:`S "   2  0 2 @6 f !T       ( . < . (6 p `1&   //ѐi 7Ɛƒ۔   2  p @A p"@A 'Ԫ  p   @"  p!B@c "Ъ` p ` 2 2  a" > l!D@B` " " "`  ?#> V d <`( p ""7`( ܀2 $"Б2 @   ` 6*䀢 ''̀`"  #̘ #  ܚ`@&*@Aa  `((! >s!"  > cD( >s!" pN n  2  > ;p`l "`l !@ > ;p`X`P = B ;`X #`Pp`H`D = B ;`H#`DH /f * ' bX ƒ H 0`" 4`H /f * ' > ߔ  2 H p@ `$ $`4`$@$`$`$` `> H /f * ' > #H  $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `\^ `> cD`("@"@ $`$` `]  $@[ 7g'`^>` $` `| "$` > ;#p`h "`h> ;p`x "`x  " > ;#p`p "`p> ;p`t "`tH /f * ' bX  H 0`" 4`H /f * ' > ߔ  2 H p@ `$ $`4`$@$`$`$` `-H /f * ' > #H ޒ $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `[ `>  7'D`$`  $`$` t`2` >s!Ȑ&"`>s!` t `@   p   !@ & 2  2  0 "!  $`2  $ &  Ā`$В” `2`<**` $ > 3`̀ )@ p@> ;#paD@ "aD p   ` `"@ 2 , *> ;& ppaH "aH, `P2 ? l& ?!A#* 4! Ē"@ & 2 = 4  "@` @ 8 4 ,  & !T "`   "N nN n`  $` * 2 ?c 8"  4?ؖ $` @^ (4N n  0 2k  & "    p `& & p   "! 2 !@"@ & !(  &!> "l> ;#p&!(&!, "    2:` !@>   2`@V ho:`. 0 " ` 6 f  2 `  @>   2`@V hU:` 0 " `F 6 f!@"@ 4&!`  V d` > 3`̤ $` p @ "!T !@,!TN n  " !T> ;pa@  "a@!T "`  S "O ``2 x `l* x `e* * x> 2#`@```   /'` ?ؑ* `2 2 , , ,  x@`$ ,   *  * *`@   2 2 2 , ,, ,  x` @  @M ' '> ;`7 x@ E ( x@ = A 22  pV d 16!> p > <#] |)#p@ "@ p`  " $  p !@"@ 4&! p Ē &!L& p & pt |`" ' 㿘!0V!2* :   : >s|"!4&V f> 3 ԕ* X  x 4 x>    2`@ H:`V f  f`6 f㿐> <>s#\"8b !X   d > <>s  b( #\  Z > 3 > O"> T2 > 〢;"bl <"T> cD < (>>s("8@f2 @㿘t Px X  2T "   >  #D> #D  (& > #D `( `-& H /f * ' > #H  & $H 0 $ (  & 6 & 0& (& ,& <& 8  2TXf T  "' N6  @F  4 , 0?$ * 2  2  2* 2` * $ 2 2 # `" *4`<$$ ( $ , $ 0$  $ $ $  $ $d*  3 3 3 ,, , , , , @^, ,   (4`6` 4@* <*@4 $` 4`4`$`$`,` 4`㿈   x`8 T P L X" " 4 !T  `@@<    2 Wy  > #D   &2  < (. X2 &&2"  <& ``'` '`$'`'&`` &``&``&` &`$&` &`&` `( (& `` &` &`` 44 2 &  <`( 4`  (`& && * <*@ $ $ $  , !A=?#44 84 Q ` ,@,`,`,`,`   x@] ؓ*`2`2`,`,`,`4  ` `*@  @[t (4  ` `*` * 2 2 ,`,` x    @ 0@% 4` 4 @ 4 > 24` #> 2,` `  $ x b 㿘> <"8 P @!X&> 3 >6 l |`(6! >s"p  ,` `` > 3 Ę > 3  `?&  > 3  *`: *`& p6!2& x6!06!46 h6 h 6 h&!&!`!  &!T`!> ; c,k> 2 #,l$<㿘 xV d  `86 d> ;cp`  "` > ;cp` "``<V!> 2@4 8㿘 x !T8 @ " ` 2 ` 2 ` 2 ` "    "   @  * !@@ ` ^\ P @ V!0*"@ *`" *  l * ` 2 $ l$ l P  V!2*"@ *`" *  p * ` 2 $ p$ p P 2  d!`" d h 2 l d2 @ l* 2 2 @@ϒ`( !T  `<`(p h  2 $ h$ h@,@T p  ?& pV | `"  t#> <` 4`В 2` t "> <V> < '"8k$<ɐ> ;cp` "` 㿘@  %> `"  "` "@VI  X@  ?  *!B !B *!B* * !B㿘 R`f $2a>Ra> "2a>4 8 6lZ L   lP |x`>`k!@ g e ?> Ԁ >Z ,  > ;  `N> "  6 `@ <@G WŔ  > "`Ȍ   V   @ig0#`"@B%#\0 > #`"#\ @B 㿈`>`P! M> 3 (.   >/ Ԑ? >Z( ,  > 2#䀢`>  `*`  "   >> !t  >! 0 >  `*`'  "#\[0"Ŕ  <l pؐ@  > at   > >//'#`'''"#\  @A 㿘 <p `" `4 2 `Tşa  `T ޒ? N$ 㿘 <N    4 ƒ?> <Ḗ     `(((2 *`0㿘> <!Z > <  > `H  ?`  @ > <> <" 3 2́㿘> < a/  > > <`HȀ  ̑*``6 2 > <`? * .  㿘> <c, 2> < @"c,> <c 2> < "c > <c( !> < @"c(# > `@t $#㿘H /` * !  p`& pH p@H(> > <l> < * "c$"lH 㿘  ? 㿘 " & #> < ݐ`Ѐ & 㿈H /` * !  f`*`:  6 f > ;6 fcp`$ "`$V!>  <Ò 0> ; cp`( "`(!0V!2* : !4 :  * V f> 3 ԕ*  !4* :`@ 6 h6 h`$>  6 h>   2`@V h:`e> 2#䀢`"=V f x"9V fV d 5V f 3 8 |`"-V f  " !T 4 "!T P 2 V f!T` @  // ' " V f P  $ P# ϐV f $   x!0!2* : @6!26!0 &!(& ! & ! 8  l2 @ ( C&! p!@ &!& & p#p6 jT`"TH 0㿘H /` * ! > ;cp`, $`,!0V!2* : !4 :  * V f > <> "l!$(" > 3!  `0`$`0 <0 . nn. nH 0㿘H /` * ! > ;cp`4 #`4V dC  x 8`+*> > <#$  > l> <,!$ "@ @.p`8`#`8 t   ? e 4>  > <2`@ :`i0 >  > <2`@,:`] 4H 00p<`"<} <#$> "l!$"@ @ >  > <2`@ a:`  L0kH 0]aP^P^^a`aPataaacxab$bccHaHh8h8h8hLhLhTklkkkkll<lTllkklll㿘@㿐 `    @@E 4  R#  0H /`4* !  ` H 0` ` Q   # € a 8@+ ]  " T 2 x4O < `!@;ВGyC 6   `!@; i  2  /4 d ` C ` ` 2  2  "  "  2 6 2 6?#@2 6 `< @8 `'   6  @;w  @<*) `< 8 'p 2ְ `'h ΰ  6   ŀ   ! $ t 7 P4f->  > ;p> 3 "p2` @  4 d :`ɐ 4}$ $ $ $!$ %$  -@ `!|0~  g@ |0  v [r |g˒SiÒ 5d&@H 0m H 2 @"R !2N  !<  H  D #&  !=>*@ !< :,!<|"@" 4 |P* 7g|  , n $ , n `!@>   `!@>#  >s "     & H 0㿘 H /`4`* !`  H 0 6 P P <`  @` ` / @> ИH 00vPl@ *'< *"9  (5 ` p -$ p ?*$ p"(  (# `$  l@4 4 l"  8T d  4   p$" `"$ $ #O 0 NՒ ' " " p *"   * "@ l"@ "@H 0㿘` > 3`P  > > 3> 3! f !> b ` 2 2`d` ? 4`` 7 4` `!  "aT 㿘 xV d` 8w   T  K  dh8 L@  㿘V d`> <*` €O6 d  6 d V d  xd`8V d  >  > <2`@$:`# Lh 02 2 @"  Ɣ" 2  2}  @UO В @UF  j e H /`4* !    > "Ŗ> '`"'`gȠ  > ;cpa  "a  > "  > `"` l   8  ?' 8`'?''H 0"&@I"㿘`h ?` b> T*` €> 3S > 3M > 3G > 3A > <;#,> <5# ⊖ 3> "pK @*> 3!> 3! > 3  > 3 > 3 6 *,@,hX4h<$4,,,,,,㿘> 3!> ' 㿘@@! > "'L`'P'T'X""'H 2  '  0Ȑ  /  / `σ   `@Q: ` "`"    `2 ` "` " ⌀ 8$` "`P ''' ''+  2  2 ?#@n      ?#@` @QA* `67 ` S"`/` * 2 ?! ``("`(Ms"`0F@   6 @b* `7 `Ma"04& `( "`(`  "` 0/@ʒ  //7  @'// 7'@  //7 @S @// 7 @S  < 8  > 䀦А'  ʀ>   @  ``!2`6``!2``6 @2`"`0`$ `$`(  `$`, `$`0 `$@F  `@2f`"` ` ``  `` `` `@'  ` ` @2G``4@2B``8沔 M[  0 '``@@rQN`Lcڔ L L`   "` bɐ`  '`8` " `` @j`` /"` '``@@rN`Lc b`   !>      ' ' `?`$  "`$        ' "  c` "  @Y' 0& & & &  &e7 0 U H o *@ g  ( @s  #\ @r`" `H 00R`8 `M @@\ ` 2`@i   $`H 00p`` 2 `!| "`"`!|` "`` 2 `!x "`$`!x` "``Ā ! $`!`  "````"`"``"@$`H 0 '``@@q `` 7  @) 'M`8 Lb `8a L`8   0 `  "` K3 K-㿘 J    } `& $ $$  㿘 82 8 8a\ L 8    8aQ |8>!h`Ѩ ` @ ɀ ǐ? >Z ,    > ; ` @` '`'`  '` '` '`''@P  "`  @1   // ''' ' @H'  `@'`'`'` '`'` ''@P ]`P@ W@  L{@   //``'` '`'`'@HO' @P 1 %> '      @^#\#`@60 > >#\#` ☚ @6 㿈>`2!h` .@ * (> 3 (. ?򀢠 >Z , `0 >  `*` '  #\0  N x ` 'X'T'H'L'P  >sސ"? #@  (    0 8H /` * !  " H 00 2  9``' 8# `  $"    ܐ"   "    & &  Iٔ  S 7     & J 7  @~  .` 6`  0> 3&`  &` 66` 4 6`6` /  & ` 2`*`2`@ + 2@ 3 2 @ @*`22`?#@ @8"@6`6`6` l> .` e.`,`", 8 @  0  #\u$ 0$ `H 0I$I㿘@㿘 `   `! @< 3- ``2 `.`>  €  H /` * ! > `H 0` > 3> 3! _5    `!> ; c. k> 2 #. lH /`4 `* ! `! @2PH 0ŀ  `!")    8        H /` * ! @3H 0`  8H /` * ! *H 0` ]R{  `!"         d 9H /` * ! x `! >!!` $ $`$ 0`$ ($ ,$ 0H 0  ?>6 ^;  `!@;4]C@2$  `!@5h   `!@5x    - ->sא" GِGԐ㿘H o*@ a+ H 0㿘`!  >    *0  *0> 3 !"܆ @ > 3! > 3!ۏ㾐 @S W/&  L $ L ` @N$ ` `0 `* @@ ``@2} @2`@2` `! `* @݀@ > 4"h > e  >@2a > 1#t` >  "'D@ > S"Dx v > #> ] *aD /    '<    ""@& & &  ,   ''' ,H /f * ' `` @``G $`0 & ` 2" $@`$` $`H 0 㿐> 1#p'L'P'T'X`'HF0 T / ~ /㾈> 1'H #x'L'P'T`A'X@ 7 ;& L &L `@&``  ``*`*`@ * ` 222.` .` .`.` ``*`*`@ * ` 22`2.`.`.`.`.` `A*  "@F0S. **@  *`@ "* " ߐ@ "& `"@6` "& @6` `@i*`6` ,> ` " ''', 'ɒH /f * ' `` @``FN&`0 & ` 2" &@`&` &`H 0> 1 > 1l h `!h 2!d  !  8 ! 㿘`    *0 > 1#p> 1#t㿘`    *> 1#x㿘 l@ ` lw  l @ `;#@ i  (! l?#8@8N dL ~B@&@ (BH /` * ! @;H 0 2)@o$ ! !$ $,! $ $@i,!> 2#`>  $` ;`  $ $V<  (  '@ 㿘> 3!`y > 3!Р` )> 3+> 3} $!!Ԁ !} %!!%@  @,  ?$ 2 @! @  @&@! @ a a̐8  @ @zga̘  8  @  @  @ ,`@  2@!@Z 2!2㿘\`` d "9 @ g "4  ,@ ] "* ` "@ S "   `@ I "   h@ 0   l 0@p    㿀> 3!ĺ``d > 3!Р`` )> 31> 3} $!!Ԁ !} %!!] @   @,  ?$ 2 @!H @  @& @!9 @ ! !̐8  @ aĐ@y!̘  8  @  @  @ ađ,`@ '!2   $ 2  @!@ 2 !|!!!!t#d#l#\#`#h#p-   2!㿀> 3!ȸ\`` > 3!Р`` )> 31> 3|} $!!Ԁ !|t %!!Ð @   @,  ?$ 2 @! @  @& @! @ ! !̐8  @ !Ȑ@y!̘  8  @  @  @ !ȑ,`@ '!2   $ 2  @!$@~ 2 !|!!!#d#l#\#`#h#p    2!X!> 3! >sݐ#06@xޒ @> 3!̢ @!,`   `` 2`*` ` @ " >s#  )>s'>s%>s  #8`HP`` 㿘> 3!` * > 3!̨ $ a,`@ ``!̀@@       !!̢@a㿘 $  @ܒ @Ő㿘 $$   ̀@@̒ @㿘 $  @ $ & $㿘 $$   ̀@@  $ ;& $㿐!> 3!̒ K* '$!̔ * !̒ K  * !̔   K* !̲`*`@x!̐`@x*`!̐`@x*` a> 3!*@o'1> 3/> 3> 3!Ъ`  {> 3 "a!Ԁ  z &!> 3!Ф H@ @  @-   ?$ 2 @!4 @  @& @!% @  ̐8  @ ,`@wa̘  8  @  @  @ ,` $& > 3> 3ao> 31> 3/> 3> 3!Ъ`  z> 3 "a!Ԁ  z &!> 3!Ф ֐ @  @-   ?$ 2 @! @  @& @! @ 3 ̐8  @ ,`@wa̘  8  @  @  @ ,` $& > 3> 3ao1> 3/> 3> 3!Ъ$`  z!> 3 "a!Ԁ  z &!> 3!Ф d @  @-   ?$ 2 @!P @  @& @!A @  ̐8  @ ,`@va̘  8  @  @  @ ,`@ $&@ > 3􀢀 > 3> 3a K> 3a> 3"aے K> 3a> 3"aՒ K> 3"!ȁ㿐H /`4'* !'> 3!1> 3`(;> 3!̒ K  * !&`*` K !'aĒ`*`  K> 3!"Ȓ`@vk*`!̒`a@vf*`!> 3`@v`*`> 3!Шa`a` +> 39> {a$y_ %aԀ  yV %a@    ,  ?$ 2 a @  & a @ ! !̐8  @ @u!̘  8  @  @  @ + @ p k !̑* * ` d ` ax %aԀ  x %a2@    ,  ?$ 2 a @  & a @ ! !̐8  @ @ut!̘  8  @  @  @ +   &@" Ѐ ax %aԀ  x %aΐ    ,  ?$ 2 a @  & a @ !* !̐8  @ aĐ@u!̘  8  @  @  @ aē,`  &`" Ѐ ax% %aԀ  x %ak  ,  ?$ 2 aV @  &aG @ !ǐ !̐8  @ > 3@t!̘  8  @  @  @ > 3!ȗ,`@ &`#@ > H> 3H ; ' :0H 􁊀㿐> 3!`> 3!Ь `!! X p +> 33> 3!$ ( @''w %aԀ  w %a@    ,  ?$ 2 a̐ @  & a @ a= a̐8  @ @t#a̘  8  @  @  @ H4(*   ` @2@"@Ц ! &w %aԀ  w %ad    ,  ?$ 2 aO @  & a@ @ a a̐8  @ > 3@sa̘  8  @  @  @ > 3!ĕ,`@ 2  "@ ` `2` "`Ц !v %aԀ  v %a  ,  ?$ 2 aސ @  &aϐ @ aO a̐8  @ > 3@s5a̘  8  @  @  @ > 3!ȕ,`@ 2  "@ `"  `2` "`  &  @ & `"`&!"@"!2 "`"`&""@""2"  Ā`"`&" "@":"2 $ {]Q& $OMK! "!@&!! "!|@&!!| "!@&!|! "!t@&!!t "!x@&!t!x " @{&!t `" ` ""`  ``""` K> {`?"`H p@㿘  K"@r"&""&"&!!&!&""&" > `H> 3`H!8;`?> >a&!l (ަ>b @ޡ>bP Xޜ>b pޗ㿘> 3> 3!aL@ .`2 @` `@*@ 0>scĔ H|0 !>t ''' ''''@ n> `H `H@ 8>tb a`@$#>t(@,``0'4'8'<''''@I A`@#>tD@H`p'L;>t'P'T'X'''@y-!>t@' ጀ `H`H: ᐀ 2tᔀ (t`H>t`H`ᐕ:  `  @t " x>t@`x " >t@`аᄀ " >t@`ሀ >t@a>t$a ڐ@$xQ >t@Ғa8->t7>t 9>t  ->t7>t9>t)>t $@@!@ `` 2?>t@aHP@``@>tah "  >t@ax "   >t@a "  >t@a!>t@' !''''' @' ae !>t@' "''''' @'  aF਒@A@䀒@"`H>t`Hbh:  @1b 쀒@"`H>t`Hb:  @!b "@$``H>tb`H@C: @ @ c $  `H>tb`H@C: @ @c $ @>tc$!@>tc8$ @>tߒc`$"@>t֒c$ $̀@>t`H>tȒc`H@C: @ @c ؐ@c$$"$̀@>u`H>uȒ``H@C: @ @c А@`8$'@>u`p@`㿘`"U !> w h@pP &@> 3a8> 3a̐ > 3#a8>u!(x`?> 3!> 38  ݒ hH p@-!̘ (  > 3H / * ! +  8l 2"l2lH 0  ߰     @?    > 2  > 2  > 3@   `  -`` "!`` "`"``"` "`  `` ""`` "`"``"` "㿐#> 3aؔ`'"@ (  !> { h* >u`$aaر*` . 㿐 ``  1>u '@7R   " "  `?2  2   2      㿘 `4  >uV   J ? & p 㿘H o *@ a   D    $ # $> HH:; H 0㿘H o *@ a   !    $*@# $> HH:; H 0㿘@@2  V ` @tՐ   äääÜä> 3!(\`  &    ?&@n 4@n @n   ,` 0`, `6 /& 4`,`  ;&   ;!   ;  ////`'` ' `  24` @ b ;  : 0?>4` 4`,`  :   :   : , ///`'` '`'`'`'`'` '`$' `(  24`* @ % :ǖ . :– 004`,|20#\&#`  A"8  8 ?"8 A  ?"8 2  A`> 0*` € A }  "   a ?0 >  b > "  b @sҔ  2 a  a  " h  d 2  l 2   p 2  t "   $   Ā` "`"   "@$ ` "  ?2 2&@s | 2 }&%> 3 C0  02-  (( @2# Ā | @sp 2   0t|   #\#` #d#h #l #p : Ā`"  "` "b   "$   < 0 30 ,>  H H:`<  |  0   #d#\#` $ $ "  $ " " "b &#\#` "   & |  `@7  ?̒ |ʒ"M  ̀ |a$@ra$ 2@ a@2;  "  a`"3  ".  "  a|`"&  ! " $  Ā` "`"   "@$ $ b  $ b "@'b &#\#`"> 3 @2  Đ$ |@r $ "?  Ā`"  "` "b   "  < $ > 3!0 @ (!0  !>  H H:`<  |  0  #`#\  $ $ "  $ " " "b "$   . ;&  5& 0?ꀤ |  `@r "&?ꀢ 2 |  `@^ #\#`&@ & 㿘  ? & S  2     0   "  Ā` "`"   "@@  ̀`"  "`> 3"!@  "@ "  "  "  "> => =! > 3a(?"a(㿐> 3a  !> = "a>ua0!#\ ؔ  G !E % @k      2& . . . &  & > 3a< a<& < "`А "`"<<& А@㿘 0 (@(`(`0(`1(`}(`a% 0f 0`0`2 0? ` < `  6 0` 4 0` 8  `<(`0`B(`@(`4(`|(` `80`D(`` 0 `d E `0`0`2 $1> ` (" `  ,< ` 0  `  `  `  `  `$ 60`* 40`, 8 " (`( (` `8 `< `@ `D `H `L `P `T0`\(`X(`4(`|0`Z(`` $ `h ( `l , `p 0 `t  `  `  ` `㿘f  `"  "`> 3"!H  "@  > = ` "`"  "@> = 0.㿘 " @@pΒ  2@ p  w  > 3p a䀢  #> = "a>ua@`0#\   J `0H Y @j t  >c 0 , , !, P, Q   "]4 "`04 "4 R , $ 4, T 8 "   | ' ' ' ' ' ' ' " ?$ ($ ( 8$ X < "   | ' ' ' ' ' '' "  ?$ ,$ , <$ \ , 0 @, `  ">  4 2 B4 b 4 4 D4 d4 R , $ 4, T 8 2  < 2   @ 2  D "&  2 | 2  |  2 |  " | ' ' ' ' ' '' " >$ ( $ ,$ 0 $ 4$ X$ \$ `$ d$ ( $ , $ 0 $ 4 8$ X <$ \ @$ ` D$ d H 2  L 2   P 2  T "&  2 |  2  | 2 | $ " | ' ' ' ' ' 'E' " >$ 8$ < $ @$ $ D$ h$ l$ p$ t$ 8 $ < $ @ $$ D H$ h L$ l P$ p T$ t (, H X, x X ">  *4 J Z4 z ,4 L \4 |滒" >  > 2uВՓ$ > 3aD` $ `""`$   $  "& $  @ 㾨\``G `?C  ?& `? 8` `? 8 ` `? ,` 2 `g  $` 7` /`2`? `a ࢀ@?a$|@na$ ?`a  0 aa|#da#p#h#l#\#`  ݐ?`l `$> 3`a ࢀ@> 3a$|@nАa$ > 3`a  0 aa|#da#p#h#l#\#` m ƀ> 3`!0 !0@8`2>  > HH:; `0|#`*#\ ?` | `Ж?& `  ਀ o` #> 3!0 @ 1!02>   *>  H H:`; ` `0|#d#\#`  P#d#`#\ 2   ;z L਀`H`@D $0@ `  7 $?`  q  $` 7` | `U & ? ?  $<  2ਐ w&  $  !, ( !q!<0 ਁ> 3D"  22 㿘> 3!耢`` , 2 > =a` ! "` 2`0!@@! 㿐> 3!'H'L'P'T`'X  ,  H> = `2B" 0H@ 㾐> =a "a   4/ 2   !B(  ( 4Ȑ D2    >u0  / *`*  2 /!P4Z  !`1"0# 3 2   !(   (`1"(0   4 !` "`2    >u0B  @" 2> 0  *`*  2 / @" 2 10 * *`@ *  * 22 2 ` ,,,** , *`@  * 222,,,,ꁐ!P  "> 3 8 23 > 3!耢`-> "8`"* ` ""`  ` 2 ` @"  ` 2  `@lƔ  "w!  䀤``2`  !" :` B3  ;` >u0 > " > S#x .!P, > "@  ', '''懒H /f * ' `` @``1 $`!  " H p@0-& ` 2" $@`> D  ,@ $`$`"Dj > #> ] *aD qْ 0 !$`0"$0 q H 0㿈  2͖a 2 `/`"a0ma%  > =a( a 2  > =,`0",& ``' 8# `  $"    ܐ"   "    & &  0ϔ  <     & < @* @ *@@ $@ > 24` 4` ,`a($` a $`4`  2S  ,` 2M`` 4`  2A )2 /,` 4` /@ k,` 2a%a 2 a%a 2a%a > =a% > =a, 2 a0 2 a4 2 a8 2  > =,`0 ",& 7??  ? ? 2* * ? ? ? ? 2 ** ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  (0         (& 2  > =a` 7 "`& `,@,`,`,` > 2* 2 2 ,`,` ,`a$`a$`a$` a$`$a,$`a0$` a4$`a8$`   )1,`% ( 1v )2 /,` @/ @ `*  `*`@* ` *  2 2 2 ,`,@,` ,`/U> =&a`( / 3"`(> =!``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` ! ?ؒB;   "   㿘>u镐!x / 㿘`    *> 3!8> ="(> 3!'L`'P'T'X" 'H  , 2   `." 0 "(`.$"(0 0ʖ `  "( ` 2 " `."0߀ 1^ ؒ"(` "`ؤ@d# @d   2``` 0$    ///0/  0   ///0}/  0x.t"( $"(0ǒ "(  @ :C  8 0`  ? @6   > 0!@i   !"6 0 > L  -7> : a\! a`  `8 A  @i  `@i    0`  ٲa "(`."06.> :`*   *  c`& h "hH /f * ' *  * @[0H 0 "(`-"㿐a%   > =a   > =a% `@ > =`` ((  (`-"   CH /f * ' > "Xޮ H 0`" 4`H /f * ' > ߔ 2H p@ `$ $`4`$@$`$`$` `2  > =(`"-g 70v#V @4` ,$` $` 0$` `$$`  &  ?6 `> =@$`$`$@$` b(`#```(# ; B;`(a    ?/`<* @ *@@ $`> 24  # a, , , 4 4 4 a($ a !$ ` `*@*`*`*``> 2* 2 2 *`*` *`a"`a"`a"` a"`$a,"`a0"` a4"`a8"` /4/ && 㿘`    *> 3٘!h 2 3> =bX`, "`,> => =b`( "`(b` "`  2@ 3> =bX "bX> =b "b 3> 3!` 3 l> 3!` l2 > 3!`2 , 2 3> =bX> => =b`L "`Lb`< "`< -"  2, 2Ā 3> =b "b 3 l` .q  ؐ` .h'̐آ@aߒ /ـ  0 /ؐ  .T0/ؐ  .M0,J 2 3> =bX2> => =bb` "` .H /` * ! ̒Ĕ 2$H 0, 2 3> =bX2> => =bb` "`  "!H 0, 2 3> =bX`4 "`4> => =b`0 "`0b`$ "`$e  2 H 0+ 2 3> =bX2> => =bb` "`I  2Ȁ l> #|& ̀@2/H > HH; >ȕH 'ܐ '$` "pВF@̐ '$d"cВ9p`H p@@>  H  Ha :`a>``2`3> =bX2> => =bb`  "`   . 2 `2`3> =bX  "bX> => =b "bb "b 7    `*`4 @:4 4 `"'  `*` -7aA  aD`쀢 aA   +$`2`3> =bX )2  `*` (-aA aH aL  aP aT aH@fg  aA   *`2`3> =bX  '- ( 2 `2`3> =bX y"bX> => =b r"bb n"b ؓ*` 2`2`** , " ) ,aA  aD`쀢 aA   *`26`3> =7bX )>  (,aA aH aL  aP aT aH@e  aA   *r`2`3> =bX> => =b`L "`Lb`< "`< 0 a l+  $3ǔ  a*O`2`3> =bX  "bX> => =b "bb "bv  i a *` `' 3`2 7 `2`l` "` $6 ` " >  (   6 > # `''  @'''Đ 'h`302`3`l`20) 0&@ې&@m"@,`l`20 0@@  @Ŕ)Ȑ .㿘`    *> 3!㿘`    *> 3!㿘`    *> 3!㿐'L'P'T'X'H   3㿘> "H /f * '  @> = `""H 0)\' 7&  2" "> "D` ""D bz > #> ] *aD j3 0j  H 0 㿘 `  @  @ 3㿐'L'P'T'X'H  < 2㿘> "H /f * '  @> =X `""H 0(' 7&  2" "> "D` ""D b > #> ] *aD iɒ 0i H 0 㿐'L'P'T'X'H   l㿘> "H /f * '  @> = `""H 0(' 7&  2" "> "D` ""D a > #> ] *aD ip 0iI H 0 㿀 ^\> 2#䀢`X<  R2!'N <@]Ւ   //'g H /* ! ڔ  $  7> H 00##> 2 $ @ې?2 &H 00$!Hc  u ) 3 *  *  4@֐@ & > =b! "b' $@ !㿐'D 'H)2 > P"> P> :a!$> ; x D 4%> PH 6 ``B >` "D!<`0B:`0* @*`@*` DH> ;  `B :D' 㿐@`'0 `('  (%>u )l 3 *  *  4@WȒ@ & > =bX! "bX'R $@p !㿘~㿐@`'0 `('  (%>u ). 3 *  *  4@@ & > =b! "b' $@2 !㿘@㿈a2 > 3!`3l> 3!` l2`> 3!`` 2`$&+ A a  ``̀@/H > HH; >`ȕH `'``$ '`@V```$ '`psI2`a " " ( )@ "۰ 7 ` * a 2  0`$@+``% a ``@2`a a  aa aa "p`a@aƔ  "j` (  " 7  @  `4`*`@:4` 4`  '( ( " 7 ?ؐ#@( &-u ?ؑ*  2 2 ,, M 쀢` "   쀢 [&W'a 쀢 '쀥 "`$  (  2 D 7 ` 4``$@ &`$``@51`@,(a  "  ( a  @ *  a l2`   "@@ @ @ 㿘>  H Ha :` >` " 0  2``'?ؐ#@  ?ؑ*  2 2 *`*`%> `$ @   $.  a%.  d۔ a *` `$ .``a n a        0      @Z  a23?0.``$a`2 ` `$   ?D  a " (0 㿘H /` * !  .Ŕ )> '> 2$! H   4  > 4 "> 4 > 4 > 4 > 3 #     @ `` *u ` 8q & ` $ @6!*`2 6!  "> 4  > 4[ > 4W   ܔ  @"& K   & &!d`&!h L6 * s2 &!`c @Y $  '''* ''   L 6 * S2 &!\c @Yђ $ @ * ''''   @<ٔ 㿘!\ " !`@Y !\ L&!\!` @Y !` L&!`@=5   > 㿐`$` `a a    " 2> =4 a> =X`#"* a 4`$@21 %  aadah@x    " 00 #ې> =bX`  "`#Ґ #ΐ> =bX`(  "`( ##`# ; B>` > =""" : "X 8@ B ; 8`$"`$``@8`$``@ @ s#Ű `$!``@ ``@ @r`$ ~&`$   -5  `(a@``@` a@^Ք  2 2 @?M #ZX` 0 0 LG   #K@?X`P 7 p"`P@X 0$ ,$" `"@" """a\"`4*  " "@%% 0 $ >Ɛ"t $$($$` <$ $ $$ (`a$a bk, -$ " $a" $`$ @ a$a '  8* a` '  $ $a`$`* $`@ @=x  `(`$`,H /` * ! @`X ` 2  l L> =bX` "`   ` L  @" =   # > =H 0@=VbX` "`  ? L> =bX`P  "`P`  " $y @]`0  $ L> =bX`$  "`$ $  L ! * $@&ܐ$V ܒ !!d!h@ޚ   > =  bX0  > = bX`  "`bX`(  "`(@= $@!  &Gؠ  > ="X`""XH 0j2  $m  25"0$@ *! ( $\"@  " "@$$ $N"   2$ " "@$ $"  aB "$ "@$ #ؖ"@ > ="X `" H 0 $@2> ="X `" H !( `$ t֔ H p@H 0!@=N㾀``@V a `''$'('> # '' '͒`$@a   " @\`@\ $   > =bX 0 $ 0a  @?@#@ !6 H ( L$ H!/bX` . D"` bX`# ; B>` `@# ; B;`@`$ !``@8`$``@ @ ې! `$! ``@8  ``@ @ڐ`$ ~&`$   " 8 @ !  " 8" 沔 !   `bX` %bX۰ 7"$@ $  2 ` bX 7 %bX`` `$@ ad'`&ad` _`@` 2`$ 7@   ,@  &[*"u  2/s  2 @ɐ", $`$`$`($` $``<@$ "@$ "$$a\$`* $`$ @@ @:㿘  H /` * ! @`m ` 2   L> =bX` F"`    @" <   # H 0@:n<a L> =bX` "`% X L> =bX`P  "`P@;_ $ @! " !!pؒH 0H 0x@;<` #dd#``2+   "@ : ( # " @ > =X  0 2> = ( # X(  (#㿘`o ``   "  *  R K  2   !    *C H /f * ' > "X H 0 2H /f * ' > ߔ 2H p@ """22&Ұ 0  &  & ` $`  p "> 4   > 4>  > 48 > 4    > 4!!0  ` $  &!d& & &!h  L6 * 2 &!\ ]А@T $   *'''@7 㿘!\ @S !\! L&!\@7v   > p``y 0C! &> =b 7 8"b ,, 4 `4 4 84 4 @  @``> = ` 6!@ "9` @*  @$ @@`4 `&  @  ٲ@@@ `Ҡ  ?]U  > < #0]M@@> =& @ΰ А  (Ԁ  > =`" ('/א ؐ ``/ِ " 7ڀ` ِ  `7耢``  `   7 pܔ ((  ؐ L   > =`"z 7 ( آ (  ր_`+K@`<`0JI@  * 6;!> = @2*  *  "`_$"6 L?   `> <#0\ "`H$" L(  * & @ *  L> =`("    (pRВ L 㿐`$!`'D    a "3 `$2/ D  aadah  > =  " > = D 7D`"0߰ 70  7D`" 0*`? > =$ D`"$0D> =` `""B>``" 8""@ B ; 8`$ !``@8`$``@ @ xD 0`$!``@ ``@ @w`$ ~&`$@8t  D 7@b`$#@ #`#` #`a\ #``*&)#`&#   (a@D `@D a@W”  D 2 0  0  LA   DD 7@8b`P E"`P@Q 0 D  0D 2 D> < o_0Da Ø  'Ԓ L@7$D `>$`$`D!$`$`(`a<@$` $ ($ $` $a , [b$ , @ @6p  `(`$`,H /` * ! @`} ` 2   L> =b` "`    L  @" =   # > =H 0@6{b` "` @7z  b L> =b`P  "`P $@  ` ߠ`0` @V  A L> =b`  "` , n  xn $ L ! + $@(ؒd ؒ !!d!h   > =   b > =t 7b` 7 n"`b`  7 h"` ^Ԡ > ="`""H 0d  2 ` `    ;4`   *# (o" `   " "@$$ _"   2$ " "@$$" @ @ZS `  "@$ ` "@$`H p@H 0 Ґ "@6㾀` @P@'D> #  a  ``D'''''' > =" ,`$ ,ad 2`$a  `$@ D   X$ `$@  a  2DD? c  ~ ("`H ;"`Hw ."` 4"` `# D; B>``"`@# ; B;`@`$ !``@8`$``@ @: #DI 0 `$!D``@  ``@  @"`$ ~&`$D  !  " 8"  ږ   `" 7`D%"0"'D$@  D =  2  D 7" %"D  ?2 , 4 `> <$ D m0`$@ad$  &ad@5̐  DDذ 7 " $""`""a\"`* "`$@  00 L   D 7@5"`P v"`P@O/ 0`$ @F 3D `0a  $ 3`2X  @7D lĔ `4X  @7D l  3* 0D/l Da      L@500*/D lD `>$$D $$(``<$ $`($`$`a$@a X,` `$ @@ @3㿘   0 (H /` * !   2  ؒ L> =b` H"`  ``@" <`  # H 0@3Ő> L> =b` "`' 2 `$ L> =b`P  "`P @l  L@4,H p@H 0͐@4 p > 4 !& & &!h $@N4  @'В@1F 㿘@1   > 㿘` @4   03> = L  (@N 0`$" >ѐ" ""$ , 8"  " $`$`($`$`` l<@$` `a$$ ($ $ , WД @3- l@40> =b`@ 7 "`@㿐   ( $H /` * !   L`2> =b` "` `#  ; B<`> ="  : " (@ B ; (`$ ``@8`$ ``@  @ `$!" ``@8  ``@ @`$ ~$`$  ``@" <`  # "H 0@2` "` "`@  x"`@@3   @$| i 2" $"H p@c   /    6?2$ @ *! ( "@   " "@$& "   2& " "@$ &"  Vސ  ?& $j  H 0H 0[@3㾀` @L͒ > # a  ` '''''' ̤> =b  $ a  "  0 ?# @$`0?`#@  8 ( $ 8# ; B>`  0# ; B< 0`$ !``@8`$``@ @ А `$! ``@8  ``@ @ϐ`$ ~&`$   " 8 @ !  " 8" 沔 }   ``$v 7"$@   2 `` 7 a"` @L`4 a  " 0   ,  ,` . F"` l/ i@2j  2 $w2"@  ""`"` "` 0"` L^  @Kߒ 0` $ (a$, aU  >Ӑ Ē ' ' (' ' ' `@1 ? H@2 `@ 7 "`@㿘   ( " H /` * !   2  ؒ L> =b` j"` ``@" <`  # H 0@0Ő` L> =b` J"` L2  > =b`@  >"`@@6 a @16H 0;  "0 2`?ؑ* 2 2 *` *`͐@1> =b` . "`@1 H 0H 0@1o㿘@`(`(`.  @` `(`(`.  ``` (` (` .  `` ` (`(`. 3 ` >y?>??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `>y?>??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `>y?>??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐 ې' ( (@ ?"@"` "`"`"`"`  "` " ` >yb?`@?`2  c@ 2`(`2`@@2, @2 @2  @2` c` 2@2  @*3  `@ - *`@3 @ c3 *@ @ `>zb + +`@ @ -@ @>{>z-(b@ (,  * @ !>|>z",,  `+,` >{@ -  `>}b . .`.@@>|@. `!>}-`"@'@@  '`'`y'` 㿐'D/`*@ + /    *` +(  . (D* **@  @  @D@ 1  ` 5>v5>u'/`5 0`0`0`` #,` 1 >v5 5  .  "#>w*  cb@ %>w  51 >w # >x/`+  >x*  >x+`" D```   `5`1>v"5`%>u/ 0`4 9>v(c"5+  5;>v b@ 0`>v c" 4 4 >wb+ #@5 c@ 0`%>w  5`>w cb@ >x/ `/`  `>x+ D  >x`$, `(" `, 51>v"5%>u` /  5 1 9>v5 5  (c"0`+  0`;>v b@ 1 >v c" +>wb #@0` c@ 1 %>w  5>w cb@`>x/  /`  >x+  D>x, "`4`8 `< 5`1>v"5`%>u`0/  0`4 9>v(c"5+  5;>v b@ 0`>v c" 4 4 >wb+ #@5 c@ 0`%>w  5`>w cb@ >x/ `/`  `>x+ D  >x`D, `H" `L 51>v"5%>u`@/  5 1 9>v5 5  (c"0`+  0`;>v b@ 1 >v c" +>wb #@0` c@ 1 %>w  5>w cb@`>x/  /`  >x+  D>x, "`T`X `\ 5`1>v"5`%>u`P/  0`4 9>v(c"5+  5;>v b@ 0`>v c" 4 4 >wb+ #@5 c@ 0`%>w  5`>w cb@ >x/ `/`  `>x+ D  >x`d, `h" `l 51>v"5%>u``/  5 1 9>v5 5  (c"0`+  0`;>v b@ 1 >v c" +>wb #@0` c@ 1 %>w  5>w cb@`>x/  /`  >x+  D>x, "`t`x `| 5`1>v"5`%>u`p/  0`4 9>v(c"5+  5;>v b@ 0`>v c" 4 4 >wb+ #@5 c@ 0`%>w  5`>w cb@ >x/ `/`  `>x+ D  >x`, `" ` 51>v"5%>u`/  5 1 9>v"(c5 +'0` 5   1 >v c0`, #>w #b@0`%>w c 1 >w"  5 c` >x/   /`+  >x+  D      'H ` e'P5`5`#>u%>vb.4 @/ 0`4 @5>v(5@9>u*" 57>v c 0`>v  4 >wc5 0`5`>w  # c  #>xb.@` `.@/ D+ @ @ @@ @ @1 1>u ("5>v5>u.5 >u/ 0`5  c1  9>v c" 0`7>u+  5 >wbc@0` @51 >w # ` #>xb. / @ D.@@  *@@ @  @ H@ 0`%>u.0`5`#>vb@5`@5>u/ 4 5>u7>v c(" 4 9>u*" 5>v4  b@ 5`>wc c5 >w 0` >w>x #.b@`.+  `#>xD/  b@@ Ȅ ̲@@ @0`1>uą("1 >v1 >u.5>u/ b@55 c5 %>u* 0`;>v #b@ 5%>w 5  #0` c 1    >x. `/ . @/`@ D   І Ԅ ز@  ܂@7>y5`#4 0`H(?D?+`?c @ (@ 5`@('D @`@(5P1 4 ,@1 4 ,`1 (,`,`  D@  `(0`55,` 5@ 5,`5@@ (,`,`@0` @ @(5`#5 ,`5 ,`   5 ,` ,`   `0`,` 0`,` 0`,`,`㿐'D/`*@ + /    *` +(  . (D* **@  @  @D@ 5  ` 1 0`>{ #1 >z ,`55 >{5  .  "550`#>|'/`*  cb@ 1 %>|  0`>| # `>}/`+  >}*  >}+`" D``  `` 1 1>{"5%>z/ 4 4 9>{(c"1 +  5;>{ b@ 5>{ c" 55>|b+ #@1  c@ 4 %>|  5>| cb@ >}/  /`  >}+   >}D, "`$`( `, 1 1>{"0`%>z` /  5 5 9>{5  (c"1 +  0`;>{ b@ 5>{ c" 55>|b+ #@1  c@ %>|  0`>| cb@`>}/  /`  >}+  >}D, "`4`8 `< 1 1>{"5%>z`0/  4 4 9>{(c"1 +  5;>{ b@ 5>{ c" 55>|b+ #@1  c@ 4 %>|  5>| cb@ >}/  /`  >}+   >}D, "`D`H `L 1 1>{"0`%>z`@/  5 5 9>{5  (c"1 +  0`;>{ b@ 5>{ c" 55>|b+ #@1  c@ %>|  0`>| cb@`>}/  /`  >}+  >}D, "`T`X `\ 1 1>{"5%>z`P/  4 4 9>{(c"1 +  5;>{ b@ 5>{ c" 55>|b+ #@1  c@ 4 %>|  5>| cb@ >}/  /`  >}+   >}D, "`d`h `l 1 1>{"0`%>z``/  5 5 9>{5  (c"1 +  0`;>{ b@ 5>{ c" 55>|b+ #@1  c@ %>|  0`>| cb@`>}/  /`  >}+  >}D, "`t`x `| 1 1>{"5%>z`p/  4 4 9>{(c"1 +  5;>{ b@ 5>{ c" 55>|b+ #@1  c@ 4 %>|  5>| cb@ >}/  /`  >}+   >}D, "`` ` 1 1>{"0`%>z/ `5 +0`9>{"5 5  5   5>{( c1 , 5#>| #b@1 %>|c c0` >|" c ` >}b/ @ /`@ >}+ >}+  D      'H ` e1 5#>z%>{b.5@/ 4 4 @5>{(1 @9>z*" 57>{ c 5>{  5>|c1  4 5>|  # c  #>}b.@ .@/ D+ @ @ @@ @ @5 1>z ("1 >{0`>z.5>z/ 5 0` c5 9>{ c" 1 7>z+  5>|bc@1  @0`5 >| # ` #>}b . / @.D@ @ *@@ @  @ H@ 4 %>z.51 #>{b@5@5>z/ 1 4 >z7>{ c(" 59>z*" 5>{4  b@ 55>|c c1  >|  >|>} #.b@ .+  #>}D/  b@@ Ȅ ̲@@ @1 1>zą("5>{5 >z.0`>z/ b@1 5 c5%>z* 0`;>{ #b@ 0`%>| 5 #1  c 5    >} ./ ` .@/`@ D   І Ԅ ز@  ܠ@1 7>~#54 H(?D?+`?c @ (@ 5@('D @ @(1 5 4 -@5 5-`5 (-`-`  D@  `(54 0`-` 0`1 @ -`0`@@ (-`-`5@` @5 @#( 55-`-` 5-`  -`  ` `1 -` 1 -` 1 -`-`㿘 &  & @> 0   & H 㿘  㿘 F H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@HA @e  @` @ @@@& H-@㿐'D`2*@`*2*2222 ///////*2@ `? @" /@> 3b D "   . . 2 .  .   ?`X?@?`?`?`?` ?`(?`0?`8?`@?`H?`PH?'D?;?   (. 6`0&D @0( 1 )  0(5`-` @ 0(5- @Ć0( 5- Ȅ@ 0(0`(` @̆0(1 ) Є0(5`-` Ԇ@0( 5- @؄ 0( 5- ܆@0( 0`(` @0(1 ) 0(5`-` @0(5- @0(5- @ 0( 0`(` @0(1 )  )3a6 . 5`-`  -@@ 0(5- @-0(5-  -@ 0( 0`(`  @(@0( 1 )  )Є0( 5`-`  -@@0(5- @-0(5-  -@0(0`(`  @(@0( 1 )  )0(5`-`  -@@0( 5- @- 0( 5-  -@ 0(0`(`  @(@0( 1 )  8 0( 5`-` @3zc6 . 5- 0@0( 5- 1@ 0(0`(` 5@ 0(1 ) 50(5`-` 5@0( 5- 0@ 0( 5- 1@ 0(0`(` 5@ 0(1 ) 50(5`-` 5@0( 5- 0@Є0(5- 1@0(0`(` 5@0( 1 ) 50(5`-` 5@0(5- @-3# `܆0( 5-  (@@0( 0`(`  @)0(1 )  -@0(5`-`  -@0(5- @- 0(5-  (@@0( 0`(`  @) 0(1 )  -@0( 5`-`  -@0(5- @-0(5-  (@@0(0`(`  @) 0(1 )  -@0(5`-`  -І@0(5- @- #܄0( 5- 0@@3*T aN0( 0`(` 1@ 0(1 ) 5@0(5`-` 5܄@0( 5- 5@Ԇ0(5- 0@@6 . 0`(` 1@0( 1 ) 5@0( 5`-` 5@ 0(5- 5@ 0( 5- 0@Ą@ 0( 0`(` 1@؆ 0(1 ) 5@ 0( 5`-` 5І@0(5- 5@0(5- 0@@6.0`(` 'D'''    1@3(c0(1 ) 5@ 0( 5`-` 5@0( 5- 5@ 0( 5- 0@@0( 0`(` 1@0(1 ) 5@ 0(5`-` 5Ȅ@0(5- 5@0(5- 0@@0(0`(` 1@0(1 ) 5@ 0( 5`-` 5@0(5- 5@0(5- 0@@ 0( 0`(` 1@0(1 )  -@3ta$0( 5`-`  -@ 0( 5- @- 0(5-  (@@0(0`(`  @) 0( 1 )  -@0(5`-`  -@0( 5- @-0( 5-  (@@ 0(0`(`  @)0(1 )  -@ 0( 5`-`  -@0(5- @-Ȇ0(5-  (@@0(0`(`  @)0( 1 )  -@0( 5`-` 5@3\b0( 5- 0@0(5- 1@0(0`(` 5@ 0( 1 ) 50(5`-` 5@ 0(5- 0@0(5- 1@0(0`(` 5@ 0( 1 ) 5 0( 5`-` 5@0(5- 0@0(5- 1@3\ b0( 0`(` 5@ 0( 1 ) 5Ȇ0(5`-` 5@ 0(5- @-ذ3]b6 . 5-  -І@0(0`(`  @(@0(1 )  )0( 5`-`  -@Ą@0(5- @- 0(5-  -@6 . 0`(`  @(@ 0(1 )  ) 0(5`-`  -@@0( 5- @- 0( 5-  -@ 0( 0`(`  @(@܆0( 1 )  )԰6 . 5`-`  -@@ 0(5- @-0(5- @0(0`(` @0(1 )  0( 5`-` @0( 5- @0( 5- @ 0(0`(` @0(1 ) 0(5`-` @0(5- @ 0( 5- @ 0(0`(` @0(1 )  0(5`-` Ć@0( 5- @0( 5- @0( 0`(` D    D@@D&&&& &> {`? @ > {    /`7`!@  @@  > {7 / `` 1 @)    > {7`/`@ @6. @1 )   @ @ > {  5-  6.@  %> {7  / @ @5- @ @ 7`/`  7 / @  1 @ ) @ @7`/` @  @6 .  1 ) @  ' 5 -@ @6. @  $7  /   5-@  @(7` /`@ @7 /  @ ' ,1 @)   7`/`@  @06 .@ @@  41 )  '||5-   6.@  87  / @ @5- 'x@ '> {@ |<7` /`@@ 7 /     5 x't1 @) -  @ @ 7`/`  @4t6 .,  @ @1 ) @ @@  4`5-,`@ @ @ 6.  07  / (  @ @@5-@  47`/` , |z#@ @ @@@ @7 /   3`@1 x) +`@  @ @ @7`/`  06.(  @ @@t1 )  3 + 5- @ @@@ 6.  4 7 / ,   @ @@@@5-@  5`7`/`-`@  @ @@7 /   5@1 ) -  @ @@|7`/`  6`.`@ @'6.@ x  @@@ @1 )   6`5-.`@  @ @@6. t | 67 /  . @ @@5- x@ 0`7`/`(`@  @ @ @7 / ' @t  0`@(`@ 1 ) @' @  @7`/`  5 -  @'ؒ@ 6.  @1 )   5 5--   @ @@@6.  47 / ,  ؒ@  @@@ @5-@  0`7`/`(`@  @ @@7 /   0@1 ) (  @'А @ @7`/`   3`6.+`  @ @@ @1 )   05-'̒ ( В@ @ @6.  7 / @@ @@ 4`̐أ,`@  5-  @47` @/`,#`ܤ @  @7 /  @  @0@1  ) ( @ @ @ 7`/`  3 6 @.+ @   @1 )  @ 4 5-,  @6. Д  @   5` -`@ 7 /  '̔ 5-@   @5`7`/`-`@ 7 /  @ؒ@  @@ @@ 'Đ   ȗ5`1 ) -`   7`/`@@  @6`6..`@  Ē @1 )  @ @ؖ @@  5`5' --`  @ @ 6.  67 / .  5-'p @В@ @  @@4@  , 7`/` '@  7 /  ̬@   @5@1  @) - @   Ȓ@7`/` @ А @ @  5`6ē.-`@ @ ̒@ @ 1 )   5 5--   @ @ 6.  @@ 07 / (@  @  5- @@ 0 ( @p @7`/`@   @7 /  @@0 @ ( 1 )  '@  @ 7`/` ' @ @ @@@ 0`6ȑ.(`@ @   @1 )  @ 05 -(  @ @  Ą6.  07 / (  @  @ @@@@ @5-@  3`7`/`+`'2֚@  @Ē@ @7 /   3 @1 ) +   @@ @p7`/`   4 ,  6.@' @ @@1 )   35-+  @@ @6. ' p7 /  3+ @@'@@ @6`5-.`@ @  7`/` @@@7 /   6@1 ) .  @@@7`/`  36.+  @@ @ @'l1 )   55--  @ @@@@6.  5`7 / -`@  l@@ @5-@  7`/` 5  -  @@@47 / ,   @1 )  @@ @@@@7`/`  4`6.,`@ ' @@@1 )   4 5-,   @@@ 6.  37 l/ +  @@@@ 5-@  07`/`(  @@@ 07 /   ( @1 )  @@@@ @ 7`/`  3`6.+`@  @@ @1 )   3 5-+   @@ @6. > {p `> {`"@"`"`l "` "`"`"`"`"` "`$"`(27 */   > {` `,5- `< `0 `4 `8 @  @   @& && & & H;j&. 0㉒`v"" " " " " " 㿘 . &  6  & 2 ?`? @"  9G  ? @ ? @   &93@㿐`      #* 2@, >b@ ` !! #>bH ` !!     @# *`2 .  㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`P?##`H>bP6-6)*`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H'w, 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  L *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?= 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐:  * ( *` * @ +  +` @ @ ?Ȓ000000? ,, , , , , , ,   ,( ʠ  * ( *` * @ +  +` @ @ ? 000000,, , , , , , ,  @ ,( 㿘` `(`(`.  @#0(3>>☷.3>@ #@3`>` / c. `+.   D@ # 0(33c(3 @#.  H@ # 0(33c(3 @#.  L@ # 0(33c(3 @#.  P@ #0(33c(3 @#.  T@ # 0(33c(3 @#.  X@ #0(33c(3 @#.  \@ # 0(33c(3 @#.  `@ # 0(33c(3 @#.  d@ $# 0(33c(3 @#.  h@ (#0(33c(3 @#.  l@ ,# 0(33. 3@ (c  ^@ p 0#0(33c(3 @#.  t@ 4# 0(33c(3 @#.  x@ 8# 0(33c(3 @#.  |@ <# 0(33. 3@c ( @0`0`0`2`2`2`/ // / / / / / 㿘@`.`/```(. (`/ `` >>!>c#>| <'0(6". 6bc@6"@b. x@8' 0(666c@(#@. t4'0(666c@(#@. p@0'(066(c6@#@( l ,' 0(6".`66b"@b. @ h@('0(666c@(#.@ d$'0(666c@(#.@ `@ ' 0(666c@(#.@ \'0(666c@(#.@ X@'0(666c@(#.@ T' 0(666c@(#.@ P@'0(666c@(#.@ L '0(666c@(#.@ H@' 0(666c@(#.@ D'0(666c@(#.@ @@'(066(c@6#(@ 1 *1 1 0`0`0`*******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'>>>☂'Ąd„ >ׅ(". >г7`7`ȳ.`@2 (7 ('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%>ߤ܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3>000(b@>6  #6 /`+6 #>+`" + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%>0(. 0* *`67` 7` >c7 " 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A>ޱ. .`(($%>ձ. ˳.`χ((7>. ڶ޳.`( (>ϱ. г.`Շ(("@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘>"  !j4 l,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`(@@7`?(@@0` ̆3(@@7`?(@@0`UUU(@0`@(`7`/``@>!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`>!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU(@1 ?(@0` ̆3(@1 ?(@0`Æ(@$$㿘0`(`7`/``@>!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3>!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$> * ``( > ` `(  㿘> 3"H @$-     ` 㿘> 3"D`" א ? " ? *`   +  *  @  *`* @ *@ 1 c @. (` 33 ) 6 @@ @ 6 @ 1 UUU . @ 0`? . @ 1  . ? # # *`@ @>< @ 3 @ 2> 3 "Ȉ@ @  - `(`) 0`1 (`) 0`1  @ @0` 0`  `00`0``? `< ,`1 1   <  +1 1 ,  00`0`   0` `8( 1 @ ?,+  *@ @@  @?.   3` &@3`+`` &@  ` 㿘4㿐 + *`   +  *  *  *`  * 0c *  0)?# *  0' ̐3 *  0%? *  0#UUaU *  ?`?0 *  0 *  0 *  0 *  0 *  000000.`.`.`.`.`.`.@.`㿐> 3#`m H /f * ' > 3#  1> 3#    `$ < "!  9 2  2 `@ @`  $ c  `2  c  L`L ژ Lc  , H 0! * "* <'      @ < "H 0㿘> 3#` < > 3 @ 4 H /4*`* '*` * " c* @  ?"@c D€c@ 9 @  @7 LH 0㿘H /f * ' > 3c   $  l!0a > 3` "#H 0{$   *@ *`"@ @*`   > 3#    `@ 2   `9 2 @ M  L L M.  . H 0I?* "-  laI    H 07?!> 3* *"#*% *` * " * @@-  $@  @ #**`9$ bޒ l$#H 00#@ *9H 00H 0?> 3  ` `4+ > 3$ H(* ( c(4( c@H" HH  㿘> 3  ` `42 > 3+ H(. (# ($(#.`0@\&D&<&@!H 㿘H /f * ' > 3# ``> 3#`. * "* @ `$ @ 2 *@H 0, c.`  $ 2  `` "``* "* c L@Ԑ`c 9`* 9c"H 0 㿘H /f * ' > 3   ,> 3"#"H 0 #0 > 3 ,""H 0  㿘H /f> 3* '> 3   T> 3"# "H 0 > 3#0 > 3  T"" H 0  㿘 "D  P > 3> #  > 3#> 3  cH4 9 "  H "  `  L L +  & @:  * > 3" * @& `H€ " & @' 㿐 "g  ( 2 $a #> 3c2 & @T > 3  @ 4  4 "04`24 $ ` 2 #>ߐ #*` * " *  `9  r c @` $4  4 "04`24 $ ` 2 #> #@ " & @ 㿘 $H /f * '  $`" > =!> >`4& $ 4 $`2`4> =#PܒH 0㿐H /f * ' '> 3 !> =>`#P#\ 8    > >> 4`#\ 8    $#P H 0' H 0 @P 8'> >4ޒ @C 8 $$ 4& $H 0㿘H /f'> 3* ''> 3#> 3)>`c $ Ж  }M` `,$  T$c㿘 (@㿘 P@㿘> 3D. > 3 ) > 3> 3H.( (@9 H4  @.$@.# t<HT`l"!!!"   0#e ( @   #g#i@ #f@ʰ 0耦@0#h@۰ 0` > ܓ*` €> 3#> 4 > 4  > 4  @> 4 `> 4 > 4 `> *` €> 4  > 4  > 4 > 4!L> 4!h@L $Р@H $&*`'' @j  @ f &  L ]:  ' F: T2'Ȁ#* '' B  &  L ]: Ԁ'ܔ : .> 3#H `?  Ԓ :;`#\ :#l#h;p@ 2 f  & . "_ L܀ %^ L0!@U @\@@I  @  @$㿘`#     ! @  ! X@   p$ t$  l$  \$ hX$ @y$` L "\`"@  @$ @ ΐ@ 2    $ 4   $ X` c`   %`% % % <% @* % `    ?$ `$$$$$(* $` X> 4$ $ $ $ ($ <``^  Z,  ! S ` ܒ  $ $  $"`  $ `$`" $`  D- $ 0>  { !   2x 2`` X`  ``    0  X@ ]ْ L㿘   x" `#|  А㿘| 㿘    `>!*` €        X  L[ڔ  @Y X >!$   4 $4$P$  @ "@ `   " @ 2   L [" 6  @ D :  ` .>  zD $ " ,@ 2   @     ` % , "] L,] L   -㿘  (`"`$ "@@ 2\ L& ( > 3@     㿐0#d@1  L [ &@&`&`@” \Ȓ L0 2` 2 > 3#$""`(&, ?",`0?"`0`, {`0   2  " 2 "   񀢀  "@ "`  "  "`"  㿘`  LZ  / 7`4`, @ & (\& $h& <l& & p& @t& & > Ғ0 㿘  $ " <\C L < "\= L\: L㿘 `> t6>>!m ` `2 d!(@ :&@ %>`2 YH"&  㿘 `>!`=6>>!6 ` `2 -!@ :&@ %>`2 ""@}&  `    @   &  `2 ??* ""?㿘>>!ؒaߔ  >>!גa3>` @&ɐ.`  6"$ #> @&b(.`  "@   @  Դ& ` 4444t4t4444848@8L8X8d888::8p`  @`` `` "C?`1> #*` € `€`` ``€ `2 ``€ `€ 2  0`` /k `  㿐` l W!   !   "   X’ l 2&`;   //.   $ E "@?" ?&?  + @` :"`" "`X l 㿘 q`o> 3#Ц`#> 3cԤ :` " cԔ  ,`2Ѐ`cԀ20Ѐ`cԐ $c * $ccԒ l* V  ccԀ 2 $c$cԐ @A= 7@*`Ѐ  cԒ2ޕ*X1 l$Б,@`'&  lVi  $@ @?` > #@*` €> 3#> 4  > 4  > 4 @> 4 `> 4 ` `  :" > 4 > 4 > 4   lV0 "` `   lV% "` ` #> 3'> 3 @  6*@ ` & : &`  €```  *  2 ` cP :  @"* 2  @  j*@ ` & : &`  €```  *  2 ` 㐐 :  @"* 2  @  \*@ ` & : &` [> 4!> 4!0  lU "` `! ` &  l: U "``  ` & : "` ``   : €```  *  2  €> 4!L> 4!h  lUg "`  "ܐ  @ " > 4!"` @  @"` `ݠ 㿘> 3#Ԁ@  > 3#Ѐ`.`@O `L   c"`:> #|*` €  1 `@ -   @` VΒ l  " `   @` V l  " @ V l   "V lV lc 2  㿘 2 $f  Z   U> 3#    > 3#Г*   K&      # : `    1  2  * ?`$> #*` € 5   & `4 f  &  &  & `4`# 㿐А !> 3`$#>p"@>"#\ > >"`   ##\     ##\     ##\    y ##\    q ##\    i ##\    a ##\    Y ##\    Q ##\    I ##\    A ##\    9 #ؒ     1#\##\    ) 㿘 㿘 㿘  lS  @e&0㿘@\ U l&㿘 㿘!  㿘  lS!&@9!```a㿘@(!U\ l&㿘ܔ 㿘 㿘!  lS H H@ &.▕6㿘@ `HU2 l&㿘ʔ 㿘f 㿘  lS_  @ &㿘@ ג U  l&㿘&㿘2㿘  lS8 ( (@ &㿘 ,` " `@ ! lT`` @  (TՒ l&㿘 㿘! 㿘  lS#В&@ #е.ǖ ! 㿘@ r#T l&㿘.2 㿘.@ Е2 㿘.ڕ2 㿘@  㿘@ Ȧ@ ? 0XP "? 6">>aȐ!'''' '̔ R l,` % T "@ .` R l,` % T"@  $   PT''> 4!Z > 4 !#\?  ݱ 2e,`*   |  T̀ ؀`2܀`K`I lRS  C&'& &`'ܰ  lRC  2&  # @ @@ l@S&@ $@ l@S& ` @ 2@&  &SÒ l` @  뻐 ̐ 㿘ڐ lQ 㿘S l㿈a"@  o6. Ґ ' "  "`"@"`"`  o6 ?#\  @ `   p  ' 7  ֹ6h \ /'А Ԕ ූ  Ū  Ր '̖ "  "`"@!?3# `` z '̒` "` "Ԓ#  `  '̒` "` ,@,`$`H /f * ' > "Xv!H 0'>  2H /f * ' > ߔ$ 2$H p@ """2 "  "Ԓ Ӕ  R`H /f * ' X5!'̑H 0̀`!̐ 2`H /f * ' > ߔ" 2"H p@ ̐`"`2`"@"`̔  "  ,@,`4`$`p̰̀ >k#8`H /f * ' X!H 0 2H /f * ' > ߔ$ 2$H p@ """2 " "Ԓ G  ƀ` Ԑ  ` %`  Ð  < %% @  <'> 4᠀ $᠒  $$ $ $ $ $ $ $ 8$ 4  '̒` @`'% % d 沖  f'Ԓ  w _'>`Ր#``CЀ "F'̀ !@?'''ȒД̘ؖ 㕚Ȱ # N$  ڀ` Հ`᠀@Ѐ` > #ǀ`` >#`& <   ׫   ' 7>#H|``    ? À`'''@` ܐ אЀ ԁ㿘` ? h:  Ӱ `-H /f * ' > #H’!& $H 0 $ (  & 6 & 0& (& ,& <& 8  2 I   & "㿘 /  "    ?      oŐ.@&g 㿘 N   "  " " " " "㿘    2    "  &@.@ .` .` .`֋ 0X!  'P   ># 2x 6s " @bP@{`   P%`. [#%`P. Q`@P @  0C@?0;08%`a "PXPP%a@P "@ <`P` `><> >a` "`@ e<`   @ `a:`  > 6#H `K' G 1 `ar:` | 2" @ "  0" 0@$ 0@ "   0 $ 0    C`: @ ǖ` C   0@  @@ @і "  0"   0 $ 0@ V'$@ 8 ` "@@&  /$. l h@@ l $& l @ "o  0 d $ 0 0 >#/ Z  l@ "@&, +> >0`"0 $@o "?  0"2  @ 0 $ 0@5  @$" @ 8    K# `" H@a˔<``> 7# Ґ  4@8  X  `  !>   2 <> " "<> (   `  ?`5`@" @b`@zS`" `  %` @  ` %`-T `=   6 װ Ӏ"a @ `B 2a` ]   0h$ 0Va "%aV%a $`5> > @}`$ "`$ @ȕ<   @ $8 :` @ 2<`5`  B` 2 d`( d  B=``   @_  d @ `@ 6  H.$ , ːV  H`֔  d`@ `8@ $ ` $ d$ `$ d l   ` & d h d@   d$ h $ l8  @ $ h $ l 0` ?$ 0.$ , " 0@  0`$ 0$ ,@ֶ  2  X 㿘 X! @!| 2#>  @Y  `+ k "   _ 㿘 X! @  >  !*`   '> 4   8jݘ   @Xɔ 27  `4   @X  ? 4 ?4 l   R 䀧  ? 4 ?4 l  㿘> 6#H`*> > D" c   ` 0@2&  0@ & 0&  & "@"#l[ # ``  0D @ H /d * % H 0 h \ 0` ''@ % % +%  T : <2` H* @ % *`  0?Ѐ@ = > >a` %  "` @Œy> >a`,'̐ "`,% @k 0@"o T < H% ''% `<  G>V`< T> >a`: 2*  * #`= @ ` & h < T" *` @"   @8 H @@& l <& l`(`@ $T >, H[ϒ ` &`> >4> ""4  = `@ xy 0& 4(& 0s> >( `:  d2 H* #($% * @ 'ԑ< 0C @=   @'Ѐ`% '̐ ' 0@ & 0@eȤ ̀  0  0 ?& 0 0@*@& 0% 0 !H /d * % H 0 0 Ȁ"  0$& 0" & d 0(& 0%& 4 5& d& ` `& @@j`XH /d * % MH 0X> >"d 'D1>ؤ5>Ħ7> ;>9> > "8؀ 1>5>Ħ7> ;>9>   8  2   >1     ; ">  0a ">!1 `7!~ ">! 1 ">!@Hn'ĒX@z  / ,! $\ >!x@d ?'//ɐ!&h@U ">А!H?'Ē!VaD*  㻘@ > !@۔j >"60$ab  >"()0@ NiO :.` K.  * . 㿈 t '` "` #a b$$ $  "@  o$ 4?#\b'  >`     %'   Я>  > 4a$h"h '> "> `hЀ ' '>"P H "/ )㿀> !h> V!  '@ ̐N "@5 a#\b  U ) Y'y '쒒 '#' k耢  '@j   &..>i"x 㿈#ab   2@  '( ?#\b    `  H` #   [ $ '    0 Hͣ㿐> a> >  ]Mh> >"cP> >>#T  Bh > &b> >>#\"lbВ!  } 㿐> "! +    > >bh> > cP*  > >  X 2T 2 @” 2     2[& 2 > >#T " B4 2> D"t   & B# 0>> > ~<"l@!$`$ !`L2` @ 2 `< 2`@ $`<`@ $`@ $" $@$  G $  $   W4 cT A & 㿘 > (> #  b D >"    <` `$`    @VQ  Iz ` 4`  ) 㿘 > (c  ``D >#  `" `< 2"  "@`<  %> > " T IK  T @$! IA ! "!Q<! Q6`<l$` ȤL0 @8,'TE'P  "    'PTP @`L wL - HL $T<8#\#`  H@@P <8#\#`  H@@P  3  TL  H"Z T  P@ "@    'PTP @`vL 2L m L T  P@ "@  PT@`  0'PT  P@ "@   'PTP @`FL 0LL0 `#\#` 4@fu "3L $T<8#\#` @P @ <8#\#` @O@  ˰ L  H @d Ѱ  4!0@HC 2 4`<     0 @H1 2,4`<    0  @@H 2,X4 &f 4 $TL <8#\#` @O@ <8#\#` \@O@  D L  H@d<    8 `    $ 0@  "@` <G   ?# ? "X|!H 0 2H /f * ' > ߔ 2H p@ """2<"'<" < '8< 8`" 8 '8$Ƞ L  0  @X 8 ,'TE'P  "  ` 'PTP @_L `L@ - H L $ T<8#\#`  H@@N`<8#\#`  H@@Nך` ʉ  T L  H" T  P@ "@  ` 'PTP @^̘L L  Ô  L 0T  P@ "@  PT@_9  O0'P L0 `#\#` 4@d , L $ T<8#\#` @Nw@`<8#\#` @Nj@`  "  L 2? H 4 % 4 $ T L <8#\#` @NC@` L  D T<8#\#` @N1@`    L  H <v      8  L  D T`    $ 0@  "@@  <G L  ?#@? "Xz!H 0 2H /f * ' > ߔ 2H p@ """2<"'<" < '8< L 8DT#  L 8 T D'8@c`L0 @ 8 , ?E  "    ' @]䀢  - HL $TԒ#\#`  H@MsԒ#\#`  H@Mf   L  H"r   @ "@    ' @][䀢  R L   @ "@  @]Ȕ  0'   @ "@    ' @]%䀢 > D!   @ "@    ' @] 䀢 m  /7  @ "@    ' @\䀢 T!@  @ "@    ' @\֘䀢 :'  @ "@    ' @\䀢 "!@  @ "@    ' @\䀢 '  @ "@    ' @\䀢 !@"  @ "@    ' @\r䀢 ְ       ?  @ "@    ' @\R䀢   (  @ "@    ' @\7䀢 '  '>  H H *`" *  * ''  @ "@    ' @\䀢 u  (  @ "@    ' @[䀢 Z'  '>  H H *`" *  * ''  @ "@    ' @[И䀢 4 f  @ "@    ' @[䀢 ' L'  @ "@ $ ' @[䀢 :0?# @@> D /7!@2'!@2' ! :?!@"''!@"L'*`" *  * ''LȐ `#\#` ̖@a 4 L $TԢД#\#` @K0ԢД#\#` @K#؀ Ր " #\L ɀ H0 #\ 8 Q8̪ !   l@ p@ # :FL $TԢД#\#` @J   xԢД#\#`@JҘ؀ Ƅ " #\L x H߰ #\l ??2`<Ȁ &  X`<0`<   Ȓ @C ̖!Y̔!C ̀ $TL  ԢД#\#` @Jx  D xԢД#\#`@Jh؀   L  H  #\8@^{i     8 `    $ 0@  "@`C G  ?# C?ԑH /f * ' > "Xv!H 0 2H /f * ' > ߔ 2H p@ """2"'"  'Ԑ` И D#` ЖD@_'ЁL0 @ 8 ,p''F'  "  ` ' @Yۘ 2z@ /L H $T#\#`  H@I#\#`  H@I R  L ) H"s   @ "@  ` ' @Y 24  L   @ "@  @Z  "'  @ "@  `' @Yd 0(@ 4 ? $ H )L  $T#\#` @I. #\#` @I# Ր " LL  H L  ``'#\#`#h''#d@\T`  ' -L  $T#\#` @H  X#\#`@HԖ Ć ]L ^ H VA* @ @ X d% h% X$ \ $TL #\#` @H  `D`X2 X#\#`@H 3  L  H  @]xL m    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xu!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` " ` '#@ i    8 `    $ 0@  "@` G  ?# ?H /f * ' > "Xt!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '`   #`  ' @\@\0h    8 `    $ 0@  "@`C G  ?# C?H /f * ' > "Xt"!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '`  D#` D@\'`0'@08'L ','L'P' '''D'  " $ '  @W  _ - HL $T#\#`P  H@F`#\#`P  H@FӘ` …   L  H"ǰ    @ "@ ( '  @Vɘ А  L >    @ "@   @W6  L0'> ߰#̐  ;> ?ȑH /f * ' > "XsB!H 0  4 H /f * '   6 H p@  $ $$ 4 H /f * ' cHs!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  ܀ $ ''"' $($"$ $ $ #$LА `   %%=%#`̘#\Ȓ %%%@\Pఒ 1L  $TP#\#` @E `P#\#` @Eۖ`  L  H @ZԔ ɰ `< ܀     }p eL쀦 "$TaԀ $TL P#\#` @E`܀   \P#\#`@E` = L  H" ` @Z 2u ` Ԩ%   $"@ @YU"    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xr!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '""㾀`0`' `L`@ `8'H'`,'L'P'4'0'E  "   '040 @T, , - H`L %`T#\#`H P H@D˜ #\#`H P H@D  g  4`L  H" 4  0@ "@   '040 @T, n, `L 4  0@ "@  04@U  0S'0!4  0@ "@   '040 @Tv, :,        0@ "@   '040 @TW, , 4  0@ "@  '040 @T>, ڐ0),`L  '`<   @4 `L '1`L H %`T H#\P#`  H@C' H#\P#`  H@C' `L  H߰ `L `#\#` H @Z# -`L  %`TH#\#`P @C H#\#`P @C b `L  H~ w  <       !  @;L   @  @;L8 -L '  P`L %`T (  2'T' :`F T T('"'' %`T`L H#\#`P @C= ? `P`dH#\#`P@C+Pݐ P @'`L  H"" l    8 `    $ 0@  "@`c G> D  ?# c?H /f * ' > "Xo!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  d" ἒ`d'$'gT    8 `    $ 0@  "@`G G   ?# G?H /f * ' > "XoH!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `H" 'H'D` ?` > ߺ#     8 `"   $ 0   @"   ?$  $ \H /f * ' > "XnВ!H 0  4 H /f * ' ` 7`H p@  $ $$ 4 H /f * ' > #Hn!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %4 .  8c " 5 2 >vW#P    8 `"   $ 0   @"   ?$   $   @##    $  "`:`"`"`"` A 9Ւ   8 L @' " %`T`L H#\#`P @AI 2 XH#\#`P@A:  `L  H4 8@V2, " u@V8`% 4   ? "@@T%  $ > D!> D!$$00'@8 'L'L,  ''''`'@  `E  "   'ЖԒД @P̀  - HL $T#\#`  H@@`#\#`  H@@` Y  L  H"ð   В@ "@   'ЖԒД @P̀ Y̐ L `  В@ "@  Ж@Q   0>'Ѐ`&  В@ "@   'ЖԒД @Pì & '      ?   В@ "@  'ЖԒД @PÈ 0S̄ ?  . `*Ԁ`К  "@ " " ` "`" " `" #"@"   2 6.LL   $T#\#` @?ږ  `#\#` @?ϖ `  " #\L 倦 H #\  `#\#` @V  -`L  $T#\#` @? `#\#` @?` H " #\L  H #\O 80L' < `         @7L 6L  $T#\#` @?U``  x#\#`@?G`  L ] Hd #\8 @S][ 3 .5ؒ %%` "" "2    %=%%%> >H`"H7h LJ " $TL `#\#` @>``  ``L```2 #\#`@>͖`  `L 〦 Hဦ`#\@R8 2ް     8 `    $ 0@  "@` G   ?# ?H /f * ' > "XkN!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `" ` '    > #\#\  i     8 `    $ 0@  "@`C G  ?# C?H /f * ' > "Xjْ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '`  D#` D@S'x'P'D&D`'L" L 0 @ ,''% (% 4 % H>  H H:`4`, @,`b2*@ *@ b 2`*  *`> `H@C3`+ > 4!+`<B <`BE=` ` " ' @M  / H`L %`T#\#`P  H@=p#\#`P  H@=cP P @'`L  H  @ "@ ' @MW T `dO `L   @ "@ @MƔ  0; '$  @ "@ ' @M' $       @ =`%`H  @ "@' @M  ?  =` ` ;`B=`%`P #  "@ " " ` ""  "  # "@"   @ 2c %`T#\#`  @<#\#`  @< #\ 8 @P  %`4=@%`,H /` * ! `H @   `` @`` `8`` @8` ` %` ` ` "`$`  $` %` `H` "`$&`H`H%`$`, h `p *  @@`  `d d@L  2 ` `` @ `d``  @`d d@4  "`"4` %```"`$``%` L `` `@  ` @ P 2@  `@`d `@`d d@  "`L0 %``"`$%`H 0> `H`H: 0(@(b2*@ *@ b 2`* @ *`>  HB2**< @ B H /` * ! `H ( $ 2 4   4 2 `" $ $"`$ $ "@ `"  "`  "H p@ , L% , 8 #\ L `#`  d@Q '䀤 '耥8L ' <      ' 2  H L@3  H    &&& >  "&6`H   2 2  + &1ƒ & "" "2 2> >H`"H3_  L'=> ߬#̪ $ % T#\#` @:ך #\#` x@:̚#\8@N% T  `L``2 #\#` @:y#\8@NΚ    8 `"   $ 0  @ "  E>   ?# =H /f * ' > "Xg=!H 0 2H /f * '  5H p@ """2"'"  '>  \`"  ' P `H \  h     8 `"   $ 0  @ " C E  ?# C=H /f * ' > "Xf͒!H 0 2H /f * '  5H p@ """2"'"  '`  D#` D@O' ,`% 4>nu#`H /`* !   =`H% `H "`$&`H% $`(   `" $ $"`$ $ "@H 0  H /` * !   =@`H%` `H` "`$&`H%`$H 0> ڀ H 0H /` * !   4 "  ` $"`$ $ " 4P"D"@ 2 4H 0 㿘> &"䀢`>c@j ``"``"```"@` `"`$`$"`$`$` "@` @4  "` @ ` @`>mŐ#$ ,!`, , (@ `,@@ 2@"@`> `, (`H` &`,`2 ( H 2 (& H ( &`  (` "`$& (&`$`(   `"$$"`$$ " ( "  ( "`$& ("$`(2 㽠`L`0 `@ `8``, ?@' ''''$'EP  "  ` '@D@ @H< <@ /D`L H %`T,(#\#`  H0@8 ,(#\#`  H0@8 6  D`L nH D  @@ "@ ` '@D@ @Hy< y< q `L D  @@ "@  D@@H  D0` '@D  @@ "@ ` '@D@ @HJ< J<@ 4 ? $ H".`L`L %`T,(#\#` 0@8 ,(#\#` 0@8   " `L`L H `L `$ @D''#`#h '#\#d@K9$` 8'  '$=`L %`T,(#\#` @7Ø0   x,(#\#`@70 e `L H #\8 @Kɘ$  Y0D  @@ "@ ` '@ @G< <@ "     'T ' Dl D  @@ "@ ` '@ @Gn< n<> D@! D  @@ "@ ` '@ @GS< S<` /7D  @@ "@ ` '@ @G;< ;<@!@D  @@ "@ ` '@ @G"< "<@'D  @@ "@ ` '@ @G <  <@!@D  @@ "@ ` '@ @F< <@'D  @@ "@ ` '@ @Fۘ< <@!@!D  @@ "@ ` '@ @F˜< <@`      ?D  @@ "@ ` '@ @F< <@  'D  @@ "@ ` '@ @F< <@'` '>  H H *`" *  * ''D  @@ "@ ` '@ @Fd< d<@  H D  @@ "@ ` '@ @FI< I<@'`-'>  H H *`" *  * '!'D  @@ "@ ` '@ @F#< #< H   '7 @'  @@ "@  '@ @F< <$> (2 cx <@' ' /` 7``  `    :? ' ``!u  .  %H  ]' ``   ' :5ג 6?-  K`L %`T,(#\#` @5g0 ,(#\#` @5Z0  l `L 2hH0f'   - `L %`TՐ,?# @'''`' - @@` t `L` %`T,(#\#`  ,(#\#`  æ -j  ϒO4-^ = ?  @-9  S?  @ @X d& h&X$  a   $H@  2 $ I'T$%`T`L ,(#\#` @40   `D`T2 x,(#\#`@4j0 `L UHSw ,    8 `    $ 0@  "@`# ,G> D  ?# #?,H /f * ' > "X`!H 0 2H /f * ' > ߔ 2H p@ """2,"'," , '(,> D  ( $" (ἒ`$'(#@``#@  @H #\8@H ,    8 `    $ 0@  "@` ,G  ?# ?,H /f * ' > "X`u!H 0 2H /f * ' > ߔ 2H p@ """2,"'," , '(,  (` # (  '(,    8 `    $ 0@  "@`C ,G  ?# C?,H /f * ' > "X` !H 0 2H /f * ' > ߔ 2H p@ """2,"'," , '(,` ( D#` (D@H'(# " +f  ˒@쳐 C  =㽸 L  0  @  8  ,P?H',E'  "  ` 'HLH @BܘD D@ /L L H % T40#\#`  H8@240#\#`  H8@2T  L L H L  H@ "@ ` 'HLH @BD PD 폔  L L  H@ "@  LH@C  L07 'HL  H@ "@ ` 'HLH @BhD !D@ 4 ? $ H". L L % T40#\#` 8@2640#\#` 8@2)ې "  L L $HE  L `, HL''#`#h '#\#d@EW,` 89L L % T40#\#` @1840#\#` x@1ژ8 L րHԐ#\8 @E,  뀞  H@ "@ ` 'H @AĘD }D@> 4 c* @?   \*  cL` `H "  ` 'H @AD OD> D@! L  H@ "@ ` 'H @A{D 4D` /7L  H@ "@ ` 'H @AcD D@@L  H@ "@ ` 'H @AJD D@'L  H@ "@ ` 'H @A3D D@@L  H@ "@ ` 'H @AD D@'L  H@ "@ ` 'H @AD D@@!L  H@ "@ ` 'H @@D D@`      ?L  H@ "@ ` 'H @@˘D D@  'L  H@ "@ ` 'H @@D jD@'` '>  H H *`" *  * ''L  H@ "@ ` 'H @@D ED@  (?L  H@ "@ ` 'H @@qD *D@'` '>  H H *`" *  * ''Ȑ? &L  H@ "@ `'H @@ID D6,`?@c *   *` '   's H(u B 0W (f ˒K.a !?# @''''(C 2@@ 鏤 !ؐ@ @ X d% h% X$ c, Ze,% T L 40#\#` @/840#\#` @/88 L Hw4    8 `    $ 0@  "@`# 4G> D  ?# #?4H /f * ' > "X\!H 0 2H /f * ' > ߔ 2H p@ """24"'4" 4 '04> D  0 $" 0ἒ`$'0#@``#@  @D#\@C%8# " 'U @袐 2  , L 0  @  8  , ''''F  "   ' @>ɘ 2z / L H % T#\#`  H@.`#\#`  H@.` @   L  H"   @ "@   ' @> 24 z  L   @ "@  @>  "'  @ "@  ' @>R 0 4 ? $ H ) L  % T#\#` @. `#\#` @.` Ð "  L L  H  L `  ''#\#`#h'#d@AB`  P'砐 - < 2  @.(  @    @ܐ ĔĀx0   \'g % T L #\#` @-`  x#\#`@-` :  L  H  #\P@A 㼸80@ '<L ,  '8'4'0',h'd'`'D'@'('F'  "   '`d` @=X\ 2\ /dL H $TLH#\#`  HP@-*LH#\#`  HP@- ϐ  dL  H" d  `@ "@   '`d` @=\ 2b\   L d  `@ "@  `d@=  "dH'`d  `@ "@   '`d` @<\ 21\ 4 ? $ H ".LL $TLH#\#` P@,LH#\#` P@, S " LL  H) L``` `D #\ d''#`#h< '#d@?ΖD`  "'8, 'D CL $TLH#\#` @,YP   LH#\#`@,IP  8L  HҰ #\ @@_#\ H @@WD  쀊 Gd  `@ "@   '` @<'\ w\ - HL $TLH#\#`  HP@+LH#\#`  HP@+   dL P H"u d  `@ "@   '` @;\ 2\ (ٔ L d  `@ "@  @̖@`  H '0* '@  6" tDx <` <    ` `  23 2 `  `2X  X`X@  B   B  Ā  @< "?  |Ĕ|}xܒ@Ő U "P˒䵐?" p#W D '4D@ ',@#> $TL  LH#\#` @*P   LH#\#`@*P c  L  H 84@>#\0#\,H@>' D "@K@ "E ?p" Ԁ 6"ݒ B.,` 8  0  @P' L ,  ' ''''F'  "   '  @:Z 2 /  L H $ T#\#`  H@*,#\#`  H@* ѐ    L 퀦 H"    @ "@   '  @: 2    L    @ "@   @:  " L' L G   @ "@   '  @9 2z /  L H $ T#\#`  H@)#\#`  H@) W    L s H"r    @ "@   '  @9 24 䑔  L    @ "@   @:  " '   @ "@  '  @9i 0'`4 ?`$ H ( L  $ T#\#` @)3 #\#` @)( ڐ  L  H  L `#\#` @?f : L  $ T#\#` @(  X2 x#\#`@(   L  H @=#\ P  <`2  L)  S L `  #\''#`#h'#d@<  䀢` P]'g '䀦 ,`    X`X 2   \ @D Ԑ  :%'䀢 '(&쀦 $ T L #\#` @(U  X2 x#\#`@(D   L  HԐ@=;#\ؐP@ Ȕ  L $   @ "@   $@8?  "$$' $   @ "@  ` ' $  @7 2 @ 4 ? $ H ". L L % T #\#` @'m #\#` @'`  "  L L  H#  L `  $''#`#h '#\#d@:`` 8' '  ަ`V$   @ "@  ` '  @7& > D@! $   @ "@  ` '  @7  w` /7$   @ "@  ` '  @6 ^@!@$   @ "@  ` '  @6ט D@'$   @ "@  ` '  @6 ,@!@$   @ "@  ` '  @6 @'$   @ "@  ` '  @6 @!@"$   @ "@  ` '  @6s @`      ?$   @ "@  ` '  @6S @  ($   @ "@  ` '  @68 @'` '>  H H *`" *  * ''$   @ "@  ` '  @6 @  ($   @ "@  ` '  @5 d@'` '>  H H *`" *  * ''$   @ "@  ` '  @5ј >@$ hZ H Z    h?x'p''h'l''t'  'p@3 `2-$   @ "@  ` '  @5 1$`7- /֒ ;@# ޳  > `2*?# @`'''s'  Đ@o @Xd%h% X $ ۖz   Œ' % T L ` #\#` @$`  `2 X`2 x #\#`@$  ` L  H` w     8 `    $ 0@  "@`#  G> D  ?# #? H /f * ' > "XQp!H 0 2H /f * ' > ߔ 2H p@ """2 "' "   ' > D   $" ἒ`$'#@``#@|  @9m#\8@8)    " @ ݐ   㽰 L  0  @  8  ,P?H'('$E',  "  ` 'HLH @4#D qD@ /L L H % T40#\#`  H8@#40#\#`  H8@#  L L H( L  H@ "@ ` 'HLH @3ޘD ,D ֔  L L  H@ "@  LH@4M  L0 'HL  H@ "@ ` 'HLH @3D D@ 4 ? $ H". L L % T40#\#` 8@#}40#\#` 8@#p" "  L L H  L, `  HL''#`#h '#\#d@6,` 8'( ',< L % T40#\#` @#)8  x40#\#`@#8ː( L AHY #\8 @7/, N ܿ(~LL  H@ "@ ` 'H @2D LD> D@! L  H@ "@ ` 'H @2D 1D` /7L  H@ "@ ` 'H @2˘D D@!@L  H@ "@ ` 'H @2D D@'L  H@ "@ ` 'H @2D D@!@L  H@ "@ ` 'H @2D D@'L  H@ "@ ` 'H @2kD D@!@!L  H@ "@ ` 'H @2RD D@`      ?L  H@ "@ ` 'H @23D D@  'L  H@ "@ ` 'H @2D gD@'` '>  H H *`" *  * ''L  H@ "@ ` 'H @1D BD@  DL  H@ "@ ` 'H @1٘D 'D@'`)'>  H H *`" *  * ''  H@ "@ `'H @1D DP,` /7  '_G0B#  ,@ҧ @ X d% h% X$ ڳ,  '$,% T L 40#\#` @!B8  2 X2 x40#\#`@!,8ސ L THRw(4    8 `    $ 0@  "@`# 4G> D  ?# #?4H /f * ' > "XM!H 0 2H /f * ' > ߔ 2H p@ """24"'4" 4 '04> D  0 $" 0ἒ`$'0#@``#@  @5(#\$8@4ɘ 4    8 `    $ 0@  "@` 4G  ?# ?4H /f * ' > "XM7!H 0 2H /f * ' > ߔ 2H p@ """24"'4" 4 '04`  0 #` 0 J'04    8 `    $ 0@  "@`C 4G  ?# C?4H /f * ' > "XLВ!H 0 2H /f * ' > ߔ 2H p@ """24"'4" 4 '04` 0 D#` 0D@5'0 "و@   u 8 0  @ ' L  , ''''F  "   ' @/ 2z / L H % T#\#`  H@w`#\#`  H@j`    L C H"B   @ "@   ' @/_ 24 V  L   @ "@  @/͔  "'  @ "@  ' @/. ɐ0 4 ? $ H ) L  % T#\#` @ `#\#` @`  "  L L ƀ HŰ  L `  #\''#`#h'#d@2` r| ' 8 L  % T#\#` @`  x#\#`@` N  L v Ht#\ @28 j B <   Ā  @ 2  2Ԑ 9 @! 0ײ װ 8' % T L #\#` @A`  x#\#`@3`   L  H  #\@2G8 ` L  0  @  8 ,'L','(''EX  "   '(,( @.$ $ - H L & T#\#`  H@#\#`  H@Ԛ   , L ˀ H" ,  (@ "@   '(,( @-ɘ$ U$  L ,  (@ "@  (,@.6  0:'(",  (@ "@   '(,( @-$ "$        (@ "@  '(,( @-v$ $:  ' L ` > < % %%4쀢@4' L `#\#`  @3 4 L & T#\#` @'Ԡ#\#` @'Ԁ'Ð  L  H"; ؒ @2 4  L'    @L@M &L:  L & T#\#` @֘'Ԁ  X#\#`@Ƙ'}'ؒ    j0''А8'''''' '0?@'L'4'8'<'H'P'T`'  'L `̔ >`@ "   L0 '  L AH1 ؒ  " LҒ  L & TԔ#\#` @X  XԔ#\ؘ#`@H   L @ H"r Ԕ@1@ 0j  & T  X``Ԕ#\ؘ#`@ ʐrؔ@1    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XH!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' " '  f    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XH;!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '> D!> D     0e'@ ' '耥@ '` @ "` ` "`  2 Z & T L Ԕ#\#` @  X @@Ԕ#\ؘ#`@ܖ   L Ԁ HҀpؔ@/    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XGb!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' " '      i 82f`   $ 0   "Z@   ?$T@ p &@@$ H /f * ' > "XF!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HF!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @> D!&@u`@ p &@@$ H /f * ' > "XF{!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HFF!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`@ p &@@$ H /f * ' > "XF!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HEӒ!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @@&@`@ p &@@$ H /f * ' > "XE!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HE_!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@``> ߰#̀@ n &@@$ H /f * ' > "XE!H 0  4 H /f * '   6 H p@  $ $$ 4 H /f * ' > #HD!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @@&$@@@.@?`@ p &@@$ H /f * ' > "XD!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HD^!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @v&@`@ p &@@$ H /f * ' > "XD!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HC!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @&@`` ' ?'  @  ` ꀥ `  ?" @`쀧@ @'Б @ p &@@$ H /f * ' > "XC!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HCL!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @> Da&@`@ o &@@$ H /f * ' > "XC !H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 H /f * ' > #HBג!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  $ $  @ > D!&@> D&@ `@  &@$  &@@$ 9 6 h0' L@ 8,'L?@'''E0  "   '@D@ @%< w< - HL %T,(#\#`  H0@ ,(#\#`  H0@  3  DL f H"= D  @@ "@   '@D@ @%v< 2<m L D  @@ "@  @D@%  0'@D  @@ "@  '@D@ @%F< 0<  L   ' @  < % %%4@4'L `#\#`  $@+U 1'L %T,(#\#` @0'ؠ,(#\#` @ޘ0'؀ ' L À H  $H yL  $ @   @ L #L $L %T,(#\#` @0'ؠ,(#\#` X@0'w'ܒ $  ? ''Ԗ,(0'''' '?'$' ''' '(',`'  ڒ 'L$}`И $ H$L$ bL` "  " >  $ "    L %Tؔ#\#` @0 ؔ#\#` X@#  Ր L  H ܒ@)Hٰ "$%Tؔ#\#` h@ ܐؒ@(H,    8 `    $ 0@  "@` ,G> D  ?# ?,H /f * ' > "X@!H 0 2H /f * ' > ߔ 2H p@ """2,"'," , '(,> D  (" (> D'(        0A''$    '䀥  '`   "  "  h''耦 %TL ؔ#\#` @0 ؔ#\#`@#  Ր L  H" ؐ@(H,    8 `    $ 0@  "@` ,G   ?# ?,H /f * ' > "X?!H 0 2H /f * ' > ߔ 2H p@ """2,"'," , '(, (" ('(  ,`  ( `8` ``$`0 `  "@ `  ?$@@J G> ߸#`4 /$ X  " '` "@Ý Xd"h" X $   L ˢ˞` t`  ' '쀢 '@( |> Da ''x''p @ o't,@(` &@@$` H /f * ' > bX>ג!H 0` 4`H /f * '   7 H p@ `$`$@$`4`H /f * ' > H>!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ n,@(` &@@$` H /f * ' > bX>e!H 0` 4`H /f * '   7 H p@ `$`$@$`4`H /f * ' > H>2!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ n,@(` &@@$` H /f * ' > bX=!H 0` 4`H /f * '   7 H p@ `$`$@$`4`H /f * ' > H=!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`@ n,@(` &@@$` H /f * ' > bX=!H 0` 4`H /f * '   7 H p@ `$`$@$`4`H /f * ' > H=O!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @&@`p> ߪ#̀@ n,@(` &@@$` H /f * ' > bX= !H 0` 4`H /f * ' ` 5`H p@ `$`$@$`4`H /f * ' > H<ג!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @@&$@@ $> .@?`> ߪ#̦ @ n,@(` &@@$` H /f * ' > bX<~!H 0` 4`H /f * ' ` 5`H p@ `$`$@$`4`H /f * ' > H "X;!H 0` 4`H /f * ' > ߔ 2H p@ `$`$@$`4`H /f * ' > #H;!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @> D&@`@ o,@(` &@@$` H /f * ' > "X;x!H 0` 4`H /f * ' > ߔ 2H p@ `$`$@$`4`H /f * ' > #H;C!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8`  `0  $` %`` @ > D!&@> D&@,@ `@ `&@$` (` &@@$`   hL0 @8,'E'  "  ` ' @.쀢 v@ - HL $Tܒ#\#`  H@ܒ#\#`  H@    L E H"D   @ "@  ` ' @쀢 1  L   @ "@  @W  0'  @ "@ $  ' @쀢 V0LА `#\#` Ԗ@# 6L $Tܢؔ#\#` @ ܢؔ#\#` @ s % " #\L ŀ Hİ #\  @!8 Ԗ  Ԗ䒔 8Ԗ ƛԀ $TL ܢؔ#\#` @ 5ܢؔ#\#` @ ( ڐ " #\L z H"y #\@!= 2n     8 `    $ 0@  "@` G>   ?# ?ܑH /f * ' > "X9!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '>  \ؒ`" \ '#@ #`  L0 @X8,'E'  "  ` ' @ `@ - HL $T#\#`  H@ m #\#`  H@ `    L u H"j   @ "@  ` ' @U  L L   @ "@  @”  ؐ08'L `#\#` @"j 3L $T#\#` @  #\#` @    L  H @  `X ` ⃔" $TL `#\#` @  `  X```4#\#`@   Y `L  H`@  2     8 `  4`    $ 0@  "@@  G`  ?#@?H /f * ' > "X8&!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '``  4 `"`  4 `+':  @ $$ : @ $ $   ;`@ݕ; $ $ $ $ $ $ ($ $$ 0 $ ,$$  $ $ $  L  0  @X 8 ,'TE'P  "  ` 'PTP @L `L@ - H L & T<8#\#`  H@@ <8#\#`  H@@ Y  T L vH" T  P@ "@  ` 'PTP @L L œ  L 0T  P@ "@  PT@   ߰'P L0 `#\#` 4@  3 L & T<8#\#` @ F@<8#\#` @ 9@ L  H @2 4Ҩ q4& T<8#\#`  @ @@<    8 `    $ 0@  "@`/ <G   ?# /? "X6!H 0 2H /f * ' > ߔ 2H p@ """2<"'<" < '8< 8 0" 8``0'8R   "?  #`,#` #`#`#` #`(#@#`#`#`#`#`$㾸L0 @X8,'TE'P  "  ` 'PTP @L `L@ - HL $T<8#\#`  H@@ S<8#\#`  H@@ F   TL u H"< T  P@ "@  ` 'PTP @;L L 2 L 0T  P@ "@  PT@  0 'PL0 `#\#` 4@P 34L $T<8#\#` @@<8#\#` @٘@  L  H @Ҕɰ  , 4 (  4 $ 4  4 Y4 $TL <8#\#` @@<8#\#` p@@ 7 L  H@~ 2t <    8 `    $ 0@  "@` <G> D  ?# ? "X5 !H 0 2H /f * ' > ߔ 2H p@ """2<"'<" < '8<> D > D8`" 8, '8"(" "a!$"" "㿀 L! ,  & T#\#` @ `#\#` @ޘ`   L 2 H 㿀 T ,  L & T L  #\#` @ `#\#` @` _  L 2 H 8`2 < X <`"  @ <    2 @&  @  @l  `   @" 㿘`$P P TX P R $\  2H /f * ' > "X4 !H 0)>  2H /f * ' > ߔ$ 2$H p@ """2 "  " f  H /f * ' "X3Ȓ!H 0 "   4 H /f * ' > ߔ" 2"H p@  $ $$ 4   $  ** 2 "  vH /f * ' "X3!H 0 2H /f * ' > ߔ$ 2$H p@ """2 " "   7 \ O 90-`ې (H /` * !  &8`$ #>>   6*cŘ `"8 2 ``<@  2 8`>   48H 00H 0`A>  *@ 44z4z4T  ࠖ!ऀ * ! !ऀ *  * " >:# `"C H /f * ' > "X2!H 0  4 H /f * ' > ߔ$ 2$H p@  $ $$ 4   "@ ?$ c  R `2CࠑH /f * ' > "X2z!H 0 "   4 H /f * ' > ߔ$ 2$H p@  $ $$ 4   " $  ֔ !a* *`  #> `> Dx @!@4@*4x* $l$$$x$t$p$$$$| $ ?4H p@@/㿘 %> @( #>?  cȖ  ؒ  > #`" `2@`$ @"`$@`2` 㿘 P & P ΐ㿘$ "Ð D P 2 ? @&$ : &$\ R    " V` @? `  !> c 9є$  @  &$>` 9Ĕ ? # 2 `> "&"@  T "  P@1 9   $`@Z 0- P`@%> >! 沒   ``$` `   ?? " @5 0 $ @2 @.  s}x ̖А  ''?''''''آȲ @'Ȑ   z #   # $  #"'Ȁ 耢    " >`   9:  w *@  ! ' > >`Pp 9$ b ' @'Ȑ  < #"'Ȁ "'Ȁ?"'Ȁ L耢H>  ` ̘ " 9 > !'''آĀ !Ā Ȓ 'Ȑ Ā` #   # $ = #耦 "Ȁ  >:  " " '̀ G E?D }  & > `8  @1 g " 0*2. ,    А"@'''̤آ'Ȑ  # $ 倦 #"'" '̀ 9&@ 㿀> >!@8  @^  @V  ? #\ P2 8$` "  '쀣`' '  @Q䀢 ~$> D!  !(`~%!($> #`> >1> 4#x!` 2@` 2@> 4$` $`0耢`]$`> >ct * * " `4* " `4*` ` dl|` *`l |  :    : *`l |  :    >  H `4*` ?*  `4*` ?*   H d  h` $ (`$ "`8"@ #t`  ?"@$#t4`$< @@@j $$`$ ?$`$$`$ !`4* `*` l `8: #@  `# `4* `*| :`#@@ " $`2Z` ` @!$`~%%!$ $2 $  >7  @'D X !'H'L'X @ L$<H$4D    $$  @' $+'ܐ 'Ԫ@f   Ԕ@" "#\#`@"* "~ }H0 W     *  '#lH#\#d#p#h#`ܖL@ ڐ܀` Y  T <L``"8`$"  ?ܐ" 4 ?"   ?`$$  }ǔ "   $ ? "@L$̓*`$ '/> ->   e h$(> 4 $,`$8 $$$$> >!a$  "aH /` * ! `$$""`H P ? T  (  @2H 0  \ @ے  P `  }Ð= \`@  $ @  !% $` $$H 0 ?$8  H /` * ! `""`" "H $` $$ ?% 2 $ > <`@ ' '   "    'ĖȒĔ @ 2> D!@ "> Da2 -$> D! 2 2  PА|{"@|x  |s$ ` #\@!İ  `Ȓ` Đ " 6   @/Ā 0.'  Ē@ "@ $ 'ĐȒĔ @  k  Ē@ "@ $'ĐȒĔ @{ |0W A"& #" F|H H@.`7> #> ܔ`  H@ > 4"ΐ`` F2JD" X"@\"@` " {Ԑ  X"@\"`"{x 0 { +{o 㿈\H /f * ' > "X,!H 0`")>  4`H /f * ' > ߔ 2H p@ `$ $`4`$@$`$`$` > #<  &H /f * ' > #H,|!$`$H 0`$(` $`4`$`0$`($`,$`<$`8> #@@ $ $` `> D`X & &I > D> D!&   > Da.& &` ??$` > D! & & &!&`L @ `@ *  L > D`@2`<     @ ꀦp> Dl?'p '&&& `  `8` ``$`0 `  "  B `  ?$@ 4; H /f * ' "X+֒!H 0 2H /f * ' > ߔ 2H p@ """2 $@$   $  & &&& &J KHst Ljn & &  8` $0   " B   ?$ 4; H /f * ' "X+Y!H 0 2H /f * ' > ߔ 2H p@ """2$ $   $   & &n  k& h&f&  8` $0   " B   ?$ 4; H /f * ' "X*!H 0 2H /f * ' > ߔ 2H p@ """2$ $   $  @&&`'@%@` "> >aa "a 㿘H /` * ! > # )> > >!   $ 2 <@ " 8 $ $ $ ; $ 8h2"d 4> 4!*` d *l@ |  :    : *l@ |  :   ` > 4"*   8 `4 $`$ $  ,@$  (> <`@ $` $ $ , (@& T  $  $`r$ $ ` dl$ , di$ ,P`e?$ 8`|`"@``" 4  `V (   $  @6J 沔 y  "A  `    @     `@  )?' #"&\ "!4`8  $`"` ,  $ $ d$ , d$ ,:  $!$ਐ $$ $!$$ 8 2#  H H H: 0(@(b2*@ *@ b 2`* @ *`B*2< *> @ B  H`"@8 `8@ 2 HH 0> D!`"`$" @" 쀢` *@!(  㿘 `  `@`<*  !)  @@!@'>`͔  & ͘ !2>   *`@@2`@@& 㿘@@*@>0!  & *&㿘  *`@! '>  < "  $`0 a2>   *`@2  $ 㿘@*@>0!@ & *&I㿘> 4b4  "b4l > ߦ#  "^H /f * ' > "X(!H 0` 4`H /f * '  4H p@ `$`$@$`4` (+$` H /f * ' > #H(l!$`$H 0`$ (` $`4`$`0$`($`,$`<$`8$` 2 `> 4b8  "b8 e w+&P`0`@`,''   " ' ( ' (@ n > D$`X 0   "    ' @ Q $`T$`L> D!@  I> D!@  J  K`2 $`L`$`D `8 L`L ` L2 `D> 5`* @$`D!`L> Da ? $`L    "    @ } 04'  @ "@   ' @  `@ P $`$`$` g  *` "    ' @   `4*"`4 *`:  4`@`!2 '   "  ' @  0> Da   x ?  ``&`&` 'v  H   Ж`!?''''Ԁ 'ܔ@   @ "@  ' @ > }Ḁ  >0V!P`  @ "@ ` ' @  Z  >08!h`a   &a`L`@$`L` &` >0#!v`  @ "@  ' @  %Ḁ  >/!Q`  @ "@  ' @ Ø u_0P' @''` *   L``5> `2``< ``    @M` 뀦` >  H`h@  `l@ ``pĀ@ `&`h` $`D$`T @``L  $`L  $`D$`T  $`0$`@㿘 " /2>a/J/: h`0`V H'`$ 沐`p&`0沒 "'̖А'Ԕؘ >̖ #Ѐ 2` ##`0%   "`8" $&`&`8 "&`  2&` @L :`0 5&`0 2&`0沨"ԤآР̐ '̒' Ѐ`Ԁ " `( "&`$" &`("   `#2`0Ѐ ِ  `$ `0 @㿐 0 " >-^!$ 0 < G 8 $ 0       `?& &      *   `?& &   8* ?$ 8$ < 0  0 ?$ 0 < !@ G 0 8   $ $ $ <@$ 89   /  @ "@ t $  < "@&  < ""@&  < 0 #  $ <@Ւ 8$ "$ 8$ < 0 ?$ 0 ,  ,@@ 2@"@ 0 "d < (` ,"`$ $ ,$ ,X$ (㿐& 0 "6 7 $`'0 7` & $"`& (R`   @'$@   Р ($ <$ ,$ 0  $ @d &&a s2 㿘 0 #> #" 0>  ? `",a D `& D" 0 2 0>  & 0`"㿘> 4b> D 4x > D"a> D!"!"`㿈 <  > Dw >,     > D X ax2  > D a*  p'> >> D! X @2e   D 2`       8@  "T   2ΐ  ` ,  "` "@$$ "@$   >+"2 a,  ($a, a4 $a4 #\#` $    a4 $a4  s & a0  $a0,    ,  , P0 2 X> 4"8#> Da|` "8 4  @$ a|  $a|, %> D> D!  " #> ,  b  A      ,  `"  "`   "@`"  "`"  " " rm   @"T H /f * '  > R c̒`*@ ?2@  `  {   `"'  8 ` <"<  8 <"`8> $$#H ( "4,$0 $   2  "0 > @"X'$ H 0  , $$ "@" ,  X$  8  `  ,  $ 沐 @,  8 r $  F4  Xax2  ! * ` $  X 2  * "`  Xax2`@! @ *`"  X2  * $  ,  ,  ] 㿘 < h X> Dax2  > D a*  [> 4"> 4> 5c p#> X @2M   D 2H       8@   "<    b ,    >  X  , `,  D*  `"  L 2  * ` T $ 沒 r! $ `,    ,  ,  0 2 X㿘> D!"> D!` "`  "@`"`$`"@  4 2> D"!|㿘H /f * ' > "X"8!H 0  6 H /f * ' > ߔ 2H p@  & && 6 (& H /f * ' > #H"!& $H 0 $ (  & 6 & 0& (& ,& <& 8 & &㿐  ?'D'L'`hpH /f * ' > "X!Β!H 0"7>  4H /f * ' > ߔ 2H p@ $ $4$$$$ `( & ۑH /f * ' > #H!!$$H 0$( $4$0$($,$< $8 " @$ $$ `  ` `8` `$`0 " ? %@ 4; H /f * ' X!E!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 $$  > 4cx  $ ` !> 4#|  (b $#|'%#x!> D-> D('b!> D-> Dt `&#x %#x#xa&$@!`$@`$@`$@``  $@``L$@L> 5 p* $@`􀦠$`$@8   8 ` $0   " K   ?$B $@ H /f * ' X !H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4  ($>(T"H$  $ $@@`$@D`` $@D`? $@?`$@`,  $@`> ߨ#  8`" $0  @   ?2_H /f * ' X !H 0  4 H /f * '   5 H p@  $ $$ 4 (&$H /f * ' > #H!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8`" $0  @"   ?$8  &$ @c "$ $ ,? $   8` $0   " B   ?$ 4; H /f * ' Xi!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 $$   $ `\ $@\$`> ߨ#  8`" $0  @   ?2_H /f * ' X!H 0  4 H /f * '   5 H p@  $ $$ 4 (&$H /f * ' > #Hϒ!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8`" $0  @"   ?$8  &$ c\ " $,? $ $`$@ d$%`l%`"㿘  "@ "P ` $] @`2`W @@`*0"L H "@` `ɔ`` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @ݖ&㿘  >%"X`? ?"ͪ > ߬#     8`"   $ 0   @"   ?$x H /f * ' > "X!H 0  4 H /f * '  5H p@  $ $$ 4 `"&$ H /f * ' > #H!$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %@      8 `"   $ 0   @"   ?$          ˒  $  <`  B#$> & M&"`"7"`$k     8`   $ 0   " E   ?$< $: H /f * ' > "X!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 $ %@  @*@` $ &  &' 㿘 & &@&@'@o l H>$~"xH /f * ' > "X!H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4 $ $"$  '@&@  " H    ' @"$ $ @ 40$ & &@   "   H &" "@㿘      8 ` $0   "  ?$ ?@"@ ` $   < &$ > ߪ#̑H /f * ' > "Xْ!H 0 4H /f * ' ` 5`H p@ $$$4(&H /f * ' > #H!$$H 0$ ( $4$0$($,$<$8  0  $ $  "@ `?$      ?"@ @&$ |&  &@ 㿘> `> D?a > D > D > D!> D"3> >%> D'> D)> D+> D-> D/> D1> D#> D$!# #a&ct$$%!%a%%&!$a d@+ !> D $!$!@ ѐ !> {> #"#"`!>o cpy㿘> D" >  L"? 6"c"c["  㿈 DX@!  b"  T C쀢 ` @> 4`' ``+`D*``*'`H  %'@> 4 cȑ* @`< > (#x2`  ``4'`8*`" *  * ''􀦠2<" <'$<> D"$8<? > D"pX$8g > $ $$ $8$;$&$$(( /6 & D`& ,& 0X`d-& ` "6 `  & ` & ``     @ > & ``       > H`8& `<& $`@& (`L& 4`P> P& 8.& @` 6 ` & `& ` > `& ` : 2* @* > H`(& `,& $`0*`" *  * & (& (& @`< & 4& 8`@ > P& <  2 @!>  2   8 2   @( >  < @Rw > <>  H$I `$!"&$&(" &,&0 㿘 > `  X!H`#H`@Ӑ" < 2` 2      > >a`  E"`a`( "a ` 2`( `@!`( 2 `  8 `2  ` @( `<  <`` @R <`ؔ ``$!"`&`$`&`(`" `&`,`&`0 㿈\$`  $R$ @  @@"@ $ "| H "K  /2 n `@$  ,@ @`'@ ?",@& & 2Q  $@$ #\$ h0 #`@ 2> `<  4  `$$ # !$ d$ k 2   @@`  ~w  $@d$   䁒     +" ' (0! , " "   ( #2" 㿘\`@c@    8`   $ 0   " C   ?$ 4< H /f * ' > "Xm!H 0 2H /f * ' > ߔ 2H p@ """2$  $  > Da $ #@r    8`   $ 0   " C   ?$ 4< H /f * ' > "X !H 0 2H /f4 * ' > ߔ 2H p@ """2$  $  > Da $ #@` #@#`,`#@0#`4`#@8#`$@'@@㿘`c    8`   $ 0   " C   ?$ 4< H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2$  $  > Da $ "f`    8`   $ 0   "W C   ?$ W4< H /f * ' > "X,!H 0 2H /f * ' > ߔ 2H p@ """2$  $  > Da X$ "@`X&'㿘V`&`& ` & L 0> 4@* &`? /&`&`&`H&`L& `F&$`D 3`  &(&,`&4&0`&8`$&<`(&@`,&D`0&H`4&L`8E&P@> 4c* @&@`2> (> (#` *`# ` &`&` &@ ?`D&`H*2 @ & `&$`&(`$&,`(?"&0@#&0`,&4`0?"&8@x#&8`4&<`8?"&@@o#&@㿐> "\&`ː 2 a F`0 2X `   O` ` 2`c R`` h`+0"11  d ` &`&R 66     "R   6   $$` K      @  H( ``X2 `p `d00 0`2`XH  L`S D> 5(R   P?# @ > 5؆  ( * " **  㿘@ P &@  &` &` 6` V 6 V` `   " V V` Ð`㿘`>  X !H`@R" < 2!!!!`     㿘@;  @27@>"!   8 ̀@8 Ā 2  2 &  & &  @& &  h Q & @2< #> @2 &  &@2" @> `@ڒ  Ē!bz  ?2    2 Z@  ` "`  "@`"`& "@ M 32G  #" 㾘 @#!: i> c "@ '> #>#㈒`$# bȖ $ #`@ K N!6`  G D'''''ѐ <@ " X a쀦 1 @ @' $ `@ 7`ɔ    `'Y    0" 0`, `00@ 0" 0`, ဦ `0݀ ` | @ À   `0 "@@ *  L    @2  <      ڒ  逤  > 5#P`@ 6 `0 $`@ | 3ݯ `0  c 3~@ ` `"  "`   "@` "`$`  "  b   $  PT $` 4 $ $ l> $ lpx$ p H xt  $ h < "$  `   $ ` $ 沐 $ Ḕ`< c $ $` $ ` "@$` @% *  L` $ @ *  L "` @ * " L@ *  L@$ Ḑƒ``L @"`L@ " `"` $`@ ? 㿘(` R`   > D!0`"T@b ڰ T@  !!xe "T@a0ɀ 2B` H /f * ' > "X!H 0 2H /f * ' > ߔ$ 2$H p@ """2 "@ ?" ctV ` `2E`xR 2A`xH /f * ' > "X!H 0 2H /f * ' > ߔ$ 2$H p@ """2 " "  t `x4`z`  ?4`x4`4`  2U!@ؒ!$  $ $> $ "@"$ $   $ $ H /` * ! >t!$`$` $ 0H 0 㿐'L'H'   H /`   L Q`?"`* ! L  4!&@!L%!%> % "@"> 5cX "cXL`  #``, 2 @L  2  #> #`!> 5%> #T`% $#T!ؖ  #T $#T c " 2 > #`> #0 ` 2D  $0$D% 2 c ?$c " 0 W  @ ?4$0 S듔 胐ѐ!>  HH:`, 4` ,`@c3`+  +` b 2* *> @`H`C!> 3`+  H  +`<B  H`" @ 8  2 ` 8      %  0   "  'H 0 `  `V@4􀢠E> `H "\`H`"``< ""`8  # ?%  8`& &\!&d`  2 h!! 2 H | ޴  첔   ?%  "`D "T > >!>  HH.< 9􀥠2 ! D`> 4> 4!` !:  D<*` ! !`'!  < " _!> > D!ę+   $ " , +> 4   !@  >" >|"$ `:$  ``"  8 `  $"   ?ܐ" 4  ?"     " " _  "    "   $   "@ 0   < m_4 b0 @T <`"X ,H /f * ' > <cR `*@ ?2@ <`  h  < `* 8 ` <"<`<8<" 8> $#H( "4,$0ۛ$`< ?2`<" 0> <"XH 0 ,  ^ @ 滐 ?2!o @VH /`* !u > 4"0`@͔ ^`,^`< > N '> `H`H: 0(@(b2*@ *@ b 2`* @ *``B2*`*;@ B H / 4H* !H` @   2 `    H 0vH /` * ! ꐔ "Y   % @% Q L?"`"  "`> "# "@H ֒ 4> 5cX&? "cX@ѐ 㿘 0  ? & 0 0 $ 0&    p3" P `PH /f * '  > R c̒`*@ ?2@  `  g   `"'>  8 ` <"<  8 <"`8> $#H ( "4,$0 v$   2  "0>  x"XH 0] ] $  ! ` "`   "@` "`&  " ] B 3`2 H /`4 H* ! H  "$$$ $$ "@ %  2 & HH 0㿘 D? & D 0 `"  "`> "# "@ 2㿘> # " >9"$㜀 #> +> /> )> D-> Dc c 0 ` "`$ "@Ԓ 2 2 0c$c$ 㜐 `$㜐 $c" %c㐐 ?%㐔  2!%!@~!!Đ`"` "` c "c" $ !Ġc$c" !  2%@e!Ȑ" "" " "@$ > {* (      2 L@" D@ @ D ` 82 ` `> HH \"*  `( ` H(`"@ ( ` ` `!   !!㿘> D!̪`?      ̓+  2  > 6 *" H `` "H %``, '> @S'> 㤀 e㤀 c`> D" %>! $@  㤀`R ! N㤀`"``"`" ``"@`0 :?!`\H o *@ e  p    0 2  0 $ 0   0 @$ 0 \`t "`tH 0a 2`\㤀`2` `cH?%`"&cH㿘> Xb 㿘> D!̔  > 5, `2  ,  )\  8 " "\#>!>b   #? b  > D!̑, @  n      , 0\ 6"\㿘\@ %#>>  @&*  cF `<6 F@"> *@&  y!&!& & &  &  &  2 2 ;>5>  * c( `<@ `  *@& P "   *@&' ̐ `$ * @ & *@&Đ 㿈`4`> #8 C@*  耧`> `2``> `h H 6@> ``"`& `@"@'@ '` "@&     "`t & &" '`l`H`H   `H  `p` ``H'`l`'`p`'`p`l '`p'' '' x @'\ '   "  ` ' ܀ ܢZ~@> `'@ '`H@, a,n> 5#P ܀ 6   & ܐ | 3Ջ `"  "`  "@`"`& "@&`&Hx&h &l&t&p& & "@& `@7 C*  耢` &`@. C*  "` `@& C* " `@  C*  &     " &  '   Z5''@p L "'   5 @> >@> >a` "`  D Ж' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X !H 0 2H /f * ' > ߔ 2H p@ """2 >p#x"'" '? @" ' R`#  "  Ru Q찒 nYS0.`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "X 7!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  ' H #\#`  ʚ谒 " .#'  @ "@  ' "ܖ 9  ؖ  -؀ 耢 X_䀤` `  " 30   4''  4ܖ X 0b&@ 8 8&`"&`      @ + 3`  &`        @ + 3`  &`      @ aC 3` +  &`c &`$  &`&`&` &`&`&`&`D@ `T Z` ZLa X `D`@? X%-֐p> >a` "`  Dߐ`R``  ?'𖊠   `8  ``$`0 `  " ``  ?$@~`4|`     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "XȒ!H 0 2H /f * ' > ߔ 2H p@ """2 >#x"'" '? " `@'R#@` #?` R S b Wd0#\#`  D찒 t .'  @ "@` ' 래 $@   ܒ= 쀦 M  @ "@/$0 ' 0| W 08@a >$  $$@a >$ $$@c <$: $$ $V> > H`;" <"HА@N!(e>c? >#> c@!> @#>#:> `$&& `$  "$"$" `p# >#@kH /f4> `* '> `a> )a( %> n>x#?> ; l>`   2+>> `(@.@ɒl^l "`<l?"@l$$ `@N >Ӑ 0 *2 @> Xʒ|$Ɛ h$$$  8> ? >' <@"<@ X    j'''''' U  @   o$ @Җ > 㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, +#> %> D@` @ܐ & d@` d@6``@& d@˒* "@ d*` @* "@*`& d` " ``0  d& h d& h`"`  ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P "   T 2 %>#>  !>`bܒ !  ѹ  &  &$ &( d&, h&0 &4 &8 &@!&H!&L!&P!&T8 I  2p   H> ? a K X4 * W'> 5c\ 6 < "c\  <@@!쀢` D @ b '!Lv9 @4  2.@ Y 2$ Z$@@א Y 2$@@ʐ@u  2 '@㿘`<@@ T3_  %!@!&a$``$`> `> D@*$`    $`h$`$`$`$`$`$`$`d`$`$`$`    < $`L4a4a4a4a`` ` ``@ `W Z`S ZaLN X$``  `$`X$`Tʒ &`L  Њ SԐ㿘!6`  `$%> #> ܔa p  `  *@$d @$АS `$ S  㿐!`L`  `&@㿘 ` $ X2` 2 d p `   2 d 2 X -㿘`(7   $ -002!L&* !K!L&$ !> >!!L  aL  !ϔ!LK > 5#\# ?     - -iLiTiTiiTiT㿀 ْ #\#`   .RpX  b<  `<    ` `> >a`P "`P  H័R``  ?'𖊠   `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 > B!0"'" '? @" 'R`#  " R S " R$0    8 `    $ 0@  "@` G`   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '`  "`   ' <@  2 @2  #2 @2 # #\#`  Ӌ찒 I .'  @ "@ '  Q 0.   ܒ灔 쀦   @ "@  '   2 QV0@W8 `<  ``> ʐ!@d    ! "  $!@ "@  " ! "  $!@ "@    Ә  ": @:t$ `< 2   <    (#$    " Ā@"$ `< 2   <       @:B$ $  㿘   < #    X!@     @Tm   4    v $   ? 4  x X!  ` "3  ϐ > >H a`D "`D  D ^'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$}S 4{S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "XD!H 0 2H /f * ' > ߔ 2H p@ """2 >!0"'" '? " 'R"@` #?RKu   "n O0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "Xƒ!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  '   #\#` [찒  .   'j O[ 0OX㿘` `  @? - ? ?2X $?2 X ,?2 X ?#@" X <`y  ? ?"F ,<?`#>!`*` €e  ,?? $?? ?#@ ??2 ? ??N ?5< X <`F  ` ` ` }  6   <@@8e<`?2< $?"`<  ``  }  2` `` @  ?2< ?<@88<@p X> >!H  "Hb  D`  < k`' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "XQ!H 0 2H /f * ' > ߔ 2H p@ """2 > !0"'" '? "  @'R #? RWu`  n`M0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "XҒ!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #   ' `8?`#@l    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "Xb!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D %> D`" ἐ ' `i     8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  `" ᴐ ' `?k    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  " ἒ`' `g     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X$!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  ' ` ?k    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  " ἒ`' ` g     8 `    $ 0@  "@` G   ?# ?H /f * ' > "XR!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  ' `?`?"o     8 `    $ 0@  "@`  G> D  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  # a ' ` `f    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xy!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  ' `$>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X !H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  ' `$ `(     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X:!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  ' `,>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "XΒ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  ' `, `0     8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xc!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '     8 `    $ 0@  "@` G?  ?# ?H /f * ' > "X0!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '? c " ` '> D! <`> (> (#@ *`#  $`?2$ > D!$ ` ?2$ > D!$ `$ `$$ `(?"$ @zƒ#$ `,$ `0?"$ @z#$ #\#` ȓ c .`Q  @ "@ '  G> D!   @ "@  ' ј .'  @ "@ ' ڼ    [ܖ   'ؒPؖ FA 0F>    X! @  & X <`" <? °  <   'xs6 :  8> >T =  2'&T    @ > >! `"   ($ tH&> >a`  `L "`L"` `` ? $ H ԗ `' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X}!H 0 2H /f * ' > ߔ 2H p@ """2 >7!0"'" '? @" ' R`#@` "  Rs`  l`0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "X!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  '  `D' ?`  ?`  `  8      $ 0@  "@   ?#|4z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "Xf!H 0 2H /f * ' > ߔ 2H p@ """2 > !0"'"  '? @# '#@` "n   "D  #\#`   .n . ''|  @ "@` ' ; .@   ڐ| "|CD `!   @ "@` '  @  @C H"    "  @  '   vxs qR`2  X`@~ 2 XCx 0ux qx`F 't  @ "@` ' ׺ @   tY t'p  @ "@` ' ט @  7p  0} 'l-l ul&C ($R`2  X`@~z 2 X ux xB0 `F'h  @ "@` ' H ;@   h /h'd  @ "@` ' & @  Őd  d '`غ` B % `  "($@"& x 2 &x\"pd&B ""     X`< ?  ($㿘 `< 2    n) 㿘 `< 2    n pX> >!T "Tb  D  'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >!0"'" '? " @'R#@` #? Ru` ց "n`A0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "Xg!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  'x `#\#`  찒 " R . "'  @ "@` ' R 5@   ܒ )쀦 )  @ "@` ' 0 @@ǰ H0 c @ 0@pX   =`B "`8 @04@ H00@ 0,`*> ߬#> >a`X "`X@ , P L'R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@$|S 4zS      8  `    $ 0@  "@ M?  ?#D?AH /f * ' > "X0!H 0 2H /f * '  5H p@ """2 >!0"'" '? @" 'R`#@` #? R8t  ͐ m?ϐ0e`  `8`"``$`0` ` @"  F `  ?$@ >H /f * ' > "X!H 0 2H /f * '  5H p@ """2"'"  '   #  '~     8 `    $ 0@  "@`  E  ?# =H /f * ' > "XK!H 0 2H /f * '  5H p@ """2"'"  ' ` "   '#@ #`#` #@`#`#@! #\#` ֚찒 "| .9'  @ "@` ' . 5@   ܒΔ *܀    @ "@` '    ` 'ؐؒԭ    @ "@` '  @쀤  $ >{%@ 2   ` ` `> >hX !'P&` `> B 'L'Ԁ'Ѐ` ̰  >G Ѐ> ߮#5> > >a`\ "`\   ?` 4 X `'R`   ?`  ` 8 "$0  @" $S   ?$$xS 4vS      8  `    $ 0@  "@ L?  ?#C?@H /f * ' Xޒ!H 0 2H /f * '  5H p@ """2 >!0"'" '? @" 'R`$ #?qR༐ ~ m=.  8`"$0  @"  E   ?$ =H /f * ' Xc!H 0 2H /f * '  5H p@ """2"'"  '   #  '|v`o    8 `    $ 0@  "@` D   ?# <H /f * ' X!H 0 2H /f * '  5H p@ """2"'"  ' " `' $` $  $L @$ i$    8 `    $ 0@  "@` D   ?# <H /f * ' X퍒!H 0 2H /f * '  5H p@ """2"'"  '  " ` `'$ $ $ $L !`#\#`   .` '  @ "@   ' n > D!    @ "@  ' U Ԁ    @ `?'  @ "@  ' 6   ܖ ֔ Ԁ`''Ԁ d  @ "@  '  e_ 6@% " "@;` `` b >`&`Ѐ  'Ѐ`2 "'#2  А zڔ '@vߔ  P "zɔ  Ԗ 'ؒmؖ Ԁ `T"`;V&> >Ѐ L"@&`h X ! ` "D  > DRxҐ  -!> >l``"l  ? 0 T`` `<  `' R`   ?`  ` 8  $0   " $S   ?$$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "Xϒ!H 0 2H /f * ' > ߔ 2H p@ """2 (>!0"'" '? @" ' R`#@` "  Rys j "l0  8` $0   " H   ?$ @H /f * ' > "XR!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  ' yc  9ð ?`  ?`  `  8      $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X궒!H 0 2H /f * ' > ߔ 2H p@ """2 >p!0"'"  '? " @'#@` " x ` R `9T b    8 `    $ 0@  "@` G> 4  ?# ?H /f * ' > "X5!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> 4  " ?*`  '#@ l    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "Xƒ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D #> D`" ἐ '#@i#`    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X\!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  `" ᴐ '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  'a#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X莒!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  'a#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X(!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  'a#@$>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X绒!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XP!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@,>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X}!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X嫒!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@?     8 `    $ 0@  "@` G?  ?# ?H /f * ' > "XB!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '?  " F`'#@D 2  #`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XՒ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' ` "  `'> (# > (#*`  > D!$$ $ $ $$ (?"$ @g|#$ ,$ 0?"$ @gs#$  #\#`  G찒  . `  @ "@` ' ǝ @ C`!  @ "@` ' ǁ @  @ 3 Hڀ     " @  ' _  Xey  `/  @ "@` ' ? "@@   @ "@S  Tǭ T 0~'䀦 ؖ 'ؒŔ s؀`"p  @1 ` d  @ "@ ` '  G> D@!    @ "@` ' Ԙ -  ` @ `?'  @ "@` ' Ƶ @  TЖ 2E  Ѐ2<쀦 "p? @`&@ے  ` 2` " p'㿐   ph X  ' b    6 X (> >!``"``  ? ( L` `< 'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X⑒!H 0 2H /f * ' > ߔ 2H p@ """2 (>K!0"'" '? @" 'R`#  " Rps` , "l`0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "X!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  'p% ` 0ǰ ?`  ?`  `  8      $ 0@  "@ `  ?#}`4{`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "Xx!H 0 2H /f * ' > ߔ 2H p@ """2 >2!0"'"  '? @" '`#  "` o`   0 f    8 `    $ 0@  "@` G(  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '( `"  z' #    8 `    $ 0@  "@` G>   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> `  "` | `'`H> ~#> ~!#  "## ?#@l    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D %> D`" ἐ '# i#     8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "Xߩ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  `" ᴐ '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XA!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xے!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xu!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '# $>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '# $ # (#     8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xݝ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g#    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X6!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '# ,>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "Xʒ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '# , # 0W#     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X_!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xۓ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' ` "  '`> (> (#  #*`   > D!$$ $ $  $$  (?"$ @^:#$  ,$  0?"$ @^1#$ `` #\#`  찒  .   @ "@  ' [  `C!  @ "@  ' ?   @ )Ӱ Hڀ     " @  '  X\7  /  @ "@  '  `"   @ "@S  Tk T 0~'䀤` ؖ 'ؒ s؀``"`gw ``` @(W`  d  @ "@   '  G> D!    @ "@  '  -`   @ `?'  @ "@  ' s   Ж )  Ѐ`(쀦  ( #`7` f  (` `* 2 ``@V"` `` 2`" f͐8   `<  `5 `D ฀ $   2W $W   WS    @$ "    ฀ 2 @') 4 f$f㿘   @ pX> >!p `"p" $H '  'R``  ?`  ` `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >Ȑ!0"'" '? @" 'R`#@` " RgtS  l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "Xؐ!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  'f '>% ?  ?`  `  8      $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >߰!0"'"  '? # @'#@` "e   &}#\#`  t찒 " 6l . d  @ "@ ` ' ˘ G> D@!    @ "@` '  - ` @ `?'  @ "@` '  @  1ܖ &"  ܀&` 2`" 㿐   XX @     "!` X@ 4 "` D (`  `2` <  @$ 2`c `` ```#\`@6#` <`   < T1T/cΐ c^ cYcÐc " 㿐`` #`` `#\@pX> >!@ x" ?` "x   H V 'R``  ?`  ` `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X=!H 0 2H /f * ' > ߔ 2H p@ """2 >!0"'" '? @" 'R`#@` " RdCuS  m0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "Xտ!H 0  2H /f * ' > ߔ 2H p@ """2"'"  ' `  "`   'c   ?`  `  8      $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X(!H 0 2H /f * ' > ߔ 2H p@ """2 >!0"'"  '? # @'#@` "c0  Œ ŀ R`   ?`  `  8      $ 0@  "@ S`  ?#S`4}S`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X~!H 0 2H /f * ' > ߔ 2H p@ """2 >8!0"'"  '? @" 'R`#@` " Rbt`` m`0    8 `    $ 0@  "@` H   ?# @H /f * ' > "X!H 0  2H /f * ' > ߔ 2H p@ """2"'"  ' `  "`   'b `" ?`  ?`  `  8      $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "Xe!H 0 2H /f * ' > ߔ 2H p@ """2 >!0"'"  '? # @'#@` "am   "#\#` `\ 찒 "6 .  @ "@ ` ' : > D@!    @ "@` '  ` ` @ `?'  @ "@` '  l@   ܒ `܀`  @ "@ ` ' ژ F@!@   @ "@` '  - ` @ `?'  @ "@` '  @  Aؖ !2  ؀!)` 2` 2`" " p  X  X b  ` _  ^ `  `|> >|`"|`  ? D   'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "Xј!H 0 2H /f * ' > ߔ 2H p@ """2 >R!0"'" '? @" 'R`#  " R_t 3 m01`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "X!H 0  2H /f * ' > ߔ 2H p@ """2"'"  ' `  "`   '_+  R`   ?`  `  8      $ 0@  "@ S`  ?#S`4}S`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "XЁ!H 0 2H /f * ' > ߔ 2H p@ """2 (>;!0"'"  '? @" 'R`#  " R^t`` "m`0    8 `    $ 0@  "@` H   ?# @H /f * ' > "X!H 0  2H /f * ' > ߔ 2H p@ """2"'"  ' `  "`   '^ ` N ?`  ?`  `  8      $ 0@  "@ `  ?#}`4{`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "Xf!H 0 2H /f * ' > ߔ 2H p@ """2 > !0"'"  '? @" '`#  "` ]m` `  "``` #\#`  찒 "6` .'  @ "@  ' : n ܒٔ  ɴ i`  @ "@   '  G> D!    @ "@  '  -`   @ `?'  @ "@  ' ژ   yؖ j  `؀`a` ` 2`" `" Z " h> > Xa h   b"h@X  ?`  L (`  <  `' R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X֒!H 0 2H /f * ' > ߔ 2H p@ """2 (>Ր!0"'" '? @" ' R`#@` "  R[s q "l0F`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "XY!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  ' [j  2`  ?`  `  8      $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >{!0"'"  '? @" '#@` " Z ` ] 4`?#@l    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X?!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D 1> D`" ἐ '#@i#`    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "XՒ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  `" ᴐ '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xm!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '!#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '!#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xʡ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '!#@$>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X4!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xɒ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xb!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@,>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xȋ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X$!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@֐@ ?  ?`  `  8      $ 0@  "@   ?#|4z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "Xǎ!H 0 2H /f * ' > ߔ 2H p@ """2 >H!0"'"  '? @# '#@` "U  `+ `-2    8 `    $ 0@  "@` G> (  ?# ?H /f * ' > "X !H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> ( > D` "  '!@$$ $ $ $$ (?"$ @I#$ ,$ 0?"$ @I#$  #\#`  찒 "` .`   @ "@` ' ߘ @`C`!  @ "@` ' Ř @  @ Y HĀ    " @  '   XG  `/  @ "@` '  `"@@   @ "@S  T T 0h'䀤`  'ؐؒ  ]  @ "@ ` ' H G> D@!    @ "@` ' . -`  ` @ `?'  @ "@` '  @  Ԗ   Ԁ`쀦"RB  `` 2` " R " h > >`  X ?a  d' "db $ H  < + ' R``  ?`  ` `8  ``$`0 `  "  `  ?$@~ 4|      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >̐!0"'" '? @" ' R`#@` "  RStS  l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "XĔ!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  ' R Bɰ ?  ?`  `  8      $ 0@  "@ `  ?#|`4z`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >˴!0"'"  '? @# '#@` "`R   ! ?#@l    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "Xu!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D '> D`" ἐ '#@i#`    8 `    $ 0@  "@` G> D  ?# ?H /f * ' > "X !H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> D  `" ᴐ '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X£!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X=!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "Xג!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@$>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "Xj!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@,>  H m    8 `    $ 0@  "@`  G   ?# ?H /f * ' > "X,!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  ` "  '#@,`#@0N#`    8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  `"  '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' > "XZ!H 0 2H /f * ' > ߔ 2H p@ """2"'"  ' `"  '#@    8 `    $ 0@  "@` G> (  ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '> ( > D` "  '!@$$ $ $ $$ (?"$ @A#$ ,$ 0?"$ @A#$ `` #\#`  p찒 6  .   @ "@` ' Ƙ @ C!  @ "@` '  @  @  > H     " @  '   X?  /  @ "@` ' h "@@   @ "@S  T֔ T 0j'䀦  'ؐؒ _؀d  @ "@ ` ' + G> D@!    @ "@` '  -   ` @ `?'  @ "@` '  @  Ԗ     Ԁ  y ` 2` "   `"`Jn `` `@ Nа  `<`2  `" `JW`"` JNp  X   bJ?J= m > >t`"t  ? $ H  'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "XВ!H 0 2H /f * ' > ߔ 2H p@ """2 (>Ċ!0"'" '? @" 'R`#  " RJs k "l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "XS!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  'Jd   ' ?`  ?`  `  8      $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >q!0"'"  '? @" '#  " I  S " U} #\#`  4찒 "6l .d  @ "@   '  G> D!    @ "@  ' q -`   @ `?'  @ "@  ' R   ܖ    ܀`  `` 2`" 8280GҐGА "     'hX!< 'l    2 2d 2 Ā@2 > >a`  "`!'d " ư  d@F  .q  "@ "" @b L $\ p'` > b'p'$ 't'`'|$'?'x'@ x@?l #@2@*@%@   x@xl #@" ` 8 9h       &``  `p` ?2* 2 @ Ԓ  'h` h  l > ߐ   `"    " "@@""@`"<`2 l > >d 2  > >a`  "`  ""``X> #`'`  к ` "'L'P''  '> >`  "`  D   ̐b  '`R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@$|S 4zS      8  `    $ 0@  "@ M?  ?#D?AH /f * ' > "XG!H 0 2H /f * '  5H p@ """2 >!0"'" '? @" '`R` #?`RGOu  ̰ n 0`  `8`"``$`0` ` @"  F `  ?$@ >H /f * ' > "Xɒ!H 0 2H /f * '  5H p@ """2"'"  ' `  "`   '`F z    8 `    $ 0@  "@` E   ?# =H /f * ' > "X_!H 0 2H /f * '  5H p@ """2"'"  '  " `'     2 k   e     8 `    $ 0@  "@` E   ?# =H /f * ' > "X!H 0 2H /f * '  5H p@ """2"'"  '  " `' Д` `#\#`L {䰒 " ~ . ?'  ܒ@ "@ 'ܐ Әؖ \   Ԓs QԀ   ܒ@ "@ 'ܐ ؖ ;' ' I0<  ܒ@ "@'ܐ ؖ   ܒ@ "@   'ܐ ؖ      ܒ@ "@ 'ܐ fؖ ?   ?"`"@ (`  5@@ "@@" "`"@ &``8 3(@@2 &@-5b- ` @&` "@`? "`e @$@+@@"@@""`"@&` ` `ܐ "  @  0'܀   ܒ@ "@  'ܐ   ܒ@ "@ 'ܐ ٘ؖ b؀ "&'&'&" /   ܒ@ "@ 'ܐ ؖ 4`?D䀤 > >`""@ 5@@ "@@" "`"@ &`      ? P " H0  0` >!X X  'x't`'Lx # ` ''P'' 'p'l'|'h> >`"h  \ R``  ?'   `8 "``$`0` ` @"  `  ?$@~ 4|      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >V!0"'" '? @" ' R`#@` #?  RC S h6     8 `    $ 0@  "@` G   ?# ?H /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  " `'#@`#@  ` 2`#@`#@`#@``#@`t  #@ #``#\#`L  F .'  @ "@` '  %@       @ "@ `  ' Ԙ @`'`@'`` l    @ "@ `  '  ` ` ׆ p ?"`"@ @ (`'p 6@@ "@@" "`"@ &``@8'll:+`@@2 '"`p`'p.6".'p`@&` "@?"@@& & @$@,@@"@@""`"@&`` ` "  @ ɒ 0r'  @ "@ `  ' - ]l  @'"@`@'"```@ ``  "S  T T 0;'  @ "@` '  &@L  @ "@` ' ߘ @``@`` ` "    'Ę W`2 X`@=Ŕ 2 X?'| '4ϖ   '|_| '''D '' (> (c*@  2 '| .x@#  & D`@&@  2|x`/`+|  @ "@` ' ] @` ``  "   ђ 0z'|? '|  @ "@` ' . ^@ lb   @ "@` '  A@`? l > >p p""@  6@@ "@@" "`"@ &`l#     P ?` #{|w|r H|m  |` >!x| ?i㿐/` ' |J # $@>$``< 2>ː!, `  4>a $` ``*`:  z,``@@ w  `@@  "` ?!`@}ƒ hX> >!L `""L  $ H ƒ `'R`  ` ?`  ` `8  ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >f!0"'" '? " @'R#@` #? R?s G l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' > "X/!H 0  2H /f * ' > ߔ 2H p@ """2"'"  '   #  '?@ ݐy ?` ?`  ` `8   `` `$`0@  "@ `  ?#@}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >O!0"'"  '? # @'#@` ">  2 4р`#\#`  찒 "`` . `!  @ "@` ' h @  @  H`    "  @  ' E z@`"%UR` @ '܀ @4 `{ `R `@ ܀ @ y "`ܐ> 2 2 X@: 2X >a` "`  DR``  ?'𖊠   `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' > "X!H 0 2H /f * ' > ߔ 2H p@ """2 >!0"'" '? " @'R$ #?R< S  0    8 `    $ 0@  "@`  G  ?# ?H /f * ' > "Xq!H 0 2H /f * ' > ߔ 2H p@ """2"'"  '  #  '$$ $ ! #\#`  z .  @ "@  ' _ R> D!   @ "@  ' F 9'  @ "@  ' 1 $   ܒД 쀦 &  @ "@ '   0А@8  ; !1㿘  "  `X L >i2` $ 㿘  0`  >s! 0  > " 0 + +ɒ㿘    @ 8`'`X?!?''L'P*  !@  '  `X!@X V H /d4`p* %`p A > @  0 22#  0- $ 0"@  T:  `3`+ +` ;B  2 ` ( `   ` d"@ @ :`C 8 @      H 0 HP&@!1 `X 7,  0?c $ 0$&H /d * % $ϐ`t`'`t 0$ d$ 0 0? @ $ `$ 0(H 0͓,H /d4`p* %`p Y @ > 0 * L 2K2H 0  $ 0ؒ`/ H 0 P `a>   *`' 0 >Y!  0 2"9  0  0$ 0H 0X60 H 0L `3H /d * % >??H 0 P a >   *`'`p  _  ?2 㿐   `` #\ / 㿘 > "<d8 <`2>^Ґ>["8 㿘 @ 㿘>  0 " 0 >"@ 0?! @& 0H /d * % # ` 2  \" \`0 "`0 \t "tH p@!@  @ B T : `* 2`  *`  0:  d@ "@ & 0 \ ,/ 0* & 0 0& d ?& 0& `H /d * % '?H 0 !1 \u`X ` 0@ & 0W0`2 &` `0 "`0#`8   X <`  <        U  2   =㿘 > `H > )a3 H> # `*"@ *`@ *`# X* @㿘 > `H > )b3 H> # `*"@ *`@ *`# * @8 ` c &> )d4 `D` > )`X <`> )5 !" ' ' ""  ' '  T> )!> *` €㿘 > `H > )a3 H> # `*"@ *`@ *`# XL* @㿘 > `H > )b3 H> # `*"@ *`@ *`# L* @8 ` c @a > `H`H$ `*" *  * $  " > `H`H$ `*" *  * $  $4 `D` > )`X <`> )5 !" ' ' ""  ' '  T3> )!> L*` €㿘'@`  0  %@> @  ? `>" >" >"2  Ā "C   ">  `  ̡, < : (@, d$ 0>  @N̖ " $06 2 `@6 @,ې>!@  a `@ $`$a'@@N  >@Y> # 㿐\'` %@ `0 e@> @ 2  ?  @  >`0#(`>~#h2`>y# ".`````̡,`< :U`(@,~ d$ $`.`  `>`0#` >X# ? : ': @N7 `@,R@^ `@ $$`dT,@" >$#g`$6 `2'`<`*9`(@," `̀@#>>` J`$``<`(9@, d`̀@`0> `H9`Ԑ  $`> x|`> >!@ϖ $:`@EX <@ @ "6 `T&?  @ =  `$`$`d,"T"0""0H@-6%@` 2" >@ R>#`԰   '@MՖ > 6#P`' ` $ z  `` `P?'#>`, @Td0@ K: 2 k`&` `d8->, `P " U耤,   T+>, `T " AT@+K:T@+D:2& Ȥ @E 2  @E 2 `*`'x * ?0?  3 0'x H @c` *` * ?   ` *` *  2 >ސ!@ & ?0  H'@*ߐ>#@ '|. |H ` `Td0@ : 2`>!`Td@:@@  >!`X <@ x  0#\@% %@ #\@'%@8 @` x> 6cL )> 6L ` %`    > 6cL    0| `X <@  ``Td0@: `d,@ "T``Td0@ : 2> 6>&!#T`>!8 @դ x?x  9 㿘& Ȁ f<@ 2@k,7ے@: @3'<@ L @   *@ @ ?*@  >"@ "9 X  @04 `" >!G>!>"=& &  &.7&   &  >@ C0>"@԰ 㿘 `,`@)`@)`@)  @`"<`. @3O`,`,` cP*  @ 6 `& `&  ` `cP@ 6 `& `&  `  @2x < @: , ``8@): & : , `47dd7 ` `06@)"% &@) @8  @)8 " `,cP*  6& &cL @?  6cP6& &cL @% 6 cP*  @6 `  cP @`6 㿘 `\@/U .? 2J`8`t @  @1``N .?   @1`@(@(` `,@/*`@(wcP*   6$`  8 cP @ 6``, `X (& * ``*  " `@0 $b6`8 6`D6``|*"@ *`@ @(3*`?@(/6`8㿘  "`,. @@6&@  , `,@.   ݲ``,@"   㿐 .`P@T'` : 0? 8? 4ɰ  55.@   d, ? @HbU  > #Ԁ  > ϐ  ʰ 0 H$ @.XT>6!8@"U    :`c `   ?":@ ؘ 璀 8" # 4@"U   ` :`c `   ?":@ "T T> # *`@ ?#@ #*`@  #@ T>/ @"U.`   ` :`c ` `  ? "(*@* $ $ $̚`P?$̒@` ?"`  , X <@ @!㿐 .`P  2 02  44̒.@   d, ?Ę @ H bU " #Ԁ     > 0>  ǰ  H$ 02 T@o08>   4. `   `@ `@ "`@ I  L@@-O8 .`# 4@"U  ,` :`c `   ?" +@*8`@8  $"@ $ $̗+`P@ $̔  " ,   0W@  t 0L@.` 4!,`@"U  ,` :`c `   ?" +*@`*@ $ "$ $̀P"$̒@` ""` , ? $@*`   3X <@ @ 㿘'H`  `H@& (8 @,@bU ``@> 2`X ոP Ѱ|3@%@bU| -TT  @"U"X- 3* 3@,`@%33}@,U@,S3w@,N@3r@%@,`U` @`@ ,`U`$`@,` @,`U 4 U `@,`U`$`,`U e @,3?%`@%g. L -`#\ T3-* R? ?>"pƖ>6"2T-`#\ 3* R@"U`@C 2(`L?2Xe` `:@ $ >"p>"8@d 6$(x ,`@bU >`@<?@$Ē$ P* "2|@$|2@+@$2|2@+}@+{2@+v2P@$* @"U@- Ԑ XP2* @?4bU -`TT  ?",2n ``X< H@㿐` .`T 6` ° 2S2N.@   d, ?F @ HbU  " h#Ԁ  h.$     `@ @  @ T.`` `$z#  t# @$2"8  @*ؐ`:  l:`*  &  *@    p *`    @   A @& @"U)> # `@  2`ې"@$ 1`*@ @#ߐ".>ǐ# @3>ǔ"8c0@@o0ܰ 㿐 .`P  2  11.@   d, ?y  0@ H`bU"` cԀ` >    H$`@*0 `:`b@`\@  ?&:@ W.``0` `:" , `@"U@:@`\@ @# 2``@"U@ b`\@ @# 2 ``0>#P>#p@bU " @`\@ *  .`  *>#>#$`0 X <@  0@<`@"U@:b@`\@  ?  &+@*` <?$` Ȗ P$Ȕ?"  ,` $`P`$ "w0㿐 08 @> @ 2  8T@>  $  >0#Ȗ$>#@"$@ >  >!@/(0 0e0`-@   d, ?X 0@HbU`  > cԀ >  0 H$`@)0 v`@`bU >@c``@@  2 ` > 8Ȗ>8 `@"U@"``cؒ@@  @?`-` $`ĐP $`"0|@")|/@(@"!/|/@(@(/@(/P@"* `@"U@, Ԑ@ `XP/Ӡ@* @ 4`bU ,`T8?.@  `@"U@:c@``@    " %  : :@ `4?@ XT > >-`@"U>@,``:`c@``@   : *#:@ " ` 8 > "``@@    ?# @ *@ +@ ʘ `$$`$̀ P@$̔ "  `@"U@:c@``@  8 " ?% ::@ @  `@`"U@= c``@@ c c`$8 " $`$8̐P#@$` #@>#` ``$`P$`"/|@!)|.@'@!!.|.@'@'.@'.P@!* `@"U@, Ԑ@ `XP.Ӡ@* @ 4`bU ,`T@`T@ @ "@ ,㿘 X`< @ @!B 㿐 ,.@*>  @) ..,   d, ? 0i@HbU   > #Ԁ >  [  H$ @*T @bU 6` \ `:   > ؔLҀ`2 >]  @"U@6`b \  +@* * 0@*$ 0 , $ <P`$Ȕ     " ?$ P$ ?" , 㿐 0  @> @ " $>!  >!H@*>!`  @ -@ * -  dࠓ, ?ژ ?0U@HbU  " #Ԁ "  F?@&0  @"U@# ``@>@ .T >@ ! @"U@,   ; # ` ` ` ?#@; 2` ``@ >!`?㿘 @&P`  ` `, & ``: ``@:bU "@``@`8> 7!*   ?"? * @*X +`@"U@ c``@`8!*@  ?"? * @*8 2 >!`Ē >4!Ȑ" *  &`,:.@"U> 6> 6cX#|    `:`c@``@  `8 "& $  : : @ @*`@  @ + `@ *`8Ӏ >!}`>" 㿘$l h>`.`# (.> . # (.@.$p@8(& .` . @ ` @  '? 8(! .> @ ?@ !$4/  ".  ". "$ (T  ? .`.`&㿘>b  Ԙ (  P'T\'X@(ؒ <0 @ ?'>3"X2%6P  @ ` f @c ` 40`*:  8 <20 @8<0  D L 0 E A b0#`T#\M n`X <@ .`0#\#\@גP`+ ;   @Y= $   % X`  ,   `P* :  8` ݐ0?  `"@P< D L  @ ?n " 0#`T#\͘ `X <@ X#\#\@XK* :  8 D2 0 (0DL T)  L %X`d*@ " TH@<" @`X <@ #\#\ @  $  % @7  4>"p * @'`E' W 0TԚ % 'Ģ0 d'.@ <"T@XH"@`X <@ 0#\`  @ ~ 2*  % '`%  a`א [. 2 0  0T .$@*  0 d'.@ <"TH@`# @`X <@ ѐ 0*` *  @=$* * *` & `&'X. .* ?0. { H* `M0T `$@0 7 d.@ '"TX`H@<" @%`X <@ * #\#\@{ * X*`& Jn j  X 0?Ƙ 0  'd.@ " T%I @  @0`0@ `""@?* * 0 ">"@*X H`&  L  < T@=ʖ ! "@ % %!㿈>  H H *`" *   * ''`X`<`   ?%  @    ?%   2     `@% `%   % %  H`B = H  " HH% *`" *  * %   ?% e,`4 ! !5 5  ` @$S(`@$L`* (`` @$@$@`x``?* `d`0, 찒 "`X%0* <@ @)R `xU   "`x>"@$  H* @ &>  `X <`@, 'T i  < `2a   2<W < 'X @:`  ` `! " >#@   !  > & ` @ > @. " !> " TA "  @<?@j> " T  * !`&   C   A?e08ް e4ְ   !T#\`D  T  2ð> @ϟ@{`kT T !`&    @τe< 2`Pp> @$   !T#\`D  T  2X <@ " 42> e8`L e@`0 B 88    @  !> "TAM  2^ > `P * :  8  2`0 8e<`0e<eD `L @<`T$H@Tj` T`0T`0  : D`P@$B??'`t$ '`t'\$'`0 :` 'L $ϔ < X'H? @ "@ "@ @,`@"@ `!&    H$ <$ <>  (> ߒ > " T )?'`t"@ '`t ' ܠ "@'`d. @P 2P` $`0SL z? @+  ,!` &`P`* :  8  2`0 8e<`0e<eD `L %< @۶ I- @E 4`0`P * :  8  2`0 8e<`0e<eD `L > `P * :  8  2`0 8e<`0e<eD `L # >#H  `T:  ה< H > 0,`@ "`|#``>  H@"np!> " &!&! `& ?@: 㿐  ''P'X    t&/?P@Q0:  O `0" > "`, ",`0`<@ `8$`0$$`T>#A Ȑ P CXu"?"`H0 _  0#lt, "@@*` X <`@  R 2' t?%Ґ?&@,  d. ?? 2'0?@ P @,  d. ?^ 2'`f  X`0 $`0 АX"㿐  P @"- 4 0*:  8  2 0 @8%< 0%<%D  L '? ]  0 %< H @ & '㿘8> 7/  (-.`> 6> 6X|  ': ) @@2 8&/@/8 /`/ 8܀ 㿐> a > *" *  < *  T:` @  ;)>"4 t 0@2/ t \ *  ?o 2$ t` @2 t < " t T4 t: $ t>#͐# <# T;  p?>  t ˀ㿘 8>>0#  >@ `?>@ *  @ *  *@  `?>@ *` @ `? 㿘 8 >  >0 >.@>@ *` @ *` * * .@ >@+ * .@ (㿘 8 >  >0 > .@>@ * @ * * @ .@ >@+  .@V 8㿘 8 ">  >0 >@`?>@*` @*` *   `?>@>   ) H:l:::::;;; ;,;8;D;P;\;h;t㿐> "> `a> a(  >> n`!> # > x0?>> `  7#@   ?"^ 0%> $" "$@  #`$ "@`$"`!   Ԕ YZ @ܒ D˒ @i   \ l W < @ @@N  L Ҁ    Ӏ  @ z<* $<@o  Ӏ <@2 L Ҁ 2 Ӑ@ $< Ӏ  <@ L Ҁ  *@$< <@0@a E<@B ``; !<= = L р 2 <@>> ’ Ӱ   Ӏ   @@  , \  ,@$#L    @#ޔ `0 @&(&&$&&, < " > Z `܀&  `"<< !!`;J ;Ӗ =7 v<@@#   `  2 א Ӑ )  Y  Z`" @8  Y Z`@+$  Y`@!$ @Q 4L l D`&@<@"&  L Ҁ,  Ӑ  , #L]0  <@   ?, Ӑ@  s㿐`D ` P `` I ``  $ "@>A!(`` @t"`@m`* "`` @@a`x``?*  `d` , `0 @  x@  H* @ r U %  90x< '  `:Z   $O !@`h ?;0 " (<` @ܮ ? F H%\aT @ 0@eg8 n  ` #P##P#T##T +  h h#@40 "0̦ %(@%@D@  4?@ ##P 8 0 4!m$  d@*@ ?e /ܒHٔ 8 Ӏ @ \%$>  ,  #T%$" , '''' $㿈 ?!-  > # y 9`  #  ;} e`<   ?9 Y `h :^ " (<`' @  $ F HaT%\  O 0@@eg( , L ѐ ?`, Ӑ , `<@>> ` %L [  %L?    Y!@A! h Y %` H h h#@0 "0'`  ,  4@ %$  ,* @ Y  $$#P 8 0 4 m%  d@*@ e Hٔ' 8%$ Ԁ ``9> H ,  $#T%$" , &a&`d "`  "` &`h &`h`<%( &`@&`<%`%@%` t %`  d %`$ 8%`(" 6"@x"`" , $#L Y%  ,@$#L!"`Ԓ" @%0=aH# 04 : @8 B?%0 8 <%0%4 <%0C Ӏ @    #PZ #LZ  , , `<@   ?, Ӑ@t  #PZ " 쀢   8` ` Zz Zw &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:   t:`>%0<  @ %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` @`@ G@? 9L Ҁ 2` Ӑ` `, @  "#L), Z `  ?"` ! L Ғ  `  8?C`#PY Y Y <*@$<$㿘`< a ` % , `@5  ,  7`` 89M 㿘!F aTe\ "`4>!X&``0&``(&` `8``̠ &``<`(@ d$&```,?&``Ȓ D@ &` `T( Z `$ Z!La  l `D`@Ք  㿘` "  < `  p ``ې ` `8*` 2&@`8  㿀  )> LЀ  LҀ " '>!h>x!x''''"耢 2< `` @ 2䀢 2'耦` <@ 2  6` 7ٖ 2 8 @6PLЀ`@Ғ 2㿐a @+@ & > D#`    > D& 2"x@! >T  P > 7" b$ $$ $@+<$ "  ͐0q@.༠@'*  @@x`?*  d , 0 "xxI&@ H* @ (X <@ "T@0$> D> D#\d@C " R%& B$  2,4 `$ $ X`<2, $, $$  &㿘!`  ` d,`@  F@7  2@ "`"`㿘  ` `4?@p *cP`8`0`49%``d@*@  a H`@8`8 2`8&`8 6 `T`d@”" `h  =,`> `H$` `hHeL?H"Pe, 4H8 H"@"H`:00X 2㿐> ~ 2 > &b #\" > D>a"x!    @ @7J㿘`W ?`Q>!*` €> 8!> 8!> 6#P> 6 #L> E#> 8"8n&> F"0> G > F > F > F > F " > F "$> F > F"> F#0n -㿀   `>>!ua`<`X  @@ 2 ! 2 >>!`aЀ ( >>!Xa0 ΰ 2 4@(0ŀ 2    @ b  '  @Ӕ `` '*@ :   20 8 <0P  <<  D L 0   *<@* :  @ <> 8!`  ?#\#` $2 $ ' 4' * :  2' @8D ' D L '?#\#`ǚ ? )% $`@$6`H`Hh '   b 4XP`8TP "   % x' '  >>!ub  2<9 #  >&> &  >`"=  @ ࠀ  ऀ@0  >>"Cb>"0?b'   @  e0B  2<e4 <  `@ ` D  2   d֒ ߰  ` ࠐ` ?耧   `P@  e<`0 @ "* $ #\ u<  Bࠞ   ऀ @ D   <@U '@/` `@`P`* : ࠀ8 2`0ऀ8`0  e8`L @e@@ @ "@&Hg H@`"`0  > 8!䀢`$   =  "   $ `2o  (  "    "  34  䀢`  @ @@  ' @ b % =   ` `   㿘 < 2   "   <@" @b   `?H /d4p* %p  =# 0 $ 0  p _> 8 b + 0S  0  >"@"  P &G  p  0`     0$ 0) 0$ 0H p@ 0 UH /d * % p  " p +>X  H p@@1 ,H /d * % p  k< >"hVH 0     `?@ 㿘  @'. > D "x$  OlOxPOOOOOOOOOOLDLPLL\LhLtLLLLLLLsluTuuuTr,u@TTTTT@T|Xt||||DDD0Dd|lP ppΌp    p?" " " " "㿘 `&`2@   p ` &@H 0  > "``4 & @H 0  㿘 >> " `4 >#P &&rN?& 㿘  " >#> F6 b( b(&"b(& > ~> ~!$`&" $"& > Fb"$ "b㿈> "H /4> G* %> G!> 8 T"b4`""`"@"4H 0 ?` -> *` €> G"! > E#$> D#|> F > F#4> F"4> F!> G  > E !L> E h> E"4> G" 0>#h. H /d* %$"4"4H 0 > !8 > E` "#> Gb܀  ݰ?"b> E`d   @jd> F$d!qC > Ga   @a> F$a!q5 > `H`H '' /> Fd  a@Fd> F$d!q a  @ِa> F$a!q HH " "'耢'А"@''耢 `"w?H /dX* %Q`""`"@"4H 0 ?` -> \*` €> G"! > E#$> D#|> F > F#4> F"4> F!> G  > E !L> E h> E"4> G"0 0>#hd H /d* %$"4"4H 0    @> Gba`2_d?`> G> G?bb "܀pː 㿘 H /> F* %> F> 8b(""4 `     !`@$    / 2 2  b4H 0 V ?*@4 `"  "` "@> F?b4"H 0   "  " $  2   " @(" @ 8!" @ " @>># c> 8!* >#  㿘`p  >#H /d4> 8* %> 8""4 p$`p`""` "@`p "`p" &`p " "" ""  p2b4H 0 㿘> G"ܨ` '> G#>""`$" ` n "ܒ $"?$&@!#  $@ &@`. /– 0 $܀ o㿐     2? "  㿘 > G X <  > F b,* @    @  2  @2  2 &G > FB&> 8 !ߒb4 > GH /d4$4* %$4! ْ @ @ @ 4 $  $ $ $ $ <  8"?H /d4$4* %$4@ $ @ "`$@$ Ґ!& 㿘> Ec > > G a*  @  @2  2 &c > F^&> E# @    > F @  > F٨ > F#%> 8h4 H /d4"4* %"4 > E`$  ^#$  ??4 $ $ 4 < 04 $ $ ,$ 8$ @$ <$ D D$ H$ L L$ PH /d4$4* %$4@ $ @ "`$@$ R& 㿘> Fc> > E ``* @  @2 2 &  > D&#h > G! $ $ $ @ $@" $@$ & 㿐> E""0> F"b(> #>  @a, @ 8 > E"#@Ւ > G Nby > F"b,> F> !c@ a> E O bj > G"a> F> #c0 > F P b[ @> E"``> D>#hc(  > F>2"aXt5 !> &"> G>#\! `( @   > E>#\#$`8 X   > G>#\!`H    > D>#\#|`X    > F>#\ `h <  v > F>#\#4`x   l > F>#\"4` 4  b > F>#\!`   X > G>#\ ` p  N > E>!L`#\   D > E> h`#\   : > E>"4`ؒ    0#\> G>#\"`   & 㿀Ӏ K /0G@ , @;ܒג,@   d, Ϙ䰒 ,` H` $ '  '  ' @'P  "  " " $" ,@&!  㿐H /!> 8* %!> 8$"4`    b4H p@> ?" ,  @ @M2  "`$ $"`("" ("4H 0 㿐 ` >m!H /d3> 8* %3> 8&b4@"  "` "`"" b4H 0 㿘 p  > 8  4 2 > 8b4H 0 > D#|E  6 6 & & & & & H /d4> 8* %> 8""4  @6  p & p"  p$ p& 㿈\> F  @ <  4 $ 4 $ $ $ $ $$ 8@$ 8  Ֆ >!@H /d4> 8* %> 8""4   >$ 4` 2` $ 0 4  $ 0 `" "```"`$ ( ("`,"$ ,`" "`@`"> Ge!`2 >!h9 @4 `p $`p" $`p`p` $ ,> 8b4H 0 >|! <   k쀢  2 `p "@`p"`$`p" L  @"$ 4L$   $  "@ # b4 @6 b4H 0 0+ & 2 > 8b4H 0 >#!$ $ ""b4 @  b4H 0 㿘`@ > 8`$ @> 8` $b4H 0 >!` `&`$&`$8`2`8 `8&`8&8@ 㿘`"  8T@>  $> F>ɐ"0 ! 2 ! ?* 2  "  `X"  " " " x ?' ! ` ''  ` * ' ''> F!b㿘> F "4@ 4  6 6 & & &  `0& 㿐\H /> 8* %> 8"b4  <   p [     2  p "@ p"`$ p"  2 >G"H  6  p`& p" $ p&b4H 0 @0㿘 H /d> 8* %> 8"4   2  p`" p"  p& p"4H 0 @㿐 P  >" )> 8H /d4%"4* %%"4 p``` 2@`"4   4  p`$ p" & p p$ "4H 0 ` `  >"H /d* %%"4 2 &0 6  &0`"`  "@ &(("`,"&,`" "` "@> GL!` &$ `*    !  2  @" > 8b4H 0 >["Ȑ &   & @" ` & ` "`$`&` H*`" "4H 0  $`` \H /d * % > Gaa $a" "a$H 0 `"> F (#4  44 $$ T P@   \  T*h  T  < ` $ H < W H0㿐 >"> G ~ @c p 5 ! % , %   %   X 0%   = = !3> 8  % (@? #@` `  @ ?"@ "@ `  > &! ` @ `@ ސ`* `` @ r@ `x``* `d`0, x? >@v#`x@ ]  H* @  H /d4&b4* %&b4  ޖ` " b4H p@>a#8   5 `< % <"`"`< <% @Y@h D D`2b4H 0  H /d4&b4* %&b4@ג $ p  p'@8(0 "0b4H 0 ?H /d4&b4* %&b4@   k b4@b4H 0 @\㿘 p?`> ē*` €` !" `> 8b4H 0 >ϐ#`!` 4`  @``  P > 8` TP@ > 8b4H 0 >#H H  <` ?*@4` @`"``"``@"@`  4` ``p $@`p" `"`p` p$` '> G*`$   @L $ *`<@@`< ` "(`  ` "`  "``$ ` 2    4 `<`$`<" &`<`<$  2 ` ?*@4` @`"``"``@"@` `"``"``` "@H /d4* % $@" $$`H 0 4 p@ג/ p> 8b4H 0 `>` #> 8!*` ># > 8b4H 0 `>` #> 8!*` >#  p`2`㿘` 2 ` `(`"`,`,"`,`,`("@` ``"`& `` "@` `2`8?*@6` @`"``"``@"@`8   2 `8`4`< "`4`8 <"`8`4"<`4`8`<"  H /d * % > Gaa &@a" "a&`H 0 㿐 > E |!L 6 6 6 &  &  `X& H /d5> 8* %5> 8&4  ̖ @( "  b4H 0 @0  6 `@ & @"`"`@ @& 4H 0 㿘 `2M  8 2I  < 2E  @ 2A  D 2=  L 29   ` 3 6  $` ("`( ( $"& ,  @ ?*@6 `"  "` "@ G O& @   > 8b4H 0 >     2H  82D  <2@  @2<  D28  L24  20  " * "     H(> G"  " H > F   `  ! `  +> G ' ''' `   ,'?x'''t \ ?@ $ 0 : 'Ĭ ` 0 `d,@ @bĀ 20ۢĐ'Ĩ? ,`# 40P* : x |20|8<0<D L yē<  'Ĥڑ, (Ā@> 8> `@H /d * % aa &a" %a& H 0 㿐     '> 8t ג? H /d4$4* %$4 Ӓ ['`p"X4 2 > 8 > 8 a2 ?> 8b4H 0 > *@2 `""`"@H /d * % > Gaa "a" "a"H 0  p` 4> 8b4H 0 > H 0 4H 0  0?^ "/ H0t? !:`  N , ` d.@ ^ 20ڞ'?(0 "0p㿘 2   (`" , ,"`, , ("@  @ ?*@6 `"  "` "@ `"  "`  "@ `2 e 0   2 `<`"`<" `<&`<"H /d * % > Gaa &a" "a& H 0 㿐 2` `*0&`P@s e< @> E y h@T   5 5 % `%  5 H /d4> 8* %> 8""4 1!> E"45 yʒ   4 4$ y  44 $ $H /d4> 8* %> 8""4> Eb0 b0$b0"`$b0$   4 `p`$`p" '`p`p$4H 0 .H /d4&4* %&4`  `ϖ ` $b0 ?# @5 H /d * % > Gaa $a" "a$H 0 b0 $b0"`$b0$   4 `< $ <"`"`< <$     2  p "@ p"` p& p" % > @*   $` %  @*   $ " @*  " $ @*  $@% H ` 2 @4  5 `< % <"`"`< <% 4H 0 㿐H /d4> 8* %> 8""4 e<  `P; X&&  @W<*  - $`"  "`  "@@G *   $` &  @=*   $ " @4*  " $ @-*  $@&   2 >` & @<@ 2   <  2 & 4H 0 㿐 ?*@6 `"  "` "@ ` "`  " 2  `  k"`  !`   " - `0 P> G> E"0=#  4  *@6  @2 `""`"@`""`"@H /d4* % "!" #!"H 0 ` `0  > 8b4H 0 > H /d * % !! &!" #!& H 0 㿐@@ ` " `  "`"`  "> 8b4H 0 0"" `"  ` "" ` " > 8`"4H 0 @ 㿐>Q > Ec!> G2  !: $! @ !> G`$! wW"@  6  @6 6  X& & 'H /d4> 8* %> 8""4` e< ` `P;    2 `p "@`p"``p$`p" >`& @ *   $2 2  <2 1 2 > 8b4H 0 >~Ԑ @> 8b4H 0 >!~ ?' c 2 "  `}6 㿐`  %<` > E v h@'   4 4 $ $ A   2  2  "   "` & " "> 8"4H p@ 0v $  " $ ?# @4 $  "`  ɖ `  <` `4 < $ < "`<&<$    4 `8 $ 8"`"`80 8 @*  $` $  @*  $ "`@ * " $@ܒ *  $$    4 `< $ <"`"`< <$ > 8"4H p@ 㿐H /d!> 8* %!> 8$"4   XV  @  "4H p@>}ې!0 "2`"4H 0 㿐 >  b   >@!X0 H /d4> 8* %> 8""4    2  b4H p@>}!x @C  ?* `:  $  4 b4H p@>}! "2`b4H 0 > Ga?"aH /d * % > Gaa &a" "a& H 0 0 ?* `:  $ 4 >}L! "2`b4H 0 !  @ >@! $> Ga?"aH /d * % > Gaa &a" "a& H 0 0@H /d4$b4* %$b4 6  &  h b4  b4H 0 0   6 `@ &`@" "`@ @& b4H 0 s 0!P  ` '<`  'D 'P'8' >@"H /d * % > Gaa &a" "a& H 0 㿘 0@" p>|"8``?` u@> *` €@y@͒t` !"`>|p"` 23 <`(0 "0`` ?*@4` @`"``"``@"@H /d * % > Gaa $@a" "a$`H 0 9 S>7 $` H /d!> 8* %!> 8$"4` ?# @`4`  H <` ``H < H"4H 0 `>` "> 8!*` >#| `2y`㿘 "">}"0H6 H /d4> 8* %> 8""4 *` $)`?#>>`H @ > 8"4H p@ @{ʒc "#  #   2  2`H`ґ*`"4H 0 㿘 " >{# " 6 x@w `H*  @  O>{#P = &  @ 0` D> 0H /d4> 8* %> 8""4 D d `(>>> @  b4H p@>{^#  +    b4H 0  㨓*  {G؀ ?* `X@   b4H 0  `X*@ c{-ؐ  * ` b4H p@> { (?# @ 4   D b  ` _ `( *``("  $`"M0@"I  $ : >`   `X*> 8>@ < 2 "@4H 0 zސ`X"@ `  > 8>@ * 2 "@"4H 0 zĐ`"@`"4H 0 0E   ` $  *  0 `: 0  2 `  `(*   *`" o: >`  `X ?* "@ 2 "4H 0 㿐'?*@4` @``"``@"`` >!*` €@ @  `  4` `$@" '$``"%> G" "`"`"`2`"0 2 (`",,"`,,("@@ː `2 `$ 0 4  (`" , ,"`, , ("@@` 2 ` 2 $`"(("`(($"@",`2 H /d4* % $@" $$`H 0 _ p@ Z p` `@|4` S p` `@4` L p` !" H>y `   <` =s S` ?# @``4` $` %>@`yЀ `   4` `$@" '$` 0 > Fb$ "b$鏐 p`>`  > 8!*` >#y|  p`2 ` ` #  p` 4` @`"``"``@"` @ 4`  p $@ p" & p$``2` 㿘` )`0 "`4>yF!   D 0    2 $ `  ` `  DI 2` 㿘 O 0 " $>y!P " ` "`  "&  "`"1& `H  * " `"  "`  "@ ?H /d * % > Gaa &a" "a& H 0 㿘 b!?>xǐ!! @  6 x@  * `H@    F` "`諐  D2 #>%>'>!>>  >x! 4*`( "Вax *`X@ "" axz@#@  0 آ `"  0`0 2 0> Fb "b 0?  4?2`>x\"X` 2 0`  4@? 0 8`??`> 0L D" < <>  ?*@2 `""`"@>!@* €`  >x"" @c  < @2 <i  <>` "> 8!*` >#x  <2 `  >w"J   2  D   2 "   < " < <"<"  2 `8"`8 `8"`8"㿘 @" >w# * 02  2  ` 2 `"  `"` " <"  < "` <# <" `"  "`  "@H /d * % > Gaa &a" "a& H 0 㿘 b2?>we#(! @6  `"` " "禐  2  <  <   * $ ,?#>  w7P`H   "    ` 3  ` "`  " <#  < "`& < <# `2 ϑ*`"  <`0 > Fc0 "c0  < 27  $    $`@ "2'  `"  "`  "@H /d * % > Gaa &a" "a& H 0  㿐V & H /d!> 8* %!> 8$"4   %  "4H 0 0  `" & "4H 0 㿐H /d4> 8* %> 8""4    2"4H 0  V @>v{#x V "@ "  "4H p@>vj#?# @2  `  2` `p "@`p"``p&`p" @] D " @%#  2 `""`" @ 2  <`" <"`" <`<" @2 ` 2"4 `,"4H 0 0@ "4H p@   ^`, >@# `>u#㿘" D @6  ` "`& P  "$ $  "" 2 L  Dɒ L 2 L` "`& P  "@$  H $  H"& H L 2 㿈>  "H /d4> 8* %> 8""4    b4H 0 ̰ `@ 2> 8`< 2 > 8`D 2> 8`L "`8> 8b4H 0 >uu (0"b4 > 8b4H 0 >`  H> 8!*` >#uV    $` ` `> 8b4H 0 >u= p@!m b4H 0   ` [  !     P`*  :   2 0   0 %<`%D  L ` @ْ E !H /d4&b4* %&b4 C  82bb4H 0  㿘 >t H /d4> 8* %> 8""4 p ? 0 7  0 $ 0 0`2  p> 8b4H 0 >t    0 ?$ 0 qb4H 0 xH /d4$b4* %$b4 p  @b4H 0 㿐` 7 2 X <@   0    <@H /d4> 8* %> 8""4@  b4H 0  p@  2 pb4H 0  p   ?` >!X*` € 2 0'@ b4H 0   02H /d4%b4* %%b4 2 0'@a b4H 0   0 H /d4%b4* %%b4 `"` 2!` `0'@4  b4H 0  H /d4%b4* %%b4`2`  @  }b4H 0 0¢ $ @  @ b4`c '@ Zb4H 0  V 0PH /d4D%b4* %=%b4 '@ʒ 5b4H 0  1 0r+H /d4%b4* %%b4> 8b4H 0  >`  > 8!*` >#s  2  @b4'H 0 H /d4* % %b4Ӭ@  2pb4 H 0 H /d4%b4* %%b4 b4H 0 . H 0 ⺐$H 0    `B    ``  㿐 %> 84H 0 H /d4$4* %$4  " + DH 0 `h0e H o4I$4*@ eB$4H /d4$4* %$4  2  0'@ɒ 24`" 4, LH 0 `'0$ H o4$4*@ e$41H /d4$4* %$4  2  0'@ 24`" f4`c _    㿈> " a -> 8 14H 0  ! -> 8 H /d4%4* %%42   H p@>q! G4H 0 ``  `&   ` , @/ &H /d4%4* %%42 "   H p@>qd!0  ͖  > 8b4H 0 >qQ!P` 2$4`,@ϒ 4H p@  `, _H /d4%4* %%42L4H 0  `@Y`@R`* `` @@F`x``?*  `d, `0 $X찒 H /d4%4* %%42  H p@>p!p2 H /d4> 8* %> 8""4㿘> E# * * @א" > G2: @ > F> F @ > F b   "b 㿘> "> Ec1> Ec@붒 > Fb$` > 8"4H p@  g  d > Fb0` v"b0H /d4> 8* %> 8i""4h  c  `0> F> E > F`d` > F# #`d"> G> G > Fa` > F# #a"" >> 8"4H p@ >pJ!` #> 8H /d4$b4* %$b4> F> Fb  ` "> 8"8`& XԐ b4> (! Pۘ !$b4` $!H 0  㿘> F !> F!`"RP !耢  > 8"8> Fb X 㿐H /> G a>@ܐ!0S* %> Ga> 8   ?""4> F> 8<a*  ,  < < +!> !4H   ͖  K @!@] T0 2 a  <4H 0 㿐H /4> E* %> E# > 8  "b4> G!> 8@ *   : @ `2 @ **  @' "4H 0 0t>@Q!0p>  $ $$@ `<@"@a 2@x  ?I Ⱆ 0A ⨖ 9"4H 0 `` €    >@"0  ">@"(@ H /d4%"4* %%"4 "4H 0 㿘 H /d4> 8* %> 8""4 p Y ?` 6>!*` € 2 D`G D ?`A<  "8`8 `/  $@ " `) ``2  > 8"4H p@  >` "@> 8!*` >#n  2  > 8"4H p@  㿘' #> 8%>2  0@$ 0b4 p O# $b4 "  0 퀦` 0  F 0  $ 0㿘`2 tH /d4> 8* %> 8""4 t `#> 8%> L t`& Lb4 x N $b4 t 2 L` > 8"4H p@ 㿘 0(2 \>n"`X 4@ >n"㿘>"o㿐> "> `a> a(  >> n`%>  >o#@0W>>#hcp O . / $> G> Gc> G̒ " 8" " $ $ $`4$ $ Տ  ?"1 1 .0%> $" "$@  #`$ "@`$"`!  `Ԕ Y9 ׻ D朗@<  㿘\F!T@2& 0@@4! eg8$ >44l> n> G"l##> ~a(?c ?*`@   > G> n"`#a("̰  t @<@> G NҀ ` @  3 jNҀ a<@2].` #В  +| X!> ~!(?c |?# *`# <@ |  "!(>m(# . $!( /  $|" |$  $  4$ $ $ʒ &|x Ԑ!Ux"`Ԓ" @鄐a Z YFx Z`" @uLR t ?$ 㿘!   `?B`#+>$`@On` 2 $%   2  k  쀤  ,(" @(? *@, &  > 8"|c MZ `?2` 㿘֩ ``D@诔  D@ !La t -㿘؋㿘  <`>lx#  㿐>   " D `D 2`>lb#` ' ` T 0* @   H <0  H mW#` >mQ D >` "?>k 0$`NQ 㿘  ``" >k @    㿘  . /U $ 㿘 >` p   m 㿘>k 㿘 "   ` "      @  ` X  a쀧 >` >k] Ѐ`'@`L@@?"Ȁ "Đ@  6'Ę .`$*@ `&`" `` 4 @6 * .`( @ 2  @` ` '@6 ( "@ =0 * @ _  1 &`L   0"2`>j  0$ ,@ $ 0$ TԐ> b,`ލ",  H*Ķ `,`)`( @#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`ە   "$$,@`&?& 㿘 X!'`&   ` ?` >!(jx_   &@`S  @땔 >`   2 ( % ""@ "&&& "  @   @@u &&:& @\ `" `2   >!`j 2' 㿘> a> G  @ɖ> G> G"c"ԁ> G ܖ> G  ؅(  222㿘> "'> G%> Gܒ @ؓ*` "  @2 2  `  0 2  㿘> "    % T> Gc> G @ ؑ* @` `2 @`@2 @ T %  `2`#ܐ@ cؓ*   & " " &    2   "" 㿘 > ( c    D >!Q "1 V 4#  X <`2 @, ?@ !   @? &  `!& 6     !`      `  㿘> (#`"   D >" ތ *$ @  h' <  'Ȑ ' '  ''@ ` ?ǰ    @   X <`?   [ 2@ Tl/   %  "Ѐ` `  Ѐ       `Tj ?Ѐ     `'@  S ''耦'䀦2 X "X   ?'X`L'`|  `:`   2$`` 8$`$`  *'$`Ԧ@  a:`     > 0'$`  `` "`ܒ'> cT` 'ܐ "`` aB 2` * @ `* ' ` "`F` a`:    ٦ `2 H?' H@   > 8#`@ה ``>P@ `"" @$`Q`( * 2   ?"@`@``2' 䀥 '`@2` "' "`  2` @#  2`X @`$  "c $` z$`' @$`    `&r܀`| '$` ױ 2L `   @ @ 2D  "@ ` ;  \ 4` `$`taB 2` * @ *  $` 耍$` $`tؐ% $`t $`@$`ta,c` ~ $`$`x А(%   ? @VT@  ܀ 2`> cT` "`` `   `8>`> `@ؐ `  `  <`$`' ` >$`|G B ْ `!$`t" $`t`` 2Xn'@  `" "'@a" '@!@ "'@\  '@Ѐ`~   x ,̀' $  g`` 2X`   Y '@ (Q%  ܒ L #  ӐX `` `Δ06Ѐ`( %Ò   0&`` 2X'@  Ѐ   '@ @@ 㿘 >`X"x  g D`>f""㿘  ""  @ > ? @ $>g"     >g" @    J@ `@ &J@J   㿘`(2 >e"Ȓ&`.``?  X`@< 2 ..㿈 t  ? `v " X>e"! <@   #\:`  " "  X <@ X":   <@$"6 Xa`L`H @ X <@b`<@6 "`H2 b`<@&`H: ~ X X X`<2  ݰ : 82 t : <`:      X <@  ߐ    ?t  @ ("`4  `  X ?` <"@  @  Et Yt@   @X  : 6>dܐ#66>dא#4 6 X <@ " : {  )$x %:  8` ` x @:   ``㿐` !`:    \ "@ * t !"@  :`   F t "  2`X <@ ` `P&`䪒w 0 ``?``&`&`6``X <`@  t  {  $ 㿐`a`:  `  /" X`@ * `?&` X`< " `B0 ` &`6` X <`@ӡ`` $``   2D ?` ܐ  #\#`#h#d#l  ˚ 20 ܀ 2,     4 M  .`2M  "  M .2    D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`#  ܔ`X 찒 <   #`#\ #d#h#l   V  2>dА#0܀  2 㿘  X @`!! @f @  " D D 2 !  D@U    㿘@ܐ`I        @,2`,`  @l 2-``,  *`,` @   #> 4  c C     , @ 4 $ ,`ސ  㿘T  `>b#/?#  * $`*` @   " ,#> 4  c CS     , "$ ,$ ,   4 `ؐ  㿘 @.  , $ `" (  2X E! 2S E > 8X# `>c#C  ( C`"B  , >  . Xa ,H@ $ <! 20  > 8X#>>#`c\# >  H < $   2 E! 2 E > 8X#. `>> (c?H  4  E 㿘@ `    @,2`,`   @j `-``,  *`,` @   #> 4  `p B     8 ` 4 $ 8`ސ  㿘f  2?>aɐ##ߒ  * "`*` @   " 8#> 4  `p Bg     8 ?$ 8   4 `ڐ  㿘 @.  8 0 `" 4  2X E! 2S E > 8X# `>b xC  4 C`"B  8 >  . Xa 4H@ $ @! 20  > 8X#>>#`br# >  H @ $   2 E! 2 E > 8X#. `>> (bU  4  E 㿘  Xa쀢  <>a)    >!> " @   @ ` a! 㿘 <  H `<    坐0 Ha 2 @>`!0'أ.''''ܐ  Z` 3<` @ǒ J @` <  *`< @ &`<@  &@$N" , " 4@#@&&  @ߘ >A < 4& @ 4&@ې >Aap2   -@㿘 < @`䴐  ` *@ @" 0 㿐ap .>`]!P   <0 @>A ,@''c @?  $+?$ @ ?,@   .`"`<*@&`<㿐! @[   $ @\ p!䮔  @?Ԁ   " ,3> 6  ap @     ,' 8'   <' @'܀ " ,@  ( @ > . ,@  H '耢 " 8@  4 @ ؙ. 4> @ H '& $& (& ,䀢 & 0& 4& 8& <& @ ?# @6  8 4@? #ߒ @6  4 2  ( 2  0 2   $ 2   6 ?# @6   6 @  p! \ @Ԁ S  " (3> 6  a @   2  (`" 4 ,   > . ,@  H & < 4` 8  쀢 . 4> @ H & @& , ( & 8 ?# @6  8 4@:  ?#ߒ @6   6 @]  㿘>  <`"`D   ,  @ `"  ` " @a  $ 㗐 㿘! `@   *`">Ca\|  㿘> a> G 5 > G"c> G#"#"`p. @>  < `> G' c<> Gc *  !> G# 2 2    ` "` "  "@V' 2 > G#'> G` > 8> !*`  "     n D@ D ($ >^[!' D ?@" >^X!` "` "  "@` "` "* ?$ @`@ $@" $@$  4 $ $ 4 .  .`@  #@  $     $'?''''''' 3а  @ @@ډ @[    @ 4 `"  "` "@@2.' 4 2  ( 2   0 2   $ 2  4   "' < 2  @>  ,H $ < @ 2 ' 4> @H $ @' 㿘`` ?6`` @`?* ` 6`> G&`c``&` `""`p> "`>]!` 2`Z >]!`` %>`6` Ȗ >) `  Ò 5 ` `* ` 6`  ?ؚ`$''''''''} ` " ` "`?ؐ`?# @6` 㿘   @`"?n&?  㿘  >`#&2  `   " ` !:( K``H    @ #1 %!" 2 &$ )# %rV Ӑ’ 㿐 `   &@㿘!拒`@  `0`4&& 㿘> ~a,  }"a, 㿐 `` &` a`@"& & F 444444D\DDDlDxDDDEEEE8E8EEEE㿘 > (c* @  @ b "    q  㿘 > (@c* @`  @ G "  " V `` "``D?2"`໰ " <$ `  2   `"` D=5"> H" > H H@":H> H""> H" > H H@":H> H"" 㿘  `<`>E#*` €X <` j 2`   @"    ,`! 2 !   6"> H" > H H@":H> H""> H" > H H@":H> H""""22" " "D:"$"(","0"4"8"@"< <( " 2 X@" L" : 0( @( :H < "H:P㿘     T ?2  ?2  ?2  ?߰  D? L? !l`  @$`  @?c ? $` @ @$`` $` @`  ` @  2X ?" X <`   @ y ?2< ?"" $< "m  " X a "Xa <`^ a  @   R $?2X ,?"5 X <`2E a@%!: " $ X 7 : 0 $?" ,` $` ,?"a` $`a` , $  ?#  X <`   @  J 㿘 !@ :% "* "  < b"!  O! % 2 d"  < o @ @$ 4  @ b2 @D 㿘  a"a a@2!:@  !:a  %U 2 a!:%c laa a "| ^֐v$a $ak 8 1w Ζ0%T >Y"02`` $`  ` 74`  ` ;4`7$a $a, !I8   㿘 `<  ` @2   ` "     ` ]  X 00ݿ㾐  $ >Y "H< 2 X)y X@!q   Z 0d`# T ` @J `` `$`4`$`X+<"XѐX`<a2   є "``?``$`4`$`X <@"ڦX " ̒  ǒ  0㾐   >0=*>0:X`@ B @ -`(2X>Xl"` @`4'>Xe" `/``” /  X @`4`>XK"*  $`  X?"`$` ` ;$`㾈     ''$$2`X>X"X  " X /耤 ܧ耢 ܡ0 ` ް  ` ؒ@ , `< ϰ |z ? %>Wǐ" %쀢`_ [[  #@    @ ` @   <  :   y   耢   p  Ғ g  @J`.@       J $`  ^   `$4$ X`< ;`X< 2`   `    t`2% # `" ۮ y  @2>V#: u  `2w``@>V# 9 7`#S `` `$`4`$`X!<"XАX`<a2  "``?``$`4`$`X <@(`ز$` ՘  ```?`$`4`$`X <@ "a؎a`   ` `@>@>Vl# `@2`>Vd#0""`  `" `a@"`a Ͱ `<  ` ° B`l  B ˩ < 2  2 ` 2``?$`X`< "``?%``X < #X <@  2 ```?`4`$`` ` 5`%`   !@ a` څ萂  } ? %>Uΐ" 쀢   ">U#HͰ 0^@">U#H  > 8R#$   ` %`쐂 `ʒ ``6`1ڛ0,`)`'` ?$ܒ  ? $4$ X`< i0oh`  `$`>UQ#h#@  !  ԰ 2   $a $a 2    "`  a`  04` $`Ԑ "`<4`$`!X <@"  @"` $` `$4$X <@"XX`<2  2X @`> 8#> 8#'' '  '"''`''a #\  N `" <`$`Ԓ @;"АH X <@ Д"`<6 Ԗ"`H 2 Д`<&`HԐ`X< a2`  "X  <@ yа  ԔА 2 "` `!"@!?`$4$X <@"`\`$` $`4` X`<O  㿘  @  " @@0ѐϐv  j   f B`D` 2`] B @X   @"`Q)$` ?$ X`<"``n  ` $` `$ X <@/) JX <@```$`4`   ?4 $ X  <! @ @?` @ * [Y㿀 (`  @ /  "Ӓ @S X @@ 6    <`$ <   #`#\  #d#h#l   㿘   !o $" "    2N  "J > >SP# "@"  @ D  4@#@ #@<  ,, "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  )    㿘   Ԑ T㿘   T ɒ`㿘 ` T㿘` \<? >R# T P@2* T   T " T 0$ 4($ 0H /d * % |H 00,?2 T H@ <$ @ T?2 H /d * % ]H 0  > *` $ D#h8*` € 㿘 ? > # 2   S  > #SV  >! ! S  <`G  T>Sΐ 8 㿘 > )`> `"bX!* @㿘 > )`> `"b!* @㿘 `D A`  `  ":> )  # >  H#    >  HH`B # ; H  "# ?>  H# "> )  # >  H#    >  HH`B # ; H  " ?>  H#   ?# > )!> *` €㿘 > )`> `"bX!L* @㿘 > )`> `"b!L* @㿘 `D A`  `  ":> )  # >  H#    >  HH`B # ; H  "# ?>  H# "> )  # >  H#    >  HH`B # ; H  " ?>  H#   ?# > )!> L*` €`>F(`  `   ` $` "`     㿐   `P` #\ e 㿘< > (`cx 2 @`!$ <>F 0*` €$ 8` >  &  @ᐐ*$ @$ 8$ $`$ 8` 2`H @ $ @`H>  T <`H T *` * " *  * " * <`H&㾈$`>Pސ @'<& `   n0  $a  `$a 2   "`n a`  PN0q  > ($`4`cx2 @  " <4`$` X`< "`Ҙ`$"a  2  ) "` ;4`@` $``X< a2`  2{ꓘ 2@   & `$` $`4`X <@ @ P > 9 2 > 8 8> 8 8 8 < "   <  `2``"`<`@ 4$ " @  2 `@" "  2   , `@  " "  @  2  㿘' >Oʐ x `"/ "  @"' : 2   (@?& $@&&>S#@ʐ $ & :  `$ $   '>@>$P  㿘& ` L<@ 2@P`(@Ӳ?`(\ >T!4@ "2 X  @0- `"ಀ" > Pܘd>OL!@Β > G> H  "H"  &>@0>!@PLd 㿘& @d  ?&,    $    㿘` ` ` @& ?# ?*  *2` 2  & `.괆<.` (@ ?    㿘  "f. @@6&@  , f@|   ݲ`f@"   㿐 .`&,  `R &?*  }&  0q H  $&@ 2 &@V &: * N& : .&@G2  `2 "  @ 6  N "*``@ &N  @ 6 N "*``@ &N @g - :`*N & :   >!pOĖ$>N4! * .  .`&,$ @` ?2` ,& $  㿐 .`f, `|  ?f*  f 1 0m H`(@Ӓ `(: * L& : 5" :`2  @ɧ   @ɟ   >!O`d>MА!ؐ" L*  .`@ *  >"OMd>M":*  &+@, `<f,?$`  ?2 ,ff,@ ` 2`X`(ր 㿐   $@Ȑ&@ @ > O"8> @֔P0:&,*`?&*  _& 0* H  $@B&@ `:`*L@ &@ :  @  >"`N$>MV" * +,@  &,`$   2 ,&㿐 @` 8 (> "M7$@m&,,  ?&*  & P 08`H@ (6`L@ `: 6` >"ؔN$L&`6`>M" @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,& 㿘 ``$@Ѹ&`$2 `$ `2 " @Ș@  @Ȑ   >#dNQ >L#8" N@*   *   >"N?d>L#X㿘>c$L 0 ?'T'P'X'`' ` S .` ?# -?* *@ 2 @2@ #?f?e R0ҒaP  *` +  2 2 % % $ `% f k 'fX*@ `" TH@<" @ᴖ  4>L4#  * ?c '?** @ 2 @?2@ '#?>'   PB m% 'Ė f  'f*@ " TH@Ȃ<" @T 2' @ @*`* @22` +   %   '`%  S `M,` Ö P ,`%% *  f ֐f', <"TH@8  "`@ `'* @*`@ * ,  2 2` + $ X ,`J,`* f?m ~? H+`c **9? @ 2 @2 @ @ 5? E TP XX %**` * , @ 2 @ 2 % @+ % `$ ff P f'X, # T H@ǰ <" @ T"@P Xf? Bf ' 'f, " T Tb#@0,@  @ef`@  &D "@* * @f?ɘ ">Jڐ#@*X H`$ *@,`* ' f Ӑ' 0`@" 0ߠ @$4   " `% % 㿘 "   ` "      @  `X a쀧 >` >Jy @`'@`L@Ϋ@?"Ȁ "Đݖ  L'đ.` ?c ?* *2`  $2 * ?&`ܰ `` @ԑ.`   * *  @3`* @ ( 3  2( @ 2 @ `` '@&  ` *` ?# ?*  *2` 2?   > hK>I %0 k   &`L   0"2`>Iݐ  0$ ,@ $ 0$ T> b,`y", ? H+`c *`*?  2Đ 2 `, `)`( `@#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`u   "$$,@`&?& 㿘$Ȑ?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6`  (  2* 6`  <+`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  ͣ&`p㿐 > ( c  ``D >  "5  21  $ `X <`2      @?>  H H *`" *  * '' $ $       @  Q `͞ 㿈  X`< 2j >  H H *`" *  ' * ` '` % `"@%    " H`B % = H   ?H%   ?%   2 7 ?%  `(? @f,* @@y@f$`?f@*@ f찒 " 0 ?%  f$?@a H* @ < 0 'T'H `<?   `X @@    >FT!@֐  `& B&       `&  7    24&(1&& &@ƐD  T`T 2C& @v@v~`nT  T `&    ( `2&+& @˕  TTQ 2& &@vp@vLT$H@fT`4T&T&  : D&@eB??'&2`$ '&2 ΨX$'D'&: 'L   Ȳ? О? ؆??  ? ?  ? ?'@ 6 "@ ."@ `&    D < <&  (> ߒ > " T А?'&2`" '& 2 J?"@'  8? @ @ *`* 2 2` &@, @kP 2HP@` 'H&H 'H@ $ն ?# ,+?@ @*` @* 2 2`  &@&H: 'H> 0 D@"E@>  D@"DX2 & `l >`p >D!p&   H "@ & & 㿈  ''X'P    2 ͱ?P@Ӓ: ' ј `0" > "`, ",`0`<@ `8$`0$$`T>D!苐J PŐX" `H  ,2" * @uؐ 2'2 ?[?)&@?#, ? @ @ *`* 2 2`  . ??| 2'?ݲ@ $P "`@,  ?c ? + *` 2 3  . ?N 2'`ْ  X`0 $`0CX"|㿘 !@?c ?*` * 2 2 &@   .`.`@``` `6`h     <`  f  2  ??? ?'''''    4 . "@ @' 帔 4?$c* @  @  E"@&@@: =`  * 2` 2ݠ =   `   2  8#@ #@`  '@ ""@"@h ? @' `'' `'    &'& `  @ `X <`? Y/ [ 2 `Tǘ/ @ Q - "Ԁ  @`H Ԁ`   @  + TC kԀ  @ ` -`& ''耦`'䀦`2 `X @"`X  ?'`X``L  |`"$  @@$   ' $  :`   @h  ' ?@Ư[ ' "   :   @G פ  ??'' H@   > 8#`@  > ?  %  $ Z 3 ? 2`*  * 2`  ?"  2`''  쀢' '2`   " '耢"  2  @ɒ  "| ? 2` *  $   * 2` ' @j@܀  | '$ ```2D @"@ "<`X <`"1 㥒 *  ?@ʍ'$  $ t$  $ t؀&'ؐ@z $ x`$ Ԑ($ ?@z`x[ ? ? + *2 @ @3 @ $   * 2 $   ?   >&   ?`$ $  @``  $ |`F` @A, ? @"@$ t$ t  2`X&   " "& " & @ "&Ű  &Ԁ` \ y `,Ѐ' @$ h   2`Xa   Z &(R$0 M @$ '`X ` `"07Ԁ`) @&`  R0&   2`X?&  Ԁ @ &@i 㿘? #`  `  * 2` ` >$" >"8` ? >"P >"x@? *` * 2 2 >"?@# ?*  *2` 2 >"Aɔ>@9" ` (&>@.# ?# ?*  *@2@ 2@ '/ L #` ` < 2 ?` >^!`*` €           //Ut` < ??>?#( :2+    ?К'''Ȕ 7'''''`X`H  >?#@?@ȟ$`$Ě:   @ ? c 2` *   t @ &" `  *`@ @4 @   2 *  "@@ ؔt@  @@@?>?g#`# @ `*`2 @76 ?>#@>?U##@`*2  *`@ @74 Ť:` $x`@  :`  㿐  t` :   @ ("" :   @ ?  @ ` *`2@  * 2 3  `$ 㿐 :   @̘ @`?# ?*  *@2@ 2@ "` `L %``  <` 2 ?` >^!*` €           * *  `$ `    2U P` ܐ  #\#`#h#d#l  ޏ 2A ܀ 2=  $ "?  40 L .`L .2& ?c ?*` +  2 3  ?   *2 @   D 4 @8  `` ` 'G E B ?*# 2< ?  3 ? *  *@2@ 2 @ @`$ ¶ܒX  ܰ 2'< ߒ  #`#\ #d#h#l     2>?y#>=# ‰㿀  ` `>> =֒` `<`X @@ 2 ഀ 2 >> 0=` ( >> H=`    @ߑ; B?`  2`` (`0 2  `@  b   _'@.`    `$' <2@(*@@ ?$ ?'#\#`m  ?H +%$`@$6`H `Hb t'` `  b   ` "`XZ`X  <@  %㿐 `>> =`X 2`< "#  >%> %>" <  @  `а  >> h<`X> <ߒ`X`,   : @@D B?2`<@  `< `` B    q  `    `_ @:   @"* $ ?   D <  B 4       @l%@l֐@"@@& H{`  Q   "  %`2@       35%@ @ b $ <@ `  3 㿐  f@' f? 20 f H @ & '㿐> a > *" *  < *  T:` @  ;)>"4 t 0@2/ t \ *  ? 2$ t` @2 t < " t T4 t: $ t>Ý  <  T;  =@?>;  t ˀ㿘㿐> "> `a> Ha(  >> n`!> @# >;!(>>!PaX ##0J@;  ?"|/ #07> $" "$@  #`$ "@`$" a "$@ܐ !ߖ  L`  @ϒ @  ?Җ @[ DC 0@   Ք l  `<@@"ia N #`@  @ @   :   6:@Œ  ڐ .`<@0@# N +`<@( ``L @Ւ! 8 0 4: .6: 6: . @đ @&(&&$&&,;  < " Ð > Z `܀& y `"`<`< !!` ܄ 10] `<@@2@9   "a0B !"d@" L  ` ? @"@ @א Z` Y Z`@@ǒ" N  : .>  H&0>!h;@  㿐`D `E ``Z > ``  t "`>:!@ (?@@,* @@ؐ@8$`?` @ *@ ޘ @  $?@ H* @  0x`< 2a    -  >9ǐ!`h ? " (:  @n$ܬ $?  `< H `@ "a0Y`  4" @ΐ$, ? :<` 4 8 `$$$ $@$4 ($ @$$#$($* ?R ܐ`HG, ?@3 &>h''''`㿈` ?+  > #@    ĉ `<   ?  `h f ' $  @H 2  ! @!  &0&0 @% `H '  ,: 2 4:4: , " @ $, ? :<` 4 8 `$$ $$@$4 ( $$@$ $(   $$,$* ? .`H}, ?@i' &` &a&`d`< < &`@&`h&`<% %%  2 %  % (% $`&" ,( 쀢 "`Ɣ  =۲      &a㿘6` `@C >a` L& 2`@   2 ` : 2` 4 :@ ``< "``" ``كL&  `  ?`&,ʒ ǒ Ē `<*@$`<$a㿘!  Y` ځ  F 㿘!; cS`8 "f>7ܐ!f(```L5@`d 1 f  f D/`D    @   +` + *@ " @ 􀢀 񀢀   2݀f f D`D&`f&``@"&` ` &``"@&`@&`` &` `T Z`  Z `@  㿘 <  ` 2` p ` ``  ` `` 2&@ 㿈! Lf   >!8֒d>7F!>jc''''耢 2` ؖ` ٿ 2 ڂ Lf  > ,f H$`0@ 2㿐a $ & > H    }& H! @}! > T Ҙ "$ $$ $$!$ "( ΐ0Z@,* @@ $ ? @ *@  g<&@$ H* @ $> H> H ~ " J!& :$  > G> H  "H"$X <` $ &㿐!`  2' F (]& ` &`   ` ``@"& & F   2@ "`"` -㿘   $ X `H$` +㿘` f   + f`$f* *   + ff, ? Hf`]f &f  2㿘 8?c  * 2p cS " Le ? * *` 2 2 ?>"   *`*   2  2 `>"87N 0A "?  T @*` @* 2 @  2`  > X  * 2` >"p ` @*` @* 2 @  2` ?>"7  0`2  d @ @*`* @ 2 2` ?  dd㿘 > (c* @  @ 㿘 > (c* @   @  @`  #  D?c ?*` * 2 2 # @ @" <@$@`฀  `   㿘   ` "` ``  ` `  # > H#   >  H H@# ; H > H#  #  ?#` c#` ?3` 3` #` #`    (*` 20 #`D  ;` #`(#`$ #`0#`, #`8#`4 0#`@ 2#`@ #`<`<( #` 2`X@#` L#`   2`*  *` ;`H`<#@ H;`P㿘     T ?2а  ?2̰  ?2Ȱ  ?İ  D? L? 3"< 2X9K X@1C   j $06 #@( %  0"  ` 4 $      " `   $ 4 ` ' n`` `  ` `'`'`$``$2`X>2"X@  " X@ Ð؀ ;؀ 5հ01  `0߰  ` ڀ ( < Ӱ Ք|z` ? %`>2_# %@ܔܐ Ӵ #`@ ՝  ` 0   Ր  `<  8     ؀    ܔs t ` `J`.`   `  ܔV W $`  ب  ```4`$`    ܒ 8f   ܒ - 2%# R " g  N@2>1#8 @ب  2;  `@>1#X #@  ` 4 $   Ꟗ   M   `4 $   ꇖ  l` @>`@>1a#X `@2 >1Y#h""   `"   @"  ԰  <    ư B €  >      $ 4  ?5 ?*` 5 >1#   ꐖ   % ` ? %`>0#7܀   "`>0# 0_ >0ݐ#JH   4  $  #`#\ #d#h#l   Κ 1  >?  >ʂ  ?#?*  .@2@ 6@ '#`#\ #d#h#l   П j 2    ?`5 %   ?%   $ `0   ` ?$`ܔʒ   `` $`4`0i܁`` `$`>0K# #@  !  ௖ܰ 2܄       4`` 4`$`4`# <:4``4$  /  y@ `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#`/#\ #d#h#l   ʚ 2 X ! @&H $`>/#$` $`t "` $4 " ``4` $`<"@K 3㿘   ` %9  . B  2 % B "  0B `  $ 4  4  ڔ  `㿀 (`  @ '@ X @@ 6     $  $   #`#\  #d#h#l    㿘 X @@ 2  ഀ 2      㿐 `   #\   P 㿘< > (`x 2 > b'$ <>l#* €$ 8` "`: > ! & $ 8$ t$``$ 8` 2`H @ $ @`H>  T <`H T *` * " *  * " * <`H&㿐$`>. !<@& @  7 0M @ > (x4  2     4 4 $  " < 4       ;4   e  2 2@   & ؐ 4  $ 㿘   L`?    `?1 㿘> (#`   D > 0 }t " &   H$   N㿘> Hcc?@  >>> P``-ؔ B6@ & >-ݐ Б* @㿘> H##@   >>> P``- ^ 6@@  & >- .` .㿘> H##@   >>> P``- 6@ @ @ >-! .` @`>-!@``"    > ]! €   .`  >-y!`  "  *`"   $  "㿘> Hcc?@  >>> P``-K 6@`@ @ &` >-P!x.`@ 2"@ >-H!`` @  *` ?.`# `@ `* "`?#`㿘  &   &  $    " $@ $ ?   @ 0@ 㿘  ?@0' &    ?&  $    " $@j $ ?   @z?0@u?㿐> &b> H>#\ aؒ (  # 㿘> H##  >>> Pa(,   6>>> PaH, 뀠> H@?2 `$ 찒 ". * 2  * & & & && & $&  b &  b  &  b  &  9 b 6 b&?`    @e*㿘  >   >>> Pap,N!  b  b  b $ ?"> H b> H &㿘> Hcc ? $ P"@ @  L>>> Pa,#!7 @ 2@ >>> Pa,!86@ ` `$ ?@ 0` `$ ?@ 6`" @ `$ `$*  " * ? ""$`?,2 `$  ?  b-  -`$ b?$`$- b ؐ b Ӑ bΔ ` & `>>> Pa+!% `*``*` $``*`*  @`$` `* ` * @@`$#$``*`* @ `@ $`$" @# `$2* *  $ ?$" b$` 2$`/ b, b ?% b㿘> H## $ "   P>>> Pa +E!2 L` @ .1> ]` , @ "    !€ &` 0 '> ]`,   L@  @6 `` *`  ᬟ€` &`㿘  #> ,  *` `@ ?+cX "@@   & & & 㿘`P 28 "*`$`$> H` c"2   , @ƒ@@@* `$`$@@`$` &`L"@ &`P`8 > H`8 ?&`8`$ ` " ? >>> Pa*"v 2> H@? `" 젒 "- .2  * $ $ $$ $ $$ $  b셔 $  b~  $ w b  $  . b + b$4  W`P    `8 &`8 $ 0H@6! `L+` @ *`  "  @ `"`@ "@  "   *`"   $ `@&`L +` "   @'* `&    ?&  $  ? c` `$" `?`L@2 `8&`P ?&`8&`L㿐`P @V?#->-`@ - `2>#x) $?`0 2;`(   4`("  @   #\   @=>  `  ">@>@D6#@9k- ?$ " `( @@9 6`(`@&㿘> Hcc? >>> Pa)#\6 2 >)#" " 4$>)# 2 @   &` `" &@㿘  b* |  & $?& $  @i*  $  8"`"@㿘  $@@- .`,``  8 @&@ $  $ "& $ $  @@ڑ,`` -`  8 ? @@>)  S,-@,``  8 @$ $  $ "&  $$&  <>( 8@ @`8  $$ %8 $ $ "`2@@@@,`㿘 6@:  6   *  -* , @& ! *@"@  @  +`  ?+ "    *`"  ?& ` @qˀ㿘> H# > I: "aP> ~"0@"㿘> H#`|`x@"@ 8$`|> :`p. @   b> )>([  V " " > ~00`""`" "0 @>`x `@$`$`x> I $ `""`" > H|  |> I` > H "` "" " 㿘    0  @D !  " ( 0  ?>>> Ȓ`ؖ ' $ 0$  "> ] 4 (! €@= @> I`> H& c`"` "`㿘  @NM   & > Hc`p?"`p   0    .2 ." 0㿘> ~!0 "!   @6 ,`@  6  @ "   `@&  2  㿘  @``"$ ``" `>> '{!8 ` @M $`  (> a?# @4 (> ]a€ @6_㿘 (>` $ * @ @ >` 2  2 > H !^  &" $& > &   @* @㿘`  >D (!>'$!` @7 @   `1 >>>!a8&!\* @ "@   " ?" `"`"> H!  0` .`@"@㿘  @0  ( &/> H $*@`> H#+> H `,  " @M= p?$p  , @ aТ  & $ $o cⴠ /> H> H# , @ " @M `p?$`p  &  T c ]㿘> H# `  . 2@ > : > ~>&"H!4?$  $ $  "` > :> ~`!4>&n"x  "> H"  $ $ $ ``*> 9 6` @ : ! 8  c  ( $ $>&J". D c $ >&@"ؔ@2 `  ?$ > 9#$ $$  $ $ > ~ll $ ,l ,"`0"l$ 0㿐> ~h  "h> ~"!l> ~!> &""ap> H>!Кc X   "#\> H>#\"c 4   㿘@ " 㿘@㿘 ` 4 1&  ,`" 0 0"`0 0 ,"@   > H# ( "> ] 4 (  ! €@] @-@:ސ  2 (`  & А㿘 `  > Hc    * : : > H8    +@; 8D ;` @  2 (  >' #` * :    :`@ d2`*  *`  2 @ `  ` `" @3m  f   $` ` 2] $` W @ :E4 @3 C` "  49> 6> 02> 0 21 , 2-> ]! €@4$  0 2 , 2 (  4 (> ]! € @ @\@: $#P` ``4`` 㿐'Td@h   @Z > H?#c?H@3" 1 @R      @  J `* `  .`@ `#\  @7 "@`(`. ` 4`(4`.@`( `! @ > H `4`(& > H#` :D@T"   @ ?#  2|> H@w> H!> H# @ `!  `4`(>x" `4`(& @2 2`(#\  @7 2`.>@>#h 4`. >> H  "  @  `* ` .`@`2@3`(@J  `( ??ƒ@Ja `(? @ @9 4`(0> ab 4`(€&> H#` :D@{ 㿘 (   >>>!a#$> ]! €> H#@\ @,`&@@8ؐ  "   "  >>>!a#%     >>>!a#%  㿘a @J 㿘> ~!l`@ "`,0  㿘  @,  ( &?  $+ @`"? `*6 ` *`@-@ " (&*@`2 ?< $ 6  , @ 6  @  2  &  㿀> H#'.@  :`  #\'  #`#d= ",  &  (` " >>>!a"%˔ @In ?(# @2(> a# €> ]a€ @1> ~ t> ~ x㿘 > Z* @*`"@*`  `Z>"D@U>"l@QO 1> H@?E# :F #> ~at`& (`2` ` (`` `&`>> ~!x"V at`` &``&`.` ?,&` 䉔 at``2` `8 at > : & &&  & &  & & & atat`&  "`$$at& $ " 㿘  ?1&   >   >>> (`8"8!9    & >> ~!x"   ` $"`$ $ " Ɛ  㿘  8 ( \ ` >   b   X  `> Z*` * " *      0&@ @ `B %-> ]@G% `< @h@  >   b  >@ H# :`@ D @ ,> H,@@?   >  b ݶ 㿘 +>  & &   2"    )> '> $   ؖ U  "`"ݎ 2   $  @  2  (  ` #`b u   $  " *&  `8 " `( ` `b ] &  `& , `8     \   8`  > ` b` ; >@;    b  + 㿐> H# `"   > "a(@  "@> "a(D "D> H#    0  = "1#\ ( `! `ݰ 4 (В`$     ⬐  > " <   ⬐ ۔ >" ,     @43    ⬐  >`$@;+!(    ⬐ ܱ `$ @G  2   $ ` "`>  ⬒ ܖ   @⬒ ܌  ܢ  $܀ L` ( " ( (?# @` 4 (> ]! €[`   ⬐ e ԰  C$Ԁ``2  >>>!8aH H!&@F ?& @5o`   ⬐ B # > a"@@/`  "  L <"    ⬐ %   $> : p> H'Lcc  `?'D'P# .@ '' +'ؑH/` /> IaxH @ H*L:H 0  ' 6 ؔ'<''` > >Ԑ ؐ`" ʔ @쀢  >   ۼ   $" *'`8  `(> "  ۧ ' `'耢M`< P  > ߒ  ۑ  ` 3 H 'HL`H 'HH`2'P8 P (  > b  h > H` "`P` ( D> "  S  D`1T> :* `H*  @  > H>>>!8aH0"ѐ  @ #2 8 $@ " 2 ?.@ #  @  'D   `   L% ?  T`2N'@`&$ #. @ "   "  ( 2  0 2  , 2  > ]! €@- &. > H#`4` %  .@ `     `.`@> H`.@ '@@S X ?@ > ]!pT `:&@`"7&@ X1&@@" +'@@ `"'> H`0 2#> H`( ! 2> H@-ܐ > H#> ] "ؖ@ ` 4`H   0ah@> Hc``@@` P @#`#\` <LX `r 0u@ 2s'L> HcX "` `0%`8B 'PPP P #\ @ T#`#d  P`I'L @E> H# ->9>`21> H`( @>8!H#"'L@-P > ]`$ؖ8 `4H   0 ah@?`( 2`(> H#`@Ǡ @'L@ - @<`! ``>0>Ð"P  ` 0`@ `2< 9`#\     @1 2 >  b ٝ >@8 "8@-?> ]! € "  `0?"`0 ?"  . 2.$ .(  @ 6.6(&`Y> H U> H F$   #\   @0ʚ  2,` "C> "  P ph@ >>>!8aHH7$@2̰  ">`$@7"pX@,ْ(?# @6( Lܖ u# @? $@c `"  HPܘ 4 0> ]!h @ >    > H#`h`p  >>>!8aHH$>@7\"L  @+|(?# @6(> @,,>  ) L?'L ? P>>>!8aH%.  `8 @ L > b!(@`"@> (bD "bD  ؤ > H#  "'PܞL` P`4" `8  P P #\  T#`#d` ` `>>>!8aHd%Wư > >"ܔ  " > H#`ؐ $`` "> >[ " `Q @ > b F  `ܠ  $`L (`  `L A"  > ߒ  '  -L`( L L( > H# Ԓ`" $  >>>!8aH%€ (@+S L? (c 2 (c`> H#! $!8`2L0 P`2#\Զ     @/C  LL`( Lq L?(# @2(@+L> b  ”  >`$ @6,"@+a(!?# > ]6(aL€ L`( LG L#( 2(L  $@0&  @0!'L>"i L#\8@?    @.  =LL> `(  @*LL? (c 2 (>   b > H#`p`h@ >>>!8aHHH&M@`̰  &`4`>`&`@5#(f؀?#> H> Ha"a@*ߒ` > ]! €LL`( Lǐ L? (c 2 (L@*q #a  "a  Lܖ b# HP`ؘ 4P 0> ]!h @ *L( "((?# @6(> b   > H`h`p  >>>!8aHHҔ&>2 @5G#8؀ @)h. ?(# @6(> Hc @a  0(@*( "(V(?c 6(>   ֪  㿘%> H   @ 0  㿘 !> > آ " } @ " t 㿈  >>>!8aHHZ'2 H@ > L >>>!8aHpK'@@ @>Q#q> J %>'>> ]!p >@#` @:`$>8H&'N@  (`@>` ('8H('Q H`> H@:n> H# > :` `2 > J 2`@: * * 2`` #  #@2`@: `2`? **`"  *  "c@(c@@ > ]㿘  > H 8  5> :p` !> >Ȑ h`" վ p@p`" ղ > :`l   > #Ȁ@ > a`* @* 㿘  %>   > h Ջ > H 8  @y { 㿘> H#@ 8  @ ɖ㿘> H#@ 8  ْ@ 㿘a(&` @> :@ &` > :`p   "" >K &`  @;   D`"\@Hژ㿘!(#> : @!% ,`p & ,`p@&!(  :`0  :8 :`  > H:(c``(   :`P㿘> :p !([@ H /m4N 1* .N 1  @$ , & ,H p@> H& c` "`㿘> #  J1 2, 2J?* @ "@@ $  2J1` > H> >"  r > c``2 > > @3 > 㿘> #    . "-> : ,  2#  2 L 1   (  4  x@ @@$`(    2 ,`> H@* 2@   " @㿘H /m * .  ,N 1 ?`& ,@H 0> Hc& `> : "`!(p@  @9'@㿐> H#`2> I>&   @ > J("`@(@ @@*@/8@*v 㿐   @  =#@{ " > H# @  8   f 5> :p@   Y㘀 V 4* *L K $@8Ҕp $`!   /> +> $   `ؖ ]  `"Ӗ 2   $ p@p@p` > " `Ӂ   @D   p㿈>'> I"!x> IQ"at > ~> ~> Ib`0"ap"0"" ""> H##!L> ~""H"H"?"" ""!> ~#!P"!@6 > b @$!E#'& #`#\ ?@ d? >2!P> :" p㿐\`@> Hc#' *@ #`#\ ?@ C? "@>!&@*  @@ 2 @>!@$@@N >!㿘 > 9#@ > H>>>"b(pϔ!K#&2  *  @G   @%1  ( " 4 ( +6@ @+ܐ@@  0+  (      $8 2 $( ( "  4 (@/`@+ 2 㿘 ? > H>>>"b(o!# &2@  *`@0@g!>#>)>'>%>   @$̐ c`( "`."b("M!  "b(E!"b(?!@+k c@@ ܘ 0: `7 #>%>+>)>'>` *` `$@8% 2 `$(`( "`.b(b!̀  b(" !b(!@+0 `2` 㿈> b @ > H>>>"b( !#  H##  @* '#`#\?@ ? G  > :C@@>  p`H6" ?#'> ]%>   #\ @)) `( 2`(2 `@0$H?2 `4> b , `4 c h@ c&@2Ә 㿘> H#@ 8 @@ 㿐 !   #> &   `ؖ 5  > "`"m 2   & > H# @ 8 @ @A > "  Q  @ 㿈> b @ >>>"b( /"> H# > I` H @ #'* '#`#\?@ V? > :O  p``HA" ?#+>-> ]  @#v " `(  > #X2`(  "c !`#\  @(\ `( 2`(2`4>@/Y# ` h@ &@   `ɠ  @Δ$㿘@ 㿈> b @ > H>>>"b( "> I#?ap H@ #'* '#`#\@ ܘ?  㿈> b @ > H>>>"b( ## L@  H* "@ @  #> I`  Hc''#`#\@   >  0 `㿘?Ŗ?㿘H / * ' > H#N`?H p@㿘H / * ' > H#H 0p " >/#Ѐ  '> H#-> '''''` "`>#  @ ;쀢       $" *'`8  `(   ' `'耢V L ( `6  $   ؒ@M `ؒ@  8`ؒ@ ?  ? > H# @ Π   ϣ `*@& @   ϖ 2v' Ԑ": ` @$ @2 㿘".     > ]! €  &@+"@ P:   # !?> >"ܔ     0 20> ]! €0`@!&0@ "@@ &@㿀 `(` `P`   @& #\#d#`  '  '     Հ  >   b    ' `& #\#`#d      ?> >"ܔ   װ > H# c ؐ $  ` 7> >ڐ#`⬒ Д   @⬐ Ɣ   ܶ  $  (`   L "    >  b Τ  $`(  9 `( ` $ > € y @!ِ ? (c 2 (o `0   > ]! € `0 "`0@!@H"@   &@"@`@!&@`( ? 0;, `(  ? (c 2 ( >   b 9 (?&"``0 2  > ]! € `0 "`0@!w@"@ &@(` ? (c 2 ( 㿐Q> H#4#> ߀   b  >@,m 8 2 !  $  ` "`>#b    @ > ߐ⬒ ߔ   ܒ  $ ܀`"q #\     @%6 ?(# @6(@"@ `@ W&@ W&0#9%> ߀    ͱ "I?阐>@, H 2`!  $` ` "`># ͖   @ > ߐ⬒ ͋  `ܒ  $`܀`" Z Ɛ #\   @$ޚ ?(# @6(@ @ "@@ &@㿘`@ ? "@D `㿘`-%>#> 0  XJ?$ 0@ # 0      ( "> ]`3! €@&K ٲ㿘    @&㿘& $ ( & & & @& D& >& H& L& & & &     & & & Ho o> Ixx "x "`"x& H 0 㿐 !   #> &   `ؖ   > "`"̾ 2   & @  > "  ̩  @ l  " 㿘 ?  &  H L@#EN 㿘`N`"` "N$` 2$$ @ $@" @$` &`@2"`"@@$ &&@$@&`$  $ ` $`" @~$` $`@2"`"@@p$ &P$``" ` 2$` $ $ H2$$ ` $`" @T$` &`@2"`"@@F$ &&`$@?&`$  $ @ $@" @/$` $`@2"`"@@!$ &$@$@$``" "X" 㿘 2 ` 2%& &` ` &`" @`&`` &`@@2"`"@`@$ &&&`@&`    ` "& `` 2'` 2" & ` &`" @&` $`@2"`"@@$ &$`&@$``` & &`  2" ` &`" @`&`` &`@@2"`"@`@$ &&`$" &` @ &@" @t`&`` &`@@2"`"@`@f$ &&&`@_&@   "&  & U" 2(` `2$` & @ &@" @5&` $`@2"`"@@'$ &$@&@ $`@` & &`  2" @ &@" @`&`` &`@@2"`"@`@$ &&&`@& " 2@2& 㿘@2`K` F @ "` 2``` $" &2$$@$`"@$@`$``$`` $` ``" &@2"`"@`@$ @" ` 2" @$    0`` $" &2$$@$ u㿘@  `  ? @ `  2  &` &`&`  &@`6$ $@V$ $@  " `  @ ?@   2    "  20   " "  `@`8`  8㿐 $ޒ? `A >! (!>'>)>` ( `$  L2`$ !@   "@`   L2  !@  " > !h#\>!#\  0Wy $ 2` $?  `< " ` (_ ` @ >!Ȓ0. D` (@/``@ >!ɒ0>!0 !>!\?㿐> : > I>|"|"h"`"` "`"`> J>d"d""" ""> J>P"P""`"` "`"`> I>X"X""" ""> Jx"x>" # b" " " > IX?"X> ~b" h#h"`"h``!> &"> I>"tb#\    > I>!b `   #\> I>#lc#\ `   㿘 >  T`$> :H /f * ' > I `h  "`hH 0   >" #", X p > &"䀢`>bP@ > I#l  , X"䀢`>bP@ > I! , X@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P$ $< P `(`&`0@ B >`0&`  P  L⠒`L  ( & `$ ` $ " "      L 2  >>> `@ &  $"@$ $  $ > )!H%>'>)>   L2 !@  $"@&A&2 "`8%>'>)>   L2 !@  $"@&"&2`8  F (0 `( €㿘 >  T`$> :H /f * ' > I `h  "`hH 0   >" #", X p > &"䀢`>bP@ > I#l  , X"䀢`>bP@ > I! , X@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P&`$$ `  (`& 0@ B < 0`P `Lᵒ L ( $%>'>)>   L2 !@ E $"@&}&2  & $ `$ &` "     L2  >>> `@ "  $"@$ $ ܒ > %!H%>'>)>   L2 !@  $"@&=&2 "`8%>'>)>   L2 !@  $"@&&2`8  B (0 `( €㿈`4 0  2`4 @      > "` Ƶ `?`   &  2+@" Ѱ  2"@    #> &   `ؖ O  > "`"Ƈ 2   & @\#d#`#\@!  > I > "  j  a| "a|  ?   > :>>> ` B" p `H@" q (`$@@m@k`(f"`8` `0"@B[@Y`8 T`<P`@L`DH`TD`H @`P > J  8> J`d  "`d `"`P@`P ݶ`$$`$!>#>'>`   L2  `@ ה `$"@&`&```2` @& 2 `@"  @` @2 > J`P "`P >  T`$> :H /f * ' > I `h  "`hH 0   >" #", X p > &"䀢`>bP@ > I#l  , X"䀢`>bP@ > I! , X@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H> H# *@  ܊ $ P$ L$ L$ P  & $ `$ $` "     L2  >>> `@ $  $"@$ $  $ޒ > '!H7>9>;>`   L2  a@  `$"@&`?&```2` " 7>9>;>`   L2  a@ `$"@&` &```2`  @& `$ @:&  > "  Ք    (  > IX X @  "  $  > Jx x/" 4 `  D` $ ("" @*$@   (  @* "#   2$"#  㿐@?\' @.  ?@ @['&@ L@     (     㿀`'X'HXd  >>> `09$M@  H>>> `P+$NH`H@ @ 'H`LH@0@`H@ ``(@ $'HG @  $'H@H`L@ڀ ؐ`( @"'`` :'`۰  H #\j 2'``$ '  H`$ `"``$:`$`:  `"* `$ * `(`@ `"*'􀢠H$@ *'H#\ 2r @:I`n`$'H`#\  "`\1>`'>>'  :``i$ƀ" * '*  $'H#\ؚ * $'H?@- H?@-'HH`L@ `( @"'`` *ܰ '`H&1#d#`#\㿐 H@* L8@8=  @D 2  &    @  ( &  ('&  $ $  H"  $ Hh 8 "9 ( `2> b  >>> `%t2 > ]"€ > : p`H $ "  (,"@  8 @@> : p`H $ "  (2"@  8$ ( ?$ 8 @ $ 2  &   $&   #   "  `%>'>)>`   L2 !@g `$"@&`&```2``" #>%>'>`   L2 `@I `$"@&`&```2` "& $ ' *W $& 㿘 V> H> I#`%>'>)> H " P#%߀    $`"  L2  8  { (  X"  X ( `" X@  X  H /f4`h* '`h& $`hH 0  > I#l> I! 2 H㿐> H# H@  .@ ' #` #\ `?㿐 `  `$2y `( 2u `P o   $+ (>> @ $@ ('> 8      > P  > h2 >} "`&  @"& ""`  '>3>5>    L2 `@G  $"@$ $   2 %>'>3>    L2 a@*  $"@$ b$   2   &"` ?& `+>->/>`   L2 `@ `$"@&`&`  >!H5>7>%>    L2 @  $"@$ $   2 `%>5>7>    L2 @Ɣ  $"@$ $   2 \``2`X&  @2 `&  & "`"`  `%>5>7>    L2 @  $"@$ $   2 `%>3>5>    L2 `@h  $"@$ $   2  X  H /f * ' > I  h"" hH p@  > I#l  > I!   㿀> H# @'L `>>> `!& '耏`" H>>> `&H'L : Ln  @ '   `'!   )> #> &   `ؖ 䵘  "`" 2   &  ` &@ ` @ &   `  `'  (`''>` `$@ 8`      ص`8 値   "$ ऐ`">  T`$> :H /f * ' > I `h  "`hH 0   >"t# / X p > &"䀢` @P> I#l~  / X"䀢` @uP> I!p / X " ' ' '  $"@ ' $ ' $ (`' (` "€ 0@B   ? 0``8' 8 @ <' < @' @ D' H' D P' P> Hc L4  ' L   $  " 2 ϖ ' L쀥' T' T%`$@: &  "! '`  @`2&Lऀ    > "`਀`?` ଐ &ଐ  L @   ऀ > "  ޠ 耢  `" '&  ` *'& ' h  (d耢U $@ ' ?&   $ #   "   #>%>'>`   L2 `@B `$"@&`z&```2` !>#>%>`   L2  `@% `$"@&`]&```2`'  '` @" ऀ  > "     > "   耢 Q ऀ "L)> ߀ #> &ऐऒ `ؖ ⟘ऀ  "`"ؔ 2ଐ &L@ ऀ > "       > "   7`u `L̔@ 㿐 !   #> &   `ؖ N  > "`" 2   &  H@* L8@8 ` @`$'`! ` 2 `$2 `( 2 `P 2 `8 2  "`8 "`( ; 0  > "  2 㿐  !   #> &   `ؖ ٘  > "`" 2   &  H@* L8@8,  ` @ 5 ' (@` `8 2M `@2H `@ "= ` *`87  `<&`<&`@&`<`<> a 8 `` `$ ?c `H 2` 2` `$`  @  2 `@" ` *`$ > "   㿐4a 6 \  ! (   #> &   `ؖ ,  > "`"d 2   &  H@* L8@8   @  g$ D "  * $ > "  (  㿐 !   #> &   `ؖ Ϙ  > "`" 2   &  H@* L8@8"   @ * (  (4 6 $ T > "  ˔   "  * $ > "    㿐   >>> `0); $ 2" H   )> %> &   ؖ P  "`" 2   &  H@* L8@8 2>  > "  e 3 K @ (   $  @ `  " * H􀦀d H "  ' H $侐  * $2   > "    (a ] H 2  8 2 "  <  ( 2     @1 $ H < ` ' H $# @ ` ( ?' H  $8 H2  > "     "  * H   &  #> b    @  H 2  $ < " B"  >!P 瀊`& #  @>!x?' H " * H H? ' H ' H $ 2 H2- " U # 瀊`&  " D   ? >?!P 瀊`& Ӑ  㿘  >>> `0*9"`   )> #> &   `ؖ Ϙ  "`" 2   & `!` D (@`H "`` &`H`$ぐ`@2`H `& > "   հ `  & 2  D > "  Д ð  (@ `< " ``H 2``$` " `@ 2`<> H#  2  H@ @ (   > "    @ %)> `<`"``H  `8 2`H `2` `( 2 `H` `$ ғ `H &`H`@2`<   & " r  D @`H 2`` `$`< "`G" [ >[!P 瀊`&   @@>M!`< "``H?&`H`@ 2`< D@" `< " ``H? &`H` &`H`$⸐`@2`< "   瀊`& ߳ "   㿐` 2  >>> `+$ #> >  b   H@ L8@8  >  ה ˰   (8 > $ @> `  > "     *8  'P@ (>>>`+Bm` k> : t`"h $&@"` L/>1>Μ "R> H` M` "5 4C> @> 0<> 0 ;> H , 8c . 2    "0c> V+> ]> 0M+! €@ P> H 4 0 , > H@? $@+> H@"H> Hc 4&@$@"      2 '  e@>    㿐5 @  (@" ` @*  `< 2 `$@ ` 㿘> I "t@ 㿘 @wє @ `@ؐ @: & & "`  ఄ ఝ㿘 `  @@">@" & @㿘 @%` 2`` "`$` !`(`` `)> %> $`` ؖ E`  "`"~ 2`` $`` `$`> " `m `H`L``2"`@`` `)> %> $`` ؖ `  "`"L 2`` $``@$`H$`L%>)>1>   `L2  !@%  $"@$ ]$   2 ` > " ` 0 0 @!@!o& @㿐 ? @&  " #w 2"    #> &   `ؖ ۭ  > "`" 2   &    H L  @ > I"t&㿘ऀ 2"ठ਀ #> %ऐऒ `ؖ qऀ  > "`" 2ଐ %L H  (D(3>8`" ` >"h 2D>" " 4 2`   υ  >  T`$> :H /f * ' > I `h``"`hH 0 ` >"Q# ,`X p > &"䀢` @`bP> I#l[  ,`X"䀢` @RbP> I!M ,`X<< < <  < (< (0< 08< 8@< @H< HP< P P  $ H> H c $ L" 2 ݖ  (`"  ` " €   ( @ & $` @`$`"`" `    L 2  >>> `@Ք `$"@$`$` $돒 >ؐ!H)>+>->    L2  `@  $"@$ $   2 `;#>)>+>    L2 ` a@  $"@$ Ґ$   2   >  T`$> :H /f * ' > I `h``"`hH 0 ` >"w# ,`X p > &"䀢` @bP> I#l  ,`X"䀢` @xbP> I!s ,`X<@<`<`<` <` (<`(0<`08<`8@<`@H<`HP<`P`P  > H` c`$`L" 2  `(`" `8` "`8€ `8$`H` $`8  @ & $` @ ( $`"`" `    L 2  >>> `@ `$"@$`$` $곒 >!H)>+>->    L2  `@ܔ  $"@$ $   2 `"P)>+>->    L2  `@  $"@$ $   2 P "H  H    ͽ H  P +Θ( "@8  @ " 8> a#<  $8 $8 @  > ac`<`$ ` 28& ऀ > " m ഀ  㿈 H> Lƀ" > "  ƀ !>#0@kƀ`1 ( D@->#x%>`0H`P` `$`(#``L#dƀ#\`8  F T  F T  F T`D`<`@#\`H#``T#dƀ`@2`0㿘> # ƀ  ` 8>>ƀ#`ƀ `">ƀ   #>3> ƀ`(@y  2 ƀ`8   @y  >ƀ @㾘>ƀ !>x ( > H  .>   *> , 4ƀ  >   0ƀ!>ƀ!P`g . 2 "  > >>!x ƀ .ƀ! . >ƀ!  2  ">>ƀ! .ƀ" .  @/> I (* `쀊    0 > I !> I! > I  >ƀ"0 2 >>ƀ"H0ƀ"hhL\Ldxx  㿘> `H@x  2> :> J@ > : x> 2`@:`  㿘> #` J`1   2 ` a 8`` 8` ``2J`1> : |(  %@,` 4 $X=#` '\#\ @ ` ` > h*` €> J @ 0> H !T> %#,oĘ k> H# X' ѧ ^ \ ` _V S*$ X@q d$ LM > H# \' щ @ X `  _8 5*$ \@q d$ P/ > H# `' k " X \  _ *$ `@qk d$ T > : xo -"""" """"" "$"(",> `8> H`,/J`1+>(> : a > :2x`:`2x`:` "22``2`,> H# ",   l  "  l "  " "(""" "$000HPd N N㿐> H#'D    *  8 2  D :  `#> >" b  Д *' (@` 1>3>`8 "` >"bȖ~ :`$>"bȖ(u  `"d  ^  $8 "((`  8`>"bȖ@S  $`2(::{f #  /􀤀+P`   LQ$   @  `` `0$ B @ 2 {8#  ٦@'` *`8> "  Dۢ `` @ ```'    > H#  @8  e #@@  '@>@@ İ   В  @ *'uN 20  $0T ` ( <      @E  @ ` @|`  0, $050= ` <22     Z `@w L @   B =`7     # "  *   @ :c 2@ ( #\;` d#h@ '@ 0,?`$0ָ0㿐`@`   "> H# @ @ @ $@ * @`/ "  '> >" ⬐    $ "@ ܔ "    Ɣ@㿐> H#@`   B$ "U >@: 8M   "   %> &   ؖ `  > "`" 2   &    > "    ` `> "  r   5  㿘> H#@` @  `   #@  @  (     㿘> H#@` @   ` #@   @   0   㿘> H#@` @   ` #@  8 >"* €  @    @    @  㿘> H# @`   $ *  @:   2 H (  #!: "   (   㿘> H#@`   $ * @:  !:k "      㿘@`"  !:O 2   pd  2 #㿘  c  㿐\` Ң > H  :  2ϰ 2˰ `2@@ *  &@@  #@Ꮤ@@ `??C B < `?@ ) %`@"!``   ?c  ` ? ?R `  < v t 2/ @/  -`  @#`#\= V`"Y  2"    #> $   `ؖ ұ  > "`" 2   $  "`` 6`H   > "  ϔ  @@@   " @@0 > "    `@H&(H> H> I  3@X@P(H4(   2  2  $ 2 H,2D,.> H" > I  .? > H2.`"`. 0 2 > I " > I  .?2. "   ,2,,(2,> I"  "  " > Hc`"`.2.` "` 㿘 . " .`"  "`> I"! "@ .?# > H6 .c`?"` .`6 ,  `0>>>#cΔ ր "> I> I&!&!  &  ""  .> H c6 .`> a "` (` > b 0@ ? (# @6 (`.!0 @2 ``> I "`` > I `@ `.? > H2`. `,"`.@> I` ` `@ > H2`.> I "@ "`" 㿘 (?> ]c⨔ 2 (㿘`(?> ]#Ⱄ 2`(㿘> H> : 4 c> J22: @*`  2  `2: 2? >>>#c!;*`  㿐> I 'D'H > I> I> I> ܑ+`` "" ` +`"" "  "`> I"! !"`T"`P""`X#!" > I"aH> : `>   > J  "@  > Hc c* @t`8.`$, @@k > : @ R> H> J +`" @ >$@C>ﳐ > H @#,`"*+ > J `"@` $&@ " 4@4 @ > H@8  `% '@> H `8> :@+`> H#> !> I,@*@D"@> a > :*H "` "P $ 0> I"!,   "(","`"\"T$ 4$` "X"L㿘> Hc c"cc "><!` "    `* 2`# 㿐> H#)> :  . #> !> ܐa@6! a% !8  @ $a$!!a">">!0 * $a '>%> b@ ,` c 㿘> :  > H!> J# (> I!` >ؐ!` > J@~ ` @ 2:`  :5 `*& @ `   @ #@ ` 2?>! `(> :`  @`#? @ #? #?#?  #? #? #?#?  ` ` 2:` @ 4 * &  ?@  @ i# ` 2?>u! `^(> :`  @`#? @ #? #?#?  #? #? #?#? I u?`? A> J (> H #` @ ` (@@ :0*@&`@"$"` 2?>0!@ `> : `#? @ #? #?#?  #? #? #?#?  ʘ? 㿘      㿘> H#` >">"0*> :>"X >o"x>  "g >d"0\ > J  ` ` (`"` `? >#       ( :` (@ +`? #  @ # $ # (# ,  # 0 # 4 # 8# <?   ?  `   `@㿘> :  `)> I -> :> J   "@     ,  &,  `T> H`P# ,,   8 p   >Ր#H0l ?  "" ` H /f * '   " X" PB" T*@9> I> H c@` "` ` "@ $3XP *  X3 P *@ `"$2@ X P * @"`@2Ñ*H 0> ܐ!@pB㿈!> : >#`   @ #> J  ->-`      ;`   ?#\``@  >7#>4 > I>T. 8㿘\`   > H>>>#`P|#> H# 8  :   >>>#`pf#  <@ > I @@  D   > I!$   ` c`  8` c``,4`(`( > "> Ia(> !8      !> I`> I3`2>  *+  @@ )@  %@  `  0  >>>#`#̑+   *   ` ̀`> ` "`" "@c?" (a $?"$ (!  "  "/ * I > 6 (6 *& & & 86 .`4c   $X2 @ P* H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "6 . ? (# @` 6 (> ]"@0ې 㿘  N` (  > H>>>#`x\ #> I $`2 `X `P* H /f * '  ` "` "  "H  `"  "` "`   "@ (?#  6 (?" *& `6 *`F *>  ( 6 *` & >>>#`X  > H#> I $`2 `X@ `P* H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "㿘 (`W 0`?# @6 ( (  > H>>>#`x꽔 #> I $ 2@ X P* @H / * '   " "`  "H  `"  "` "`   "@ (?#  6 (`?" *& `6 *0`" . .`?# @6 .z& `"  .>>>#`c$ %> H`"  "`> I"! "@ .?# > H6 .c ?" .  0  `2   > I "!`"  "`> I"! "@ .?# @6 .?" , 6 ,` ?"`  (?" @y6 (&֐> I`*  & *  "@* "  6 .``$ "`> : $ 4a㿘 @(?##,` "` (  ̍ ( "   `$€  ` 4 (`4 (`@ߑ,`㿘> H'> I# $@6% 4  `` @ ` 2% 4 00` "`$` " $> ]"@ (!4 (` $`" $` `$`$ $` $$$ > "`<<<<<<<<<<<<<<<4<<<<<<<<<<<<<<<<<,$㿐> ]!p> b   > H>>>!a(p; A#> :` `2 > J 2`@: +  * 2`` "  #@ 2`@: `2`?? > J`+ `*" @ *   >>>!a(x C㿐#> :!> I!d`p #\@ Ԛ > K"`> K> K"``p""@> > "a"?$?"  > : , @@` @ , 㿈 /> H)> K ' .@ #`#\ ?? 3> > Ib(> ! > >> K!@!:@  #!@ '>>>!a蕔 > K4  "`>> K  "O 㘀 $5>#>%> ]+>'>  abt  (  ak  4h@㘠 @ 㿐> H# > aa .@ > "! '@7> b> K    /> K!7> b   %> $   ؖ   > "`"3 2   $   ਀` % ` > " `  .@ @%@  Ԓ 㿈` 'X X `@ > H4 ??耢4 ?> H(?> H @@mub :  2  @ ( & s&@@m`b*`&   & `  <` B C`(U "N . 2 ( "G ( 2 ( 2 (> b 0@ ? (# @4 ( ( 4 ( ( ` +> ]!`4 (€ `2?&* & &D` 4 ``耢4"``㿈'XX```` ;`#\`  &'@ &  ` ``@   2 N L `E@B 0> `9@6!` `  `. > H` " #`@l`   ` `@ Y`@ T`  '@&@ A㿘 e?> Hc#c +>@@V`T 2`(`. !"`(` " " @` @lI`  { @`( "@@ @(` $ @.  @2(> ]a@€ @z`% `$€  >>aa0p" 2(> a#€@> ab€@@`( 2`(`㿘> &"䀢`>bH@z > h& X& > I!\  &  "@" ?ԁ㿘> H# 8:@ - 2  2 * #> &"䀢``>bX@V  0(  4"  0 2   > H#` H,Ȑ@,$  H .`@@ĒW P />3>7> @`. 0@ `"`` `ah#F`(( " @@ (`@"@>aД#X`( @2> a > a#€ > ab€@@?( 2(@`( 2`(` >  0  >  \ "> p> !\u $>*         㿘 H /d * % > I > b <> "> `:  8> H# @,"H p@㿘> H#` @`x `: $`< : @ $`< `, @$`<$`<`< @``, $`@ $`@` @`X $`H㿘> "> I"a(H > H# Ƞ> I'>!$" !` $! @"    @`+ @$ D `$ D  @@  D@#@E#, `2ѐǖ͐㿘> H#+>H o$*@e%> I\ \Ԓ"c ŗ\$\$`H 0&)> H#0@" 8: "@$H /* d % X@ H 0`#`, > I;!$06`0p> H c`@: * 6`2`*`# p'@# p'  ' `  ` ɠc  @ *`   ` ' `c! > ] $! @ሟ@'耢 "`.!, $!,`2``2+`(`  >>>#c(p0!2`(`0  ?>>>#c("!`$`04`.`( ca0 ["a0a$  "a$  !0 P$!0!( $!(`( #c`. 0 c`p "`p> ]! €$ca  4"a 20% >>>#c("#@ * @4"hp@ $ `.>>>#c(Д"E 0  @ c%  c h l $ `.>>>#c(㷔"X `0  2`(`" `.` "`.@ + `" `.  c @iG` `  `(> ]`.` 04`(@  c` 7"` " `  @  % @i$` . c @:@ '@   2 `(?# @4`(.  &@ % c @i` 6  `&''  "@@ ǐc6' 'c4 $4   ;`   #\  `8` $8$`. "W@U@T'G 2`(>  "`(ů`(?# @` 4`( % > ]! €@' & `$€ @  '耤 > a:> a#@ > a#€> ab€`(`4`( '耢   . `@'耤`N L`㿘> Hca   $a``@6aa  $aa  a`d > I!`> I ! ##a 2 `d > I!# @@ D"" lh@ > Ip > I "# > Ij f .`2   2  (   >>>#c(HR$2 ( 0  ?>>>#c(D$`$ 04 . ( 2>-` .    "  .@  ?"  (c 4 ( . # @g      `@  (?# @4 (` > ]! €#a< "a< `4 (4 (㿐 'L>>> ` f? >>> `ޔ g> H# #   * @fjŒ  $8# ( , @ ͮ > J L Ơ#`> : 4 ` > J 2`@: * *2``# #@  2`@: `2`?Y#  `4 > J 2: *  2  E2: 2? 2#@e,  @@) *" * @ .`!> H#*" * @  4?@  @  '*" * @ .`*yŠ @<'> I *`$ , @ (2 @   $ **`  "  "@#?" (a" *$?"$ *  6 (6 *6 .& & &`& `"@'` @' #< @  > I@@ D > IÈ!$F㿘5 => I> H c)>+>-> .  " `(! ` "`&  " 4 .$s*  m$ *  g"@* " $ @$> : $`4 2 .㿘> : #>    ax!  2 㿐>!!> H#>#   ! > !    P> \" T X L `#\ 0> 4"X 8 <> @" D H > "   > "  >#( > ̐#@ П  > ܐ#p    > #   >!#!!! > 8!$>! X!! !(!<>!0 !!,!4>!8 ȟ t d> x  |  l> h!( p >!`> Ip>!P!x!L㿐> "!> H"c> K>!  Ԙ > a(> Ia( "!l> `ac ">>!> !#\ \  > ܀ "a>Ґ"> K> b(#\    > K>!b0#\ x  ט @㿘> !``` $̀ 2$D$@ $D2$` `2`㿘`< ,  \ &$̔@[ >`.`,  \ &$Д@[y &$ԁ㿐> H#  ,"    ̐ 2     #\   Ě ,  &  @ 㿘 ,  i ,  $("@ ;  $̑* @(@ $̑* @(@ ("@   ( ": ̅( *@ @  㿘> ! #> H  4 "$ $  $  $   "` " $ ᤔᤀ $ ᤐ "`"$  \&  &$D &$H 2 $ "$D$ c`d "`d> *> H"! c$@2$D`$D $H" H$H $D D d # d" 2$@ 2 㿘> !@  "$  "@ C \ 2㿀> a    #`#d#\  ">o"8&$,&$(> ```"` $(&$D$, $D 2$(` `2` H> K`!  =@  > H#  &26> ! -`$`!> H#$  :@d.`* 2`  $ b”$ `$b$  $Dd` 2&հ : А``2@> # b/ ° @ * >"H$bs " @>"X    $b& 2ᐒ  D'''''\I @    ( 0 2 `< "` > n ~"` \  ْ    h0Q`ǒ `  \ $ؠ \   @Yw$ؒ $ $$@`< 2?` $`< K@$$ȒW \  d$$$$$a ">Z"x@1 % `< 2$$$ \ \0u 2     @ aՐᐖ & 0> d@ c @ @~  <  2 4  > Z* "@*` `" @?)  @~ X + 3`    D X> D`L&dLt8   &dP&dP> H<  2* &`#  @Y/* <     `> :e `d4 "`> ޓ #\  \   &d0 Ӗ  ">ܞ"(> #`XD ez:` c*  * :@ $d0>܆"α  ">>|"#$@>#(a > :` ͒`c ? &`&d`h  "`h @~5 㿘`d( d,&` 2 `d(d, "d `  ?&`d$@" d@>>>#HcX$m <`da6d@> d@#   @} d> H# h d" " hCd@ > #k > a d(d,ͪd0 \㿘>>j" p ~㿘>>j" p r 㿘 T> H: 2* # @ao*   i 2d( 0 (& 4& 0H /d * % OH 001$ @a< d@*  2` <  >#ۢ H /d * %  h& TH 0w0@㿈H /d * % > K ӎ H 0 %`%`%` %@%``<>2`*   `H*` &`@$L$@: '@X  ~씒 ?>D "$LH /d * % %`< @Wl `d"@4H /d * % > K!2 H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>!P Xc!$ ,$ X$ $ \$ p`d > K$ `$ d`<``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4`* %` ! `  %` g@$T"@=H 0 <`DSH /d  `i `* % `` ?`%```"> K`0&`4(&`0> K ONgH 0㿘  & $$P & $x" !$&$x&$0\`t "`t~M $$P6 $x2$  ?& 㿘 t> &"䀢` >`0@b  < @`@" "@$`@ ?$  4 2$  \ > Kfސ> K!  "`@`0($`0 $`4  2' 2#> K M 2 "  >>>#HcX@& 2 > K ȒM~$㿀> H#`$\ > !`O``F> H#  "<$D$ $ 46$D$0   #`#d #\ n 2'$D$D@$H$`"dH$H@$D"dD$$D`$$H`@2`$`"$D$`$  $$  l % l$( $`` `2``` & 㿘*$$@"$$㿘?j> H# d` `>>>#HcXXi&2 d >>>#HcXp_&6 d(>>>#HcXT&d0& <  > d > :"$d  l"@ /$ l ' "d($: * @dГ*` 2d($: * @dГ*` ` 2@ ߠޖ 㿘@?@+ 㿘> H# t'D` $ t>>>#HcX&쀦2 p ?$ pD @    p $ p㿀> H# @: *22*'H'P# `6'6:`'D@^  * 2` @?@ ' 'D   > : ` '> :` 耢  HH d耢a  % 3~ 2  (?p  <@2'> H# H(" : * @Г*`   2 @ݐ  4 ,` `.@2.`@. `. :  :D@ @ը D'  { H /d * %   > > I( ` `> L!\H 0 / d耢a  H(" :`*` Б* 2(":* Б*  ` @Hݰ PP ?'PP   `> !P! % 0% ,% % H% T% pH /d * % > !(% \dאH 0> H#` .% 8%% <% ``> :.`% dHtH /d * % > a(t "tH p@> Ia(> " 0 2`@ @@> % 0% X{{n K7 0> :ณ2` 5 ` 0@1 0(-  H'<`> H# HD ($ :* Б* -@ @-@:  @ : D  0@耢 H /d4 \* % \  cݐ  >  \ "> bk> !\H 0㿐> n >آ 0JZ  \>ؙ!0A $آ \  $ؒ @R $`$d@ $@  \ $d $d>d! [u !> >!0"  <[{d@d \ \0" z'㿐`*  > :   -0 -03> :`'    &` > : 㿘6  #> :V$ &  ` $`㿘@> :`&  && & & "`㿈> :`  "`@s > K8 8''7` ''S"耧`@ &` &`" &` =& ` 㿈> : `>6!h@8 > K8 87`''''" 耧`"@&`&`b&` & ` @&&&& 㿘!> :   > K"`> K" $ 㿘!> :  > K" @QҔ!$ 㿈> H c` @   И* #   F'$8A   *  @ @*@'4 `##` #\?Ԛ? 2>  ē6@   @  >  ē4@ "  $ Ā`!>!>!`& ֝  㿘 Ԁ@> H' #>`*"@: ` " 2 ":`0 B ; @Z4  @  $Ȱ  p   ( (  D \=> H#c8 "<>6!耊 "J E$>@ 8  Ԁ   ``* "* 4 ( #* @#@ aH ''' #\#`#d#h#lu  @ D #`#\#d#h#lt   @ D & (28㿘 >ސ"0 > H#@ 8 @  㿘> "!> > L>"a |p   0   #>!>Bbx ` & "" d  < 2  > Z *`" * `"  " <  `Y' ` q&  "m>  & ( ("`,"& , "_&  `!&  > Z a*" * ` @>   `h@  `(  @U   > "@vO "  > :  "& ې& &  & &  & &    & & > `& >  & ( ("`,"& , "& X  " 㿘 ? <&  @  ?` & @    @ Y0+`&     @  `  & ""   (`" , ,"`, , ("@  " >ڐ" & pX㿘  ?  ?&  `H&     @r  `" !>  &  "" i `2     & >Ӡ#" &  (`" , ,"`, , ("@&  *㿘 (  >Ӆ#8> ]! €`&@藐 `"&   " >n#`  b"   (`" , ,"`, , ("@  " >X# "$ $  `> H#@:@*`2` 2 * '#p '  '`''#' 8 ;    ;`D    ; @Xd2`*  *`'؀ ' @ `'܀`H  `C܀"& `<?#؀ 2`(` 4` `$ 4 `(2 ``$(``( 4`(``@ ?`(# @4`(> Hc @ :E܀" ! M'؀ `` 4B` `$ 4`28``$ `2`> Hc @ :E```(  `) ` & #' `" `(`. > ]! €`(  > b 0@ ?`(# @4`(`(`2`  4`(26`(܀` ` ``ු`?`, 2ޢ> ]ᬐ€ =բ`"Ң`(  4`(> ]! €Pâ> ]ᬒ`4`(€ `*7ֲ2`'';`#\` `"`> #`  ܀ ֑*``*2 @2 `ܒT{  .`@r `**2 @2 ` / Q ` ( ?V (?c  4 (& ;m  `4 (> a"@`?`, )> ]ᬐ€  ` (  4 (" > ]`>`  >  H'> ]! €攐``@@ ܀``܀"   !> &  "   ` !"    >& 㿘> @4 > $@>- @  > HB?8 : :` @ B   @     8 ;  @ 8C  @ ?㿘@ 㿈d @5    '  @?D '`( !   > H 2`(&@ > H @ :D ޲`'s q   j ?## @ X> H T'>1>`( !  2`( " Ȗ T@2`(&@@  '#\   '@@ "> H  @) `(   `( 2`(0> a`( 2`(€&@> H @ :D ` p@6  `%>&" !&  Ж  ` 4 2  $ @? E 2 2 }  & 5> H# 'Х. @ D 4 $>  $(> ߤ">  " ?''쀊`@'''''  qM! 8  b`q  `r   @ bs' 耤$` X@ 㘀  `. "@K B  ?`&  = `  㿘   "   `& T) !> " & r t"p`  㿘   4  2>  $( >   > 㿘#> !> Lb | S > ܐa" "a> !#  "X2( 2(  SՐ $!! $00"`$a(〦 a#⬒    Ԛ 1`" (`,"`,,(" $0 ⬐ |  㿘 8> S > #  ` p > !|`" 1 6 2  $ 2  ( 2  , 2  0 2    `  `` `` `` ` /@ "` &`  `` 2 ``?#@"s 1` 2`  2 ", 26`` 2 6`` 26`` ,6`&` "S 1 ,M 1,2  #a:` 2?> L`4  " ` 8R  2`- 0`& $` & (`& ,`& 0` 2 `` 2 ``?#@ `<* @ & d2 6 6 $@  L 㿐`8 ` 7     `2`` `` > 1> 1#cހ :  # "X   > 1> 1#c֓- , 2 2`:  , M@Rϒ&7$, 2`" 4)> L ۰ 10\?* 2`@45`: 4     `$z ܐ96`6 , MT@R$@7, 2`$@ 49> L  10$ * 2`@ 45`( 4     `$B ܐ6`6 P` ` 'g'`   /`  1`  `  `?#@02)`$` 2%`$`?#@`$  `( 2 `$`, 2`$`0 "4`.`$ ذ `( ?`,#@"@0̀ 2 @`( 2 @`,?#@ @'`'`'` '`'`'`'@Z "&` `$ 21``( 2-``,?#2'``0 2#`@I   //Sc `8R` `@ @It 7 SP `@``@`$@7 2 `@ h 1'd  @'@,`k`$`` ``(  `$`,  `0 `$ `6f  A 0`$ `(  ``, ``0 "`6`2 ``( 2``,?#@2``0 2``6 2 $`$ $`( $`, $`0`$``  $``$``$` `4`4`$`dx``` 2 ` !` 2 `` 2`` 2`ΰ  `  `?#@>א >''' '''""`'`''`` '`'`''܀ `> ;>!!`  `'`'''耧` >Z ,> ;  .6`!u`!/ $ / ( / , / 0 / @ " /  4  / L`@NW  L/   `8 ?d*@ $@N>  4`@N7  228 ".4 `6 2& $䀢  $耢 $쀢 $@N  26`4 22` 㿘`  @H&`  , ,`64 `$`$$ `( $ `, $ `0@$ 㿘`  @G&`  , ,`44 ``$ ` $ ` $ ` @$ 㿘. * !> L$   G*  *@ *`> :@ " @G“*`  ( >ت `>>צ!db8#>a  > 0at% & @. <& 6 8& & & ̴& , a  !㿈@G  /H /f * '  ` ` & & "` ?& H 0 `  0  0ٔ@ 0Ձ㾐 8 j'D!\ f!` b   D@M9  M     3   DD`"F  Q 9`D <6`,`  ''','D`T "`TD`d "d!\ `  " 0D@7D@D>a( "ʴ v r 2 D`X "`X㿘 !F@N  a2@a1@=a@"a a@ aI@%a@"wx 0aH@"A!` !J@' !F@! g aG0H!H@ "-!`!G@"!\X 0!K@"8!\Q M2K /J !F@", !F@"   ` !J@" ` `    " @# / @  2  `  "  /      !F@"   !F@> L> L /> L  h'> : @] a` "Za\T ` @Q L  `@G @@B  @L  2 a\@L @ "Ȥ 1      `a` `" 1 ` $             a``  `   `  ` " 1 !\ " @  @ L  O!` &!\  =  O&!`H /f * '  8`@$6 8H 0Z !\ "!`֒ &!\!` "Pϒ K&!` G0!G@0H!G@> 1  47 - 00!H@0H!H@' 1  4  `" 1!`  @O;!` @O3& @ 1㿘`2>Ƚ!X  .@     `.@ `.@㿘` >Ȣ!"@  @      .    㿐`2>~!2`/@* * @&@㿐`2@>f!22` //    * *@ & `!\`>!`; ` 7  3@D"Ȑ@D  / / `<'//`''"7``" 0 (0  ˒  2B 7 @ *  6 /`'ĔĖ 0 *Ā ’'%Ā Ā     b      㿐  ,'L'P'T'X 'H; > L > :` @$ \`"`" ` 2  28  ` @ @" ሀ`& `L`#`L``   [#``0:`!\!h`J!`G ` C ?@C"Ȑ@C  / / `<'c` `'`'`/' /' ''''"7``" 0 (0    2m 7 @ *  >a /`'ĔĖ ^ 2UĀ  'SĀ 2FĀ @ Yd &&!d  @  @Iy  @C   - -%  % % % !d`" !d`8 ܐ?"`8&!d!d  !dX!d    3   @CH 㿐   , C'> L> :   @ )!\!!``"   `  8  @I   !`  @I  "ତ۠!`# `L `$`L !`` $``Z@0 !P'@C @B >">" '   ' ' '@'///'''̖/ $Yښ >  ">"Xِ ` >#@ `0 Ɔ   D@ ` ?"` `  &` "`Da֐  `8   "`8Xo0`8?"`8㿘W   4  @ 8`    8?$ 8㿘> S#   0 @Hc  2 ``$ `W 4  @ 8`8?"8Q  #> 0x > 0??#*` ??? 2  " 2?` "@     "     : 2   8   ?2?  * +   > 0 @ !k`H@0!j@@73S0l@20 !L@ ",0aU@"aV@!N@W @0HaP@ aO@aM@ ai0J!J@ 1!K@  ai`s @Xm@ag@ ad@ af@  !0!e@ >cL S -!@ "`!@ 0Ha"0!@0H a"`"> @7@a!@. H! @ - a@'aF@!@ !8 ! !aI@ aG@a%@ aM@  aT@aO@   %  "0H? ?  `"44@" 2 `"4@ "@ߐ0Ha"@a!@> Ha@"а   !@'a @0HIa%a@אa@0H@a%aI@"# a%@0H5a%aQ@aR@0H,a% " 1?  ` /0H  0H 1` `?* ` ?* 0Ha%@"N | H!@"8 !@0aa!@a"@'0YaR@" aI@>aQ@W0LaS@9aT@C0D (& ,& 0& 4& 8&  <&$ @A&(8 ">  `& d& h& l& p&  t&$ x.&(& & & & &  &$  &( &1@@P <J)  %@@D!<J!  & & & &   #" @ &&  #"  $ & & & &  & &  ?& & d l2ʰ @Ȓ ð@’ @? `P ' `/ ''' '$'('P'T'X'\ ''̖ ? @"  d 2 * t* p@'?@j '4 @j4 2v4 2  >cHe l  @  4& 4`\ "`\@l] 0[@? `  '8` `  7/ ('D ,L'H 0 'L 4 'P 8'T <'X @'\ '` 'd 'h 'l ? @" @jQ  @``\ ``\  @Ð`` @j   - 㾠>  H' % `"  8 " `H`-  "`H /`H 2 `  `   H@ `P 4  8~ ݒ  8`, `0'`4'`8'`<'`@'`D''ـ 2`- 2`- 2`-•`" 4 4@"`-Q 7`- `h 8   `> ;!Ȁ`>cxŒ =  > ;!Ȁ`>c 2 `h`` 8, > ;!Ȁ` !> @`j 2>`H 2:`H Ȓ      7@> &Đ(  &.).(&& 8  `&&> S|&` & ` `` 2`"`"& & "@& `H (| 7 > ;!Ȁ` !> @@90  '`H&|`L&`P&`T&`X&`\&``&ـ 22`hh@D*  "+`h  W  > ;!Ȁ`!> @0  ?&&`&d&h&l&p&t&x`h&`l&`p&`t& &&?&&`@Q ['`d&`d`"&& ? &@% "V 8 &V 8 @1 9x@=֒ `$< 4 '   /x7'/y7/'@N  > ;Ā "Đ"`&Đ"!Ȁ`!> @ e 0Sq:  @=>"X"X`` '`  '' '/@=/>"(/"(' /   4'7''R̒  `@=”    8 Ȑ?$ 8 2 8@@=b 4(!'X'd'H'D'L T ' S ?$ 8  '@А > ;Ā "Đ"`&Đ"> !h> a@  2% 8@ > ;Ā "Đ"`&"R/ !Ȁ` !> @ Ȗ  8 \>""'` `'`''RL  `@=B    8 Ӑ?$ 8 2 8@< 4(!' ','' ' T3 C' R ?$ 8@S  > ;Ā "Đ"`&"!Ȁ`$!> @ k 0 "@ `d @`   " @?@㿘 @`   `  UP   !>! @Y 0 20  ?&   Ā`""`"@@  Ā2@㿘H /f * '  ` "`&`  "@> Sc@2 `"c 2  >`& 3!x` "`@` @"` ``2 `\>a ֔0 R0?"`\`&` &`@h` ?&` H 0㿘   `f 2@ sx2 >^!!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ \p!@"  -0!@Pp - @ @I " 1@ڤ ` Ԣ ` ܰ  @;~ xE[ EW' '  EI ' ' /Ȑ@, *@' a@;P  @$0@ PE# Pp T X'P\tx | 'T'X@A'\ 2  !@  @  PD   `D `pP @ d h'`ltx |  'd'h@@'l   ` 2۠`0F 1!@ ((Dǒ8 ` `D@:ڒ! & *&@:ϒ xD  ((D8   `D` @: |D| H'<a㿘  H /f * ' ` `@ "`  "``2@&`(&`,&`0 &`4&`8&`<&`@` a   H 00*H 0`D`&`$1 `a   S#  ` &`>4" &`T`8 @@c㿘  ,>  "   2  !>  J  ` P'  ?"`   $ &  & " $ & `2 0.#8     2  >v"   ` O & ?"` &  & " $ & `2 > 8 2 ` "` @"  "@ " "`2"`" 2㿘> #8    2   6" @9 $ $ c8c8 $c8" $c8$ 㿘> #8  2 @ `"  "` "@ 60 2 xH /` * ! &` ` @ "`  2`` `   @?>  2  ,  &  6~  2 @H 0% 7 & `& `& ` & & & `   "   2  2& S 6H 0 1&Q  `$  & " $  & ؐ@9 ` `  @`/`/`''''  N0 a1@& `"  "` "@ 6 ?$ H 0  @GH 0xH /`   N "ؐ* !  ? /& @G`"  "` "@ `` ?"` ؐ@8      / /  '''' a2 6H 0㿘  6}   7 & & 6 㿘 " 6  ?? " 2  2  2 㿘 `"  ` 2 `@>  2 > :> ܆(@ *` > :@ "   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ  a(* *㿘      0%>   "    0 0  "@=  2   ``   㿘̐ "  4   ? 㿘> S# "  0 @=k  2  "    0    @ `  (0  㿘>b0    : . "@=- 2  @  "@ : `?㿐        ///////`/>bhِ 0@7 ``: * @ &@ . `@ &.  ?. 㿘3 ? >"0> "8`{/> PTP2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   > ; `"?  ";  ") # " *  4&  4 $ $ 42 `  0  2`` 2 蒂`B &:耥,),*p B; p `B ;  `B ;㿐x ? ' 5' ` 2-  2)  2&  2#  > ; `2' V`2  2 0 $   2 ' > ;  `2  2  2   2  2'  2  " 㿐@  ' `2   @Y/  2 82  <AA`? > 8`4 a<,`82)` `@   8 ` (`    :```2a<> : 㿘  z @5m   z  @5e&  zې!!@5]& @G& 㿘@G8`@| `| | 0 X@5E@5> !h> a@5@5ڐ`? `   .` 㿘 `"?@  2 `"` 2 <``2@{?  ` `G` 8  `%" ``" `#` ]?; Y?" G``G P? 2L?> :a@:є 6> :a@:ʔ /  `> $`2"` .`  .`  .` .` .`  .`  .` .`2 ?N `@4 `  .`.``  ?  .`> :` a@:  ? 㿀l `> ;!Ȁ`N>bА J HaY  > > ;!Ȁ`;>c> "8`!>@C 2`  > ;!Ȁ`"#(`  a``耦@ > Y#"?> ;!Ȁ`>cX  aȀ >c#l     #\ #`#h#d  @4' x  @3 8< 4  b//77' ''r  > ;!Ȁ`->c ?>bhbh    ?  /'/'''''' / > ;!Ȁ`>`  X? >L `    8 2  ?ߐ $  @3 ` ' >Іbh/x'H'L'P'T','4'<4'0'8'@'D   @"l   ?'l'\'X@^{    @^    @3{ x  @3>"">bb ''  ?  ''//''''''////'''''  > ;!Ȁ`>` ? 耦`"Z?J@  ."  " J  ." &" ?P?? /O@2O,P<O`#  ` * 2  X@2@3\@3g O@3c@3@2   ..6 4 .6 <  㿈 < Z 5 > @4 @ & @0L  @<  2  @N  / 9@ @$> ;!Ȁ`8>`V 8   8> ;!Ȁ`*>a  a 0$>""'` `'`''\耢 > : > :!` 4 Tx@FB ؀`/>@ `` 2@ `q@ `h``? ? 2b`Ā+> S`""`"@ `Ā2` `(G " `H 6, <   `|I/ ```"`& ``"@`  ?$` c@ 2 ``%cH!c` 2``  > ;`"`H!Ȁ`>a`  ` ?$` `2@_@E@1 ((  '    4/7/'''G1 @   0 H4G㿐 @ >!>@1  ?/'?   ? ? "```?`` `  `  ?` `   ?? "``` `` ` ``       8 &   " `& + 2 3 ?c 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"32 3 ?c 4# `@``+ 2 3 ?@ 4# +   @     ? @ * @ ?    @  ` *`& + 2 3 @4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` `+ `"12 3 @4# `@``+ 2 3 ?c 4# +   @     ? @ * @ 2l >!+ ?# + 2 3 ?c 4# *@ 㿘  `'@`           2  2  2  " ` > 0!*` 00? ? " $` > 0!x@ } > 0!* `  ? ?@ > "@ΐ ```   @C ŀ`@ "`D0E{ $@`I 1@ ` @5  " @@`8 ?"`8$@@ ` @ 2@`@/  .` ,`&` &`  &` &`&` `Dʒ $@D@   Do  0@ D0 A 1'@  `  `2a<> ;``#`  # `# `# `"? ?? ?9 '`` `> 0(` 3 ` ` `` 4 3  > 0x  > 0+`3 2" @# `?# `?# ` # # @ @ ? @?  > 0x "# 4"#  3  ? @?? @?2 㿐@  |   @:>&!   2 X!   *  W   @:>!   4? +> P" @  $  `  ` `B =  `  " `   $@ @]?" ! $ ۢ@&@ ϐ!㿘1T> L> ;`""`8"`<㿐'D'H@'      @:>!    >  !C > ܠ#@? %>  4   @3   <?`8 ?"`8> ܤ"#<< <@-   , , $  $  $  $$ C'< "  D 2  * @2  @~ !<`B:` "@   @j !<`B:`> P"`B:`<`xB:`x H /f * ' > c\   H 0    'c\H 0    >>"b0!>"x> ; p> L!@ @> L  8"$  *  *`@*   28 @3F  2 8 (@3?  " 8 2  2@ > ; l5> L `'   H`& r  @-. H@$ $  x *  * *`@  $,, ?$ $ $  $$ $( $, $0 $$@$4$D ? *@ #@2 ?$@ , ? * @@"@ # 5? @ H /f4'c\* ''c\H 0 ư!#@ ? @w H /f4'c\* ''c\H 0 !`1 $,?#@  @ sِ      $ ( , 0 4@7 $2@ $ q  P@, $ ` *  * *`@  $@  *` 4` ,` ,`  4` $`$`$`$`F 2 2  ` ` 4  #2`+" ` 4  "  $ @ ```@"@ " `` " $ sT ꀦ @T> L!D`"! $D> "H /f4"\* '"\H 0 !  `"H /f4'c\* ''c\H 0 ɰ!5> L``@$"`@ 2$r 2`r ?ؑ* 2 2 - - % %  % $% (% ,% 0% 4% $   5ߔ  %%   @D " r%?I&U ,@%*@D " r%?` &   @%> P"h`B :h<`B:`D"@H"H /f4'c\* ''c\H 0 % > P<`B:`> Pb `B : H /f4'c\* ''c\H 0 !㿘> #\` >>"b0 "|>}" '> L@*)> L`@J``           $  (  ,  0  4@ $^r @2`@P D " r$ ?% 㿘> #\` >>b0"Ĕ">4"& `& `"` &`㿘> #\` >>b0"">"  "`  " 㿘> #\` >>b0"">"& <`8& 8`8"`<&`8㿘> #\` >>b0"">" 8 <"`8 < 8" <㿘H /` * ! H /f * ' > c\   H 0    %c\H 0    >>b0"B">"x> L `8)> L '> ; > P" ?,  8 < ` `(`B <`(  <2  l@`< > P" `0 <B<`0 l@ < 2`0H /f4%c\* '%c\H 0 H 0㿘H /f * ' > c\   H 0    $\H 0   $> L 8@ > P" `  8B<`  82` H /f4$\* '$\H 0 ؈؜ذ44<D000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000p Lx&$%&''&L'&h&&&'&&'','H'd''㿘@7> ;Bs`> ;"`> ;Bn> ;"`܁`6 `` `"+(\`;`"SXV`R>H*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`㿘> ; ̀` `@`2`  m  2"`>ސ"  ̀ "@ " $ "`㿐> La B:a> P!Ph 't (   #    2  ``  2  2   2     ߐ?' ) @^ 5 :23  @  Ж   @:>z"   `2 J@a `B :    @`2  a`B :  @ a`B : $$В"@ `` 0 8 0`  $"  ?ܐ?" 0  0    ?В`0& &  0w       0&   0 0 2  > ;!Ȁ`L>b D!0F? ?#  #  #  #  #  #  #  $# $  @ ? @? 2 , ,  ? ? ? ? 2+ (, , + ( (6* 6* 6a* * * .`&  `B ;@ b (0㿐`'"`  !< @B:@ > L `B : P  @  ۖ   @:>"  '`2 `> L!( B:( ` !!< `B:` :  "> ;!Ȁ` #> @c > L!((B:((` "w!< `Bo:`> L @!(@*` B; @ "u " "U  +> ;![ o> ;!4\ .!"  "q  > ;!"B S 4> ; > ;$   !< `B:`  >!\,  €    !< `B:`     !< `0B:`0 aڠ    !< ` B:`  aƠ Ġ    !< `(B:`( "   aa    !< `8B:`8 a沔 C  "s   :m H /f * ' > "X H 0 O 4 H /f * ' V > ߔ̗*  2 H p@  $ $ 4 $$ $ $ ) #V @4   $$  $   $   ($  &  6 /$  L/   0 ("$ $ y$  (' @ , ,a(8$ B`B ;$ ;(8@  &  0 !< `@B(:`@    "!< `pB :`p  " !< `xB:`x沔   @4V'@4R   !< `B:`הa> ;` Ԕ  Ȑ  沔 Z  a@   aH /f * ' > "X H 0 ' 4 H /f * ' > R ̗*  2 H p@  $ $ 4 $$ $ $ / 4 - H /f * ' > #HZ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    "I $   $ "  82 `"   0 $  " ? $  ̰?> !h4 .c (`( .^`0@$z > !`4.V #V @4   $  $  $  $ $  $$  4$ $  ,`(, a(8$xB`B ;$x;(8@m ( a   !< `HB:`H єa沔 i  @I'@I   !< `PB:`P a沔 E  @J'@J   !< `XB:`X a沔 "  @@F'@@A   !< ``B:`` fai沔   @Cd'@C[   !< `hB:`h Ba'E沔 ږ  @ A'@ 9+0a3!Ȁ`>#0 @he `" `48 M@  @ "!a`B :a0`B :0@!۰!/ > L `B :   `0@ 0   0@:>"   2`> L Ҵ )> 33<+"< ,"  "   2  `@ ǖ   @:r"   `$3 ` *  * @ @  <`@    @:I"   > L   `**   2'  @@הz   @:%"   `> L ` 2 2  *  @ t@ `@ P|  | @:"   ?  * @@ 2 LB 0-x  x 0@:>א"   @"Q   / /`'`'` ' `$''' '̠ ꠒ'А  2> ;ؐ@"(   //`'` '`'`' ' ǖ  > ;!Ȁ`H>chǐ 0C@?`* `*`*`@  * 'ܬ`'''''/'t** *  @'t'> P! > :*` *  *   > L ?`B : F?x > ;  * *`@ *   ; Ѐ` > ; Ԁ @y> ;  `> ; ؀ @nؐ@!   //?' ?' ' ' ` 47@  D> ; 4 8  P 4  T .  @!<` @  0< `` @@ 07 > ; > L @`B ;@# T > ; 8 ?# 8> ; ̀   @ 2 h`  8'̴ ``   Ԕ   @:>"   ϰ @!    /٬ /*ٔ        * ` "@ |-     s-  ` "9>      c ` @``  `   `  ` " 47@&  <0Z``*@!h > @\! O K G ` @@`EД   @:>"   ,  @R % - 2   2 > ; `> ; `2 " <      <@̓* @*``8h4(0 <H /f * ' > "X H 0 &`6 H /f * ' T`> ߔ̗*  2 H p@  $ & 6 && & & 2`q #V @6 `& `& `& ` & 8&  $`,& hH /f * ' > #H\ & $H 0 $ (  & 6 & 0& (& ,& <& 8  n& & ` ()  `()  "     T, - N,, , H, , , , 'Ȓ`8)f ? ,  > , , * 8 8* * * h> !@> 1&@ -`   #& ,   8`&  & `  82̀"   $ 0  `8" ?8&̐@ 8& &  ,Ɛ0 Ð " 龐 㿘(`H /f * ' > "X H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4  +* H /f * ' > #H $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    $ $ * `( $       8 ``! $ 0@`  J ." *J  hd   J@K@  .2`  a >_ +    S   ) %А C0 ?   А `-3   ` * + 4  J ."*  +   #$  螐 㿘@ @# c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @# &&&& &  㿘   * @ `    B ?> "8: .  `2& `  0`@#p  " 嵐 " `  ` `   "   `@"    22&˨㿐2 > "8 >  * `H   d` bv Y `2P    `"ED ` 0 2>  0\ "    1  - "+   @"% (4` ?'"''&ܔ `&ה  0? ? "4``  2 2 2 `* @`*`2`2`.`.`p 'В`   Ԕ   @:>."   ǰ!@   //ْ   > [b b ~ `!"u  j :2q  $  $ (   $ ,  $ 0  $ @"f  2[             @"P  2E  ̀   2`*  `* "8 3沔 炖  +`@Д@ {8А L 2 8洐Ѐ "' ' L8 "'  'Ф 2 `*`@@ I8А LҔ 2 8悐Ѐ !|Tƒ L8 !   !n> PPB?:P! ''X> ;!Ȁ`>>c#  ((!0(آ  (I蟒 0 0  % ( 1 ` 0ْ 0   : `(.` `?`('` '`  '`$ '` ``&``&` `&`@&`$//`'`'` '`$'   *@q //'''' j  > Sc``0@!C  2`` 2```? ? `  @2`2'@`@8    \```8 w?"`8`2@> ;!Ȁ`!> PД\א 0 `&`` :&` `&`` .@&`.`.`.`.`  "> ;!<  `.` c.` : (-,-* 2 2 --  |6     @՚X  X  !< `B:`X !< `B:``>!p*` €X  !< `B:`X !< `B:`X !< `B:`X !< `B}:`X y!< `Br:`X n!< `Bg:`X c!< `ȖB\:`X X!< `BQ:`X M!< aBF:aX B!< aB;:aX 7!< `ЖB0:`X ,!< `ؖB%:`X !!< `B:`X !< `薂B:`X  !< `B:`䤐㿘@*#㿘#> !>c` a$㾘  ` `*  `'` '`'`'> ; X`> ; `@ @맖   @:>Q"   `2 `> L `B {:  ?'` '`?'` '`'`'` '`$'47Ȑ 47  > ;!Ȁ`G!> { ` > ;!Ȁ`:!> n `H 1> L @  //#[ .ʒ >> ;0`"! ` > ;!Ȁ` !>!(K 8 !?`@A  '> ;!Ȁ`!>!), 8 ?$8!Ȁ`!>!Ȓ4.8 ?$8Ȁ  > ;!Ȁ`!>"? ? ؠ`?@ `? `> ;!Ȁ`!>"H > L`(?@+ @+C > ;!Ȁ`!>"ɐ 0{` ``*  = ?> ;!Ȁ`r!>"ঐ =x a> L@1 `?)> ; 2'> ; @U`@ @@  @   /a/!/A/`H/ /@"j h"f ("b   .  > 2ad.? @m  //"F  0.+> L.'> L `B ;ѐx> P!P c > ; X` > ; h`` ```4 뀤``@  @+   //``'` '`'`''@,ɒ ̀` ` ǐ @ €`H /f * ' > "X H 0`" 4`H /f * ' > ߔ  2 H p@ `$ $`4`$@$`$`$` ``H /f * ' > #HV $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`a`$`  $`  `8  `"``$`0` " ?$@8% = ? 0 >6  :``0  0`4 ? ?  ` :  `,, , ,,!F,`!B  ,((,,,,,`4   0!1 `@!-  `0!& @!" @+t %( =&@ ? @&@4 $$&@0  &@"$`    ,(< .` *  = @&@$` j$`%  @ ? " & &  >    >>#cp*q? 6&   ?-  ` " `  8 "   $ 0  @ "  ?&      " "@ & &  " "@ & &   & @ <  .@.``&@$`$` $@  $``? ? 2`-` -` ` 2-`-` 2, ,  2`,,` :?ؑ* 2 2 ,,,,  ( * 䰐* 2 2 ,,    @\  !< `B:`  !< `B:`  > L!< `B:`> L``B  :`` ɐ Đ㿘 `   : @  =d9   242 * "  ( "  `̀`   2 *`̀   q ' $ `̔  㿘> ; > ;> ݐ#``Ȁ`?㿐+4  "3  4 $> ; 0   ,Ϛ " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t+"t> ; > a/͐ +| 㿘 2 4> #8  2  P    , 00 "& T㿘 2 4> #h      , 0㿘`"} ?`x>#*` €> ;_ > ;X > Lt [> ;G!> ;@!> ;9!> ;2!> ;+!> ;$ > ; > ;!> ; > ; > ;!s  @0) *EdE|EGGGGGEGGEEEF F$F<FTGFlFFGFGGGGGGGGGGGGGGGGFܝ㿘    > :>G##@ *"@ *`" *  *  * " * "> Pa: `*@@ 6*@> ; $  @/> :!+ +`" " **"@ " *` * @  *`*  @ *`* " "@ *`* " #@ > P@``2 `4S```:* `4@ > ;`> S#x@& " 0> L"`@ 㿘!> [" @i>1b >  㿘H /f * ' > Sx` x` "x""`?"H 0 `@ 0܁㿈 (?'''D    > PȪ `B 4:Ȕ `B -: "@> "@> P`4" * 4  > P"*  `B ;@ > P `B  :> P `B :D  " b!<@B:@b`B =bD` 'b`  ( 'D``B <`!<`B:`D` `b`B :` !<`B:`D` ) D`b`  * > `@B 8 €    "     2  2  $ 2   `B < D7      ?#@#b     ?#@         D  D D $ DD``8  4 b`B :` `8)? ? ? ?  ?  * @b? ? ? ? ?  * @b`B :? ? ? ? 2  D`4* 2 2 . .  ? ? ? ?  DD`4* 2 2 . . D 8`?  ? 2  ڙ  D  s 0צ    ?> SD  " D!<`B:`D ` ` @ "`  2`` `    @  2 2 > ;!`2Db  @B`DB ; @; y`D ##4 `  @e   cbp`B (:p(: $cc bx`B :x8 ?"8$c!> S#@W ?  , ,  $  $  $  $'$ c,> ;4  '> ;@ <`"> ;Dऀ D 2ऀ > ; ' !Ȁ`5!>#  ڐ 0( X`2 b @B: @D` !<`8B:`8  * @'  b@ 쀢 D   *` 2)`  2%` b`B :` " D!<`8B:`8D  " D!<`B:`D  t 0` ( )   (ㅖ蔒   @:>/#  'Db`B :? > ; X`2 DD`؀ `( ( ` "@ #` D ("`b   > ;!`D@   b`@DB:`@0 DD0zD@ 0u  `2   2   ?#@b  "b  2P ?#@2Pb B: D` M!<` BF:` `B A:P`B :P<`@B:`@!4 > P> :!a$> ; x D`@b`  * @*`@*` !> ;0b`B :` !<`0B:`0tD㿐 )  (⫖   @:>U#   2 &> P  (  ( * `(  (↖   @:>0#     > P?`B :@  && ?㿐Q?# @ "  06 01: w> P `5 q> P ` 4`Q  '&c> P ` .   *` . `;  4(?> P 'H֔$@ @O?H &@C Ր$@   ;?$@  ߔ 4?> P" ֚`C : $@  є &?> P" Ԛ`C : $@  Ô ?" Ԛ`C : $@  綔  ?> P`B :ڄ?㿘 @/ "- 0( > P0#> P`B : 獔 ?`B :`   ` #  x ?L?x 8  `  `@     ) &@ `@@* ``  `   7…  "  4'  _ ) &@ `@ 'ܒ  P ) &@ `@/ . `2( ` (@o > P    *   0> P`B W:   ! ) &@ː `@G (  3  <  +098@7 ր 3 ` *  ` *  ƀ 3" @ <  + 0   ߖ ) &@و0 @ك 3㿐3 <+># l3 *  * H /f * ' > "Xh H 0  6 H /f * ' > ߔ 2H p@  & && 6  . - H /f * ' > #H. & $H 0 $ (  & 6 & 0& (& ,& <& 8   ص 2 (  &  8`"   $ 0  "    &  ؑ  ֔& `(   (   ,3 ((    ` 2 >  h? d3"9`<,"`Y2)`(+;?0P8?0M6`IlG;@ D (ڀЀ><&@ 8 t?#@2/?,*&@ & bȀ"&ɰ? * `@  PȀ&ɰ? *  @@60?㿐?' ?㿘`t ?`(n> #*` €> ;_ X> ;Y \> ;S `> ;M l> ;G h> ;A > ;; t> ;5 x> ;/ |> ;) > ;# d>l( > ; > ; >!ܒkٔ > ; pk -OhOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO㿐 >   cH`'D  "> ; 2-  2)  2%  2! > ;> Pt@> ;``B  ::@!>#` 8ԗԔD` `j 0'   D "p %> S?,D$  4  ͖ > S`.#?`!> S`4 #` `8 ?"`8> S"#!## ND> P`B :   0"3 > S?` @J  1!> S?` !> S`8 ?"`8> S"#@ J   -- #% %  % $!}% # D> P`B :  ֖ 0D#ԏ`@ԋ8> P" @ B`B ; ; @`@  > ;!<`8B:`8> ;> ; t@ @"ߐܐD>`@`p #\` j  㓖 0d`@a< D  ` @  9`4!< ``  @@  ,`4(  !<`B:`8`@!<@ @ !< `" @ @  @ K 0`4`2`0`2`@`2`@`02`@ 8 @ =    / D0} `@`8 D  ? ? ? ? 2, , ? ? ? ? 2`@,,`@ הD DD73`@@%0 > P`@  !<`XB:`X> P@`B :@ 8`B ; 8`@  !<`HB:`H H`B ; HA ># - € Ē0   Ⳗ 0ՈPP0P@PPP`PpPPP㿘 l> ;!@ ?* ?`%>#*` €@Β@@{@@X @@ -㿘> ;!@    .  k& -0@㿘0 !k 0!j  @ @\㿘H /` * !  > Z > Z    $  ( ,  0 a !*` B ;a    @^  2  $ $@W  2  2 ``B :H 0`2``  < 8`h< @`p< H> ;* > T@*`  (: 0: 8 : :  >   "@ >   㿘V 28 - R `:`1 -"/ *` 2+ *``> ;$ * > ; 0"a > Z"!@ $> [!@ !> > ݰ#">aȐv >  耢`&`v:` xH /` * ! > ;!< `)> T*#>!!!,`2 * @*`@  ` `   / ''''   a2ؐ`* 2`@ ޢ!@ > "#> 4u#> Z! *````   ӼP 8 2 `P 8`2``*`> Z!@ p$> ;> ;> ;2!"a" H 0 x`? *` > T* a `~ 0> 0!x > 0t !*    !> ;!?#@> S> S>! ` 8!#`* `""08044!> S.#T8 @K -H /` * ! >!!` `/` '''' a1ذH 0 $H /` * !   <`8,@$`<` <`(<`0H 0> ; `2 x> ;> T*@ *`! @  C H /`4* !  >!!` `/` '''' a2ؐ@ `a?* @ *`2    ?* @*`@ ` 4aH 0 㿐> Z > Z a    $  ( ,  0 ! `*B ;!     @H  2  $ $@A  2  2 a`B :'H /` * !  848 <$< @$@ D$D H$H L$L P$P T$T X$XH 0C H /` * !  a      $  (  ,  0  , { > [! 7>5>@   2l $$@ ؔ  2d "``*`2   ϻϸ 8#\  H $  $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T X [!   @ _  2B$ $@ X  2;$ $ $ $  $ $ $ $ $  $$$ ($( ,$, 0$0 4$4 848 <$< @$@ D$D H$H L$L P$P T$T Xx$X`<` Z(`!@@  @   2  $@   2  2  $@M 8H 0  H 0 1㿘  L=  9    ?㿘 >  H?  ?@@ ?@А `,.  (  $   > ;> Pt@> ;``B  :@!>#`!`    `ߐ  H /` * ! > Z > Z a        # ' ! *` B ;!     @   2  $ @ ٔ  2  2 `!`B :`!H 0@R`B :  8K?   沑H 0? 7        8 'ђ ( 2  LҒ 8H 0 7a          #  '  .@ ` `@ j  2` `$@ c  2`` "``2`  8J  L 8H 0ܰ 7  (Ћ  > ;L 8ΐL 8H 0Ű 7 !"  > ;"   "     d" l0   +`+`  ((LV 8ϠLQ 8H 0 > ;> T!a  > ;*`2  `2` dl +`0 za !>a !``B :`L 8bL 8H 0Y 7`B :@͒   ,`,@  $` > [$`  $` <,`,`$`# a$`$ .$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8K֐ H 0   `4! ` "$$$H 0 㿘H /` * ! > Z! 5> [ @ 1 - ,> Z! `"!x ? $x@`K 8 2@@ @B=@?-@$Ku 82 ˒H 0> ݠ#>aȐpF >  耢`&`pC:`㿘> ;8!   (> T*  @" > Z! 0B: 0p`C >p(> T*   " > #`"    @2   (        8   '  ( > ; 7!  d l" 0   +` +` **9 а > ;> T! `> ;> ;! !  *`2  `  ! 2! d la `+`4"` " `" `24" " ""a  B< 4   ` 7`B < ` 08( @< B`C ::@h` B#> ;a`C > T>`>hZ > P"<  .`2 2 * @  * A> T8a* @*` @ 2(8* *  @`2!8ˇ`˂2 ਐ|`x" 8਒`B >਒@ϔ`( B`C <(<8 @`> ;* 2`@ `  㿈`H /` * ! 沔         8 ' ( 2  H 00}"4 `>   //> 'h  @ H p@0c#l` ` @ "`  2`` ``` ` @o  2@`  ,, $ $  #l$ $@$a<`  `@ :   `@ *     ,, $ $  #l$ $$` 0H 0㿘> ݔ0`B :0H /f * ' > "X} H 0 " 4 H /f * ' > ߔ  2 H p@  $ $ 4 $$ $ $ > #D ( $  $ 沐   $dU 7 ``"  82 ܀  $ "  "`  ?ܒ ܐ?""@@4 ܐ($  > ;P> T"a &@ *`"   *  "*   * "   :  > Za2**`> ;`aC <`  `` 7`B <``㿐>  `B @: @" '`!`B ;` 0 /  0 @@(   @:>Ґ!  ' 2 !`B : /!  gt  `!B˸:`0j<   `!B˩:`0[ !T '> ;> ;B! 48 ?#/ @2@/4 !(`C B8(˂804 ` ( ; `  !(Bp8(0" `0  d!0ͺ`> T*@ !*`@`> ;l '@1[! ,<LXhxLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLh``````````````H`,4444\\\\\\t\\\\44\  4\4\4\\\\\\\\\\\\\\\\\\\\\\\xxx\\\xH|$h<'|'@ 'l`0 ``" ` `Ĕ@4* "'``" ` `Ȕ@(* '``  `@*  '`<`  `@* 'H /f * ' |   | `$" >"> $  ( |?'|ؒ #\  ( ՚ |H 0 K?"'0!  |  @  !@ | @u  (| 2  Z  !H 0Ā  AȀ  ̀ Ѐ  A'H 0Ȓ Ā     (  ('p  `  | ||@  ' '||?c? "| @  '<'| '||`@ 1',`,`, 2 2 ,`,`И` |2@>v"0 <"#@ ``*,`Ā 2 >d"0 *@+@"@`#@Ȁ 2 >Q"0 < *@+@"@`#@̀ 2 >="0 + *@+@"#@̀ ",` `'`'` '`$'   '  $`  $` $`  $`$ x* ?* " " " " ` 2 `` 2 `` 2 `` 2 `2 `> P"  -B: ' > P> P"  -B: '/ /&X`B :Xؐ@T `'l` 2`  4 " ` 2  `@*  " `8 Ӑ?"`8& @+   -`-@`%``%` ` %``$%`"L `H /f4 `* ' `   > ; ,` g,`` `?`,`  H 0 A|o'؀    | 2 ^ 'H 0 V| 2 `2 `t> Pb  AB: ' "`t4 `@0|` < 2`!<`PB:`P`` ` `` 8 ` 4 > P"`B :!<`XB:`X A'`Ҥ`?π``,` ` >" 2` ,` 2`> ; g,``"```" ```> 0!*` `? ?@ ` >  8 > > Pb 3`B :'!<X`B j:X"@` `? `,` 2~ &`2 `t> Pb  AB: I'`@ "`t  "V 8!<`PB:`P " V 8!<`B:`V 8 @2 > P"`B :!<`XB:`X 3'؀` @ "`  2`` `   `@ǔ  2  |  > ;@ W `> ;!` 2 `|c  `  8 `2'@l@ '%%' 8 )?` @?  't? ? 2` ` > 0 ` @  @  t `> 0 `*` ထ* 'tt`?'t`'t? ? ? ? 2`,` ,` `? ? ? ? ,`,`Ā`|  `@3 #  `*`범 | J'`"` ?2` |  A|Ƶ';|`6`  `t @*' ( ` `* @> ; ?c " 'p" ? ?` ̐ ( 0'!<`hB):`h  `Ȁ 2 Ā " `  , *> P"``B :`> Pb ` 7B: `' ,,`p|H /f * ' > "Xw] '|H 0|`' 2`H /f * ' > ߒc`  2` H p@ | "|"`| $" |2|" |"` | #V @2|> %|D   ( # | (]|"` |x@p 'p& ?* x2 2 *@* %x  *`  * 2 2 **p@?* 2 2 .`.`Ƈ  "j> P|| "`|4"x4*`x4* * * * x> Pb*x`B :x!<`pB:`pS "  !<``B:`` '|Ŝ' | |`"`  |@t'ň| '|  > P"p`B :p l؀`"l`8 @؀``8 ? "`8_][YФV|܀㿘4o 7H /f * ' > "XvR H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4  --`H /f * ' > #Hv $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  `ğ  7$  A& 㿐 ?H /f * ' > "Xuޒ H 0  3 H /f * ' > ߔ 2H p@  # ## 3    # ,`&      8 `"     $@  0 "     ?# y (4 7H /f * ' > "Xu{ H 0  4 H /f * ' > ߔ 2H p@  $ $$ 4  -H /f * ' > #HuC $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ' 7$  i @& $ @ ,@,`  ` *` ,` ,``'`N `  "`㿘( ؒ (Ė  ] 7&@ 2   &  &  & ``@&`H /f * ' > "Xtƒ H 0 2H /f * ' > ߔ 2H p@ """22 7 " && 㿘 ,    4  @ܔ  " `8 +?"`8& 2@ݒ   .`.@&`&` &` &` ("@< @` @@:  T &   *T  (!'P  "T" A< @`@@:      *''p> "`` `  8)  ` + 2 8>"P* € @#ذ`  2  `>!* €!8 $  ` ?$ ` ` ?$ ` ` ?$ `@ ` ` `  ` ` `*@$ `ƀ`Ĥ  @ `" `" ` "  `  ?$ ` ?ߐ $ ` ? $ `H /``* !` ` $"`   |   H 0}``"z ` 2u `8p 6"> 2750= <,08> 2# 63,  !:F 2, *, # 6&,  !:F 2 , > 3 6,  !:F 2 , > 3  6 ,  !:F ",  *`| <*@ *  $  $ ` $ ` $ ` `@ `  `  ` ` ` $ ` *`Ű`;> *` € 沔 u '  '" ` `6> *` €/  `,  `2 ( `2 $ `! `2  `2  `2  `2  `2  >!܀ @  `  2   g '` $` `"@ @QZH /`4 * !  !   '  !'! '!'!'!'!'! ' 3/' $$` ` $H 0$ 6$` 75"  `<" ` ` "  *  `ǐ㿘`   ) 9 6 2 2( *  2$  2  2 ` R `:2"Ȁ  ` R` : Ȓ ǐ ' " "@  㿘> "    " $o$ @ {; $` ` ` =[ {` V a:`E8 " @’ $ @h@> "'Ȑ  5;v 2&@\ 7$> ; g ,,$?`8>#4*` €1  "+  > 0!x@ " > 0!* ` T`8@2$ 1   В А`! 2 > ; g,,   ̒ ̀   ,    2 2 2 2  !:D  'Ȁ Đ > 0!x@  )> 0? ?@ > ""@ؐ @_'ؐ /ܒ , $ $ $   $ ؀  1  @`!* ` T`8@2 1? ? 26 `2 `@  2  m 0Ƞ "h $  "`$\$ X  T  2 2 2 2  !:D > 0: 7 > 0!x@ 1 > 0!*? @?@ 6 ``2 `@  2  2  1`"  "`  "@] -' > ; d @     @;֒ 5&@ȁ㿘     &&   -0! ``"` @`2`4" `` "`  ` ``"` > ; d"`"  -㿘   `""`"@  2; 5x  ` @I @?&``"&@̰ &` "ư  @`"  @8 ` )2@`?퀢`>#H*` €@ $ߖ`&`  ?` ? 2`2`> 0!x@ 8      "y@@ `  //''' y'얒 "r 1`   4@ 2h 1ऀ 2d 1 2R@^ 1@ `` ` !(D@P "M @`"I  ` @*D `2&` @ q` &`@ (7 ` i`&`< @*`` " ) @ Y`&` @*  @2   2   2@  *@   ?@& @   ?"@`?&  㿘沔   7   '  ( * '8ې 0"??  ? ? 2* * ? ? ? ?  **  㿘 (a H /f * ' > "Xn H 0" 0H /f * ' > ߔ  2 H p@ $  0   2 u$ 7#V @0    (     (  &  6    ؖ(& &   & &@  2   ("("<(<(㿐@`   `   @: >v "X   2 )> P   2/   * @ 8   @: >u"X    > P!`B  :@ !0 > P" `C : $    !  * @&@ 㿈 `2˰ > P" `C : &  ̔ ?2  " > P" `C : &  ɺ ?*  . 1  2  2   2 ""> P      ?#@"> P2`  2`  2`  " `> P`B :Qh?` 0> P` `  ` `$ " > P ` ` ?#@2`` 2`` 2``$  " `> P`B :-?`?#`  ? # '` ' # '`$'# 3   &`&` &`$ &`  4*`2`2`.`.`䁒 ?㿐> !> ݠ#" (   , , , 7 , , 3 > ݐ#?" " 㿘H /` * !  > ; 4a2` @%  "& $  & $& ( @~ 5@x 2  & (& $> " (H 0㿘 > ; 4a3  > ;4!4  $   @     @O 㿐 `    ³   @:>t]"p   `2  > L `B : ?? @@ "@K0ˀ  " 0`8 ` ` 2 `` 2`` ?` ? @? 2 ` `4* 2 2 .` .` `   "   2  ``* @``*@2 > ;`4!2  `r `!@a  3 `  (/@` ``  `` `` `@G  2@2 `( @ $`($`$ ( @S@ $`(> " (@`Ơ`4` @9` 5?` ? 2 ` `4* 2 2 .` .` ` ` @ "`  2`` ``` ``@  2@`"`$`$$`(`? ? .` .` 㿐> `( H H /` * ! $(> S#'' ` `` '' #  (  ? $ ( @ $ $$( 2 ` `` '' 2 (H 0㿈  Y )ऀ 2 H /f * ' > "Xk( H 0`#>  4`H /f * ' > ߔ  2 H p@ `$ $`4`$@$`$`$` `H /f * ' "Xj H 0 0H /f * ' > ߔ 2H p@   02`c0 @ ($`$` $@$`$`*+`+`+`  :  `* +`0#`4#` 8#`< #`>!!` #``#``#` #`"  #`#`#`  #` #` #`  #`$  ........ ?& &  ?&  &. .  (  :* 2 2 ..@ʒ > ;> L!.`  @ `B 8 //'耤< `B:``"``$>  > ݀< `B:`< aB :a < aB:a> ݐc`? k $(Ƞȴ㿘> ;a  >br' 0%> ސ 8*8 * > [ +  (+b"b"  #a!> [">8b0Zl >  *"@ *`@ Zh*`㿘  |3 8@9 8  @!0, , ?$  #2 * * @ސ$ # $ $ @㿘5R |㿘!<@㿘 <  ` #2 @ @; @ @!v@8&`&` > :`>b q > :`! 9㿘@ (&`& & &㿘 2 >qO"2 >qI#`"  2 `   `*  @ & @ ( 2  & &  㿘  >q"#@  2 >q#` e > L `B ;@펒 (W?   뀢0> ; `!>0!ē*` € *  > ;!Ȁ`>cq' > ;& * `"& & $> ;!Ȁ`>cq > ;!  > L!@ `B :> ;Ȁ  >cp    㿘>  HH o *@a!> [">1 Y?b>  > ;|1> [Y;> ;!3> S!̀ 5> ; " ``@{<   @t` `L`@ > (pn 2T > Ppg``>0!ؓ*` €> ;!  6  $ <#@#@$  = > "  r 8$ :> ;! 50  > ;   4 $ #> ;! @ $ 4 > ;!  6 $ <#@N#@ $  @ Ø  @̀2{ " "c `@:@i     H " ( ؐ "  H "    ?$ `2 쀢``8"``H%@ (``@ H 0㿘> ["`#> ;`$ @` 2@ `2`$`> ;`$ @` 2@ `2`$> ;!쀢` > [@`@l 2@> [" 4 > ;@ː > ; X` a> ; h`a@là`!à@`@0` `  ` 4@ @ْ  à2`pؐ@ƒ     / /ْ''' '쒒 '`4$ Ԁ` `8 ?"`8'Ԁ (Ԁ` rM 2 F b '> $8 > Ԁ 26 Ԁ "2  L`?2` 8" 84 $$`0 ``L  "D @"Ԁ`> p=> o  㿘 ? ? > ; `4@>> ;!쀢+> ;2#P " ( 2 , 2 0 2   4 " 2> ; X` > ["`  > ["`4   9 @ 㿈 > ;L' ''X C'> ; h`"?H /` * !  @@  "V  `"V V  2V `" V & H 0  2@ @@=耤 @}6 @/H 0     㿘>  H   0 ϔ + 4 $$& L" 0   R 2 > ;aĐ   " `2 @!<` "㿀>  H`4`@ `09`L@"  `4 0  @ " `4`   `4 ;&`4"ˀ` "`40"80%> ;` `0` <,44$``"`4` "$``4!8  `  > 8 <`mА 0,44`  /  &`L>`m 0> >  40`# 4"0@  $`4` $` 8 ?4`$``4> ;$&`4a̖a$@"a@$`" ` `@` "'`4@  4`$` $`  ` = =,> ;!`> "@`D &`@ ʐ?"   $ &`D@ 4`$`$`T8 @|<` #'  ' ''747'/'䀢 b> ;!Ȁ`^!> cm< 0SR`4@7'> T8 @2<` #` '`  '`'`7'4'7/' ` @ "`  2`` `   @7  2 00`?@$0"``@"$``4&`L ;&`4` "0a 㿈0l ' 0 !L "` 0aUaVܰ0!NW/00HaPh aM)aO*00J!J1!KM0Ð@!(H /`4> [* !> [" 2 /,"*  @)> ?&` &` ?&`  &`6` l! `.`  6`" &`$ `46`( ` $ H 0z@裒'H /`4> ;* !> ;!쀦_ \,* +@ "`$"`(" `,"L * X*!8 <#@  420@ T +->` 4# ,`-  @ 4  8  < ? @4?  06$@-  lX ۢ`* * @2 2* "` ,H 0@- 8< @`" @@* $ < ` @  $ < `$ < `$ < ` $ < `$ < `$ $< `$ (<  `, ,< &`&`&` &`&` &`$&`(&`, &`0$&`4(&`8,&`<0&`@4&`D<`$ "`@A@O┑H /`4> ;* !> ;!쀤 !  ? ?  > S#`` @``2" `2`@ `2 H 0qH /`* !@ > [" @} @H 0R`?` @`?` ''''? @? ꀢ 47H /` * !  "  L2 R H 0&`(&` R&`$&`,H 0 > ["&`@`㿘>  H >j!`2@>j! `  ` `  A 2  4 : (2  "  4 $$" L   0`` `@ `  `` =@Œ@ @    =`.`` =@ 2 `2  `    ? 4 > ;a  $  @$ "$  "  0 ` 4  4  `  24   4 T   > ; X`> ; h`@㿘H /` * ! !> [">8b0Rn >  *"@ *`@ Rj*`> "8`a<  `"` 1 $ > ;!?$  #2 * * @ސ$ ``2a  H  @Ր `A`4  Y  `8`@?@$`8`4 &``0   "`x 8   A " `0`4  ``0, $`x " A`4$2`L~    `L`2 8 8 S !< `M !>!ih c   T  > ;!  4$T 2 T> ;!  4$$T & ?"4 " $  2<  $!<#@(#$ @ *    8  `" `    "   2 v=`  Đ <5" " # 0 0  G 0  㿘"` <"  3# 30."/0+/ / / / / #/ ! `0` >i" 0`` ͐@  !>Ơ"H ic 㿘`9 3  `  *B  %     *@@g  `ʐ+ג 㿘   H /` * !  @> [" +  `(@} (  ,`,@ `$` $`  $` $`u ,` 4` $`   44`$`(`( ڀ &@ &@H 0㿘   H /` * !  @> ;!쀤` 5> k8h@) 8` $`$`$`$ `$` $`$$@ " `L g̒x `L, `X,`8$ `<$$@ 444`8 $(`H#" @ $($(`\$0`P,$,`T % ,2 * "@*`  * -    " "  " " ` Ӓ` , 46`T   ,2`*`" *  8@`` @&@ &@H 0 > ;   ' ''''h'' '$X'@   Dl  l @:>f"   `2  > L `B :  `'` '`'`' > ;!Ȁ`U!>"-* g Fa耢 (쀢 $   ?#@> ;܀  > ; > ;䀢  > ;!Ȁ`>NbȀ  > ;!Ȁ`>Bc ? ? ??   47ʠ`M  > ;!Ȁ`>cPf 0쀢`" ``*     ؀ > ;!Ȁ`Ҫ>cf aȒȐ `?  0p@⺒ Ȑ ̒ /p/q'x'|''  4@  0 ` M    0 'h `_`@' '''`    " = ?> ;!Ȁ`w!>#O =f( laȠ@P   !> ;f 0V耢 Q쀢 N K H@n0D +쀢 ( % !>"("(` '`'`'' 4` 7ꀧ`".` h@0  ` `".`0h@0-aȀ  !> (אe aȀ  !> @̐ؔe aȀ  !> XȔe > L `B ;U @˒  >  = cD ?  @g  > pf(>e1 H /f * ' > "X]< H 0" 4H /f * ' > ߔ 2H p@ $ $4$$$$ S`D -H /f * ' > #H\ $$H 0$ ( $4$0$($,$<$8  !`$@  D "4/'/D @$@ $ $*@ ,,, @  :  `*@  , @%,@!   ///ـ` /` @'`'`' ' < 4c'̒ 77'/' $$$ D$$   ` (`  @'`'`'` *'껔     2> ;!Ȁ`!> d ''' '@ඒ  $($ ?$?$,(.`.`.`.`.`&` &`  &` &`? ?  .` .` , @ ` =  ?@$$ @} .`< ,` = U`, 2 2 ,, :.`.` (* 2 2 .`.`@  H > L!< `B:`  > L!< `B:`> LP`B :P8 ?"8 0 0 ``8 ?"`8H >     ' ' ' $' H> ;!Ȁ`!>!  c x> L  @@   @@:>cf"  `2 `> L `B ]: ?'` '`?'`'``* `**``@  2 2 2   `? ? 47؀ > ;!Ȁ`&!>!Pؔch > L耢  `> ;!Ȁ`>acX > L`  > ;!Ȁ`>acE 0` ``* F  ` `@ϐ 0 !>!M c( 0ڀ = ?> ;!Ȁ`!>"8  =c > L   L`0 T` + =  , ` =  `4``$`@!<` $`> ;!  4`$` ~4`@ {42    ` =@ @  `` `T` l> ;!  $`f4`` `2$T`  = , ` =   `4``$`<     `> ;!  4`$`T` ) 2(4`  H o *@ a @@ "> ;@, X` > ; h`@@& H 04`4 ?$4` $` v$` 0 > LȘ `B ; @z  =>  cD ?  @g   >"Hcr(>a"H /f * ' > "XY H 0" 4H /f * ' > ߔ 2H p@ $ $4$$$$ 2D -H /f * ' > #HY $$H 0$ ( $4$0$($,$<$8 4 $@` D"4/'/D @$ $ $* ,,,   `*  :,,@ؒ @Ԓ `  ` `/@/`//'''' < 4c 77'. ''$$ $ $$  m 2@> ;!Ȁ`!>"raL  '`('`?'` '$?$ $,($.`&` &`  &` &`? ?  .` .` `2`@   ` =@ ` @  ` =  ?@$$ @? .`< ,` = `, ., 2 2 ,,666.`.`.`.` :.`.`T (* 2 2 .`.`   > L!< `B:`  > L!< `薂B:`> LX`B :X8 ?"8 0 0 ``8 ?"`8d <5"!\"!\#!\ !\ " !\G!\ 2 !\> T"  22 㿘 >C ``HŐHǒ㿘H 㿘> ; 2  > ޒ T" T"` " ``>"g 0 ``>#0`; 0 '> ;| 2 v& 2 8>_#8 m h 8 |!ڔ  2>#`9 0 ``>#0`  0Q@K 8 @H $> ޒ`T`$""`> ;!Ȁ` #> c  0_  `|$ & $ $$$$@7 #< @ѐ#> |l0@  > @_ > 2`@ @U:`@@&@S㿘> ;"` 8 P`"  "`> " X "@# | ?ߐ0& 㿘H /` * !  > c 2 >c_z 0} >  0 `>2> ;> H 0 ``>#0_[ 0^"@ > ;!Ȁ`> `_L `2>> @6@ #< @-#> Ȑ04@ `2   @20(i0%& > ;aȀ  #> ` 7 0_ `""`> " X"@"z | ܐ?& H 0㿐x   0>`^ 0</09 >a#\^ڐ   `w&  !>!X`^ɐ  >a^Ð `""`> " X"@", | Ȑ?& 㿘 `  & 8  @   `& `0    㿘  0>^N!> ;" ` > ;!Ȁ`!>! ^{ 0"     z0 "㿘 >^" ` "`bX > ;   ' ''`h '> ; X` > ;!Ȁ`|!>"0SP ^( n> L &`2  2  2 [ @@   @@:>]"h   > L `B G:  L셐  > ;!Ȁ`+>b] 0&`` ``* ` = ?> ;!Ȁ`!>" =]ǐ  > L ՚ 0 > LИ `B ;t > ; a< ' ''h '   > ;!Ȁ`!>"`] > L? ? > ;!Ȁ`!>#(]q > L  @@k4  4 @@:>]"h  ` > L `B s: `롔ڐ 6 `> ;!Ȁ`W>cP]9 0R> ` *` *`@ ` *  H (@i 耤`''''`/``* @ '7' "@8`  "` X%  #2 * * @> ;a% % ` ` *`*`@ * ` 2% ` 2- @M̀` H%> ;5>3> 2  Ȁ }> c ` u>cД\ǐ p   ?  ?  Ȁ "a Ր  \ Y  28`@Ȁ "P Đ  \`PG 8@ْ `  /E/D  'L 'P 'T 'X '8 2`* *` ' * 2` `*` ' /  +  *  * @ 'p  +  *  * @ 't@' 2 @G *  (v ԀB  ?  * *`@ *   d> ;!Ȁ`,!> V\0 #  `@  @ > ;%!Ȁ` !> 5\ Ĕ ` ``*  `= ?> ;!Ȁ`!>!( `=[  > L  @0 > Lؘ `B ;` 4@` `0'`'`@'`D ` '`4'؁0'@ @ @      / /''''////'H / +!  ̚` `8?"`8  & $H 0> ;"`'|@Qؐ@׭ @ש   ////^R 2 > ;!Ȁ`6>ah [S 00!@׎ 4''' ''ߔ| > ;!Ȁ`>a [7 |`"  `8|`"  V |`8?"`8 %b $ P> ;"`2'ؐ@W @S   ////  A`") `8 4 "`8` ?5 $"` $㿘> [" "  2  @   2 2  㿘> ; X`  > ; h`" $ @  $ "@*`"  "`> ["" "> ;쀤  @ " @  @`@T  |0 '>ZH"ؐ@Ȓ @Ē @      / /''''////'  `"& $ `8 4& $ "`8g& $㿘> ["  (㿘H /` * ! > ; X  > ; h`> [> ;!Ȁ`> ; h>b0Z$ H 00zb  >  \ (> ;!Ȁ`>bxZ H 00^b ()>2 $  l "  $ L " $R  4 $ `` `` Yْ" ݀ ` b@ b`` > @ L @R   @@@$@`H 0 㿘H /` * !   5 0& . 6 & 2 H 00o`)> [ "`> [ "   "@:H 0X   (H 0M  |   H 0? @Հ ()> [$@$`$` $` $`$`$`$` $` $$`$" "$@ " $@ $@$` "& " $` "" H 0 T   2㿘  |  @/ $  T $"  T$ @& T㿘`"  "` "@M |㿘> ;!쀤 @2  X X2    " 㿘 ` |q  U @ `ʔ `2&$`T`( `X> ;`   ? @" H /` * ! aa쀢 $``"`#a$`H 0 `L `@Z `> ;!Ȁ` !>"  X Xd `i 㿘 P& 8 & <@֐ > ;!Ȁ` !>#Hk  X XB  \ +H /` * !  `"  "`  "@ T  | 2H 0 |@x H /` * !    *@`?) G  L L &L L " LL &L L "  L 8&8 <&< D&D @&@ H&H L `P `@ > ;!Ȁ` !>#X W `; 27 L2 L 8 ' L0@䤒 > ;䀢`2`L> ;!Ȁ` >c X #\ W0v "`8" <@ L@i` U> `H2J  2F    X2>  0R  7" @"2  ' ' ' '? $@ "@  8 @  " <'' <'@$ $ $ $ $   2 8  @2 " 1\ &\@ "`H 0㿘 T    ~  " L "R  $㿘> ;!+> S    L 6 ܐ  a> ["`- "Ba ? ? "  L 6  P    P $ P P "   "  P ?$ P  2 a"a??   "   L "  P  ?$ P  2 a쀤 @) '> ;%> ? ? "4  L"0  P  2 P@  Ȁ "  P  X Vw( P 2  L" @P  Ȁ "    X V_(  2 c "*c @"  " >  c $ @"  "  ,   ? $  2 0   @ ?$  2 ` P '> ;!Ȁ` !> h2  XV   > ;!쀤 "  P "  X X2     2s   퀤ޒ  2 `@ `2``> ;!Ȁ`7!>   X Uϐ M @   ,  (/ 0' 4'''`  @  Ԧ > ;Ԁ`" PҐ  P & P! !Ȁ` @` X>#\#`` #dU Ԁ``8?"`8H P '> ;!Ȁ` !>!`  XUm | ؐ@Ѩ    //ؔ @њ  (//u    艚 @> ; P ?`& Pl > ;!쀤 B)>"*  P 2&  2#  X X2   "  > ;!Ȁ`" ; X`#\ !U`  Հ!Ȁ` !>!% X` T` `8  "`8Xp֒ n   > ;!Ȁ` ># b0T͐ Z @  x @П  //ܔ  pt @ x|  @''''0* @ '4*'8*'<*@'/ڶ/8 @<''' > ;!Ȁ`!>"hTy  㿘 <>  8 H  > ;!Ȁ`>bTb  @ & D& D 8?@& @& @ `> H"@"@` "`"`㿘> !`H /` * ! ? ? " `4H 00>N6  ( bdH p@㿘 0`" ` 2 `@5  2  4(2       4 0 㿘 > 0!x@> [ b  "b> 0!.  > " \> " \ GtGGH(JJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJHTHHHII0I\IIIL@MN8QO4QMOQPMQ<QQQQQ(Q㿘> [" p> [" B':"`   2 ?#@    ?#@ΐ0@G   //ْ  F> [b b@ ``!"` `j 2~``$ `$`(  `$`, `$`0 `$@  2h`` ``  `` `` `@  2R``Ȁ?" `B < @  ("  `B ;< 7沔   /`@Ԕ@8Ԑ L 28MԀ "G"(`B  :( L8 "'  'Ԧ`@2y``/`@ޖ@{8Ԑ Lg 28Ԁ ""(`B ::(U L8 3  0."`B : ; `B : ;2@> P  "  !<`(B:`( #   > PPB?:P!㿐`>Z`C ,@ ? =?     > ; `/> "  ? )> [ 2#\"`   r  j `?R#\#`"  0'T'X 'H'L'P @ '  'ٟ '` R `:2      2  7'    ``" 8`  $"   ?ܐ" '  (?" '   ?ؒ`(& &  ({  "    "   (&   &` `&` &`  &`$`B$` H `@` $``$Q 2  &  1#'&`&` &` &``@ > 0 @`4* '`d<*2 2  ```2 .`.`.`.@ `j.`.` R `: `Ȁ?`:2`Ȑ '(7 ` (k7 `  'R` :> [ "> L!< `B:``>N#`*` €  `!< `B:`` "> L!< `B:` "> L!< `B:` "> L!< `Bz:` "w> L!< `Bo:` "l> L!< `Bd:` "a> L!< `ȖBY:` "V> L!< `BN:` "K> L!< aBC:a "@> L!< aB8:a "5> L!< `ЖB-:` "*> L!< `ؖB":` "> L!< `B:` "> L!< `薂B :` " > L!< `B:`> L!,  B;0`B  :0'  @Ր@`  ```8 ?"`8㿘):- 00i le 0k  $ "M 0  L )Հ Ŕ :   /p   @ `  'ԐR`F.`>O! €`>OS" :'ԑH /` * ! > ;> ;   'ԑH 0> [bu  'ԑH 0H 0 ?$`,`j    $` 'Ԓ  * ``(* 񀦠  >!!$``` $``$` $`  ?6 9`2> ;>N#! 2``̀  $`Kǀ  > "8`S 1 O 1    ?#@A 1    Q" - 1"ऀ ' 1$`$ $`($`,$`0 Q> "8` 1 ^ /``@``$ܚԖ 2 Ԁ m 1i'Ԑ$`$$`($`, $`0$` $`$`n$` WsS   8J'Ԡؐ@ߒ   //ؐ`Ը #2  97'Ԁ " 1'Ԡ''' '''ـ`' /'Ԑ'   -'Ԑ >N#ԁ0 8> ` `@    ' 1 '& "T     2 /  1   8  ݐ 8  ِ 8 Ր 8'''  ''''     @ $  2 6  1' 2`s '` 2 4  2  4  2 4 2 4 9 $ ``  ` 0`8 0```$" `?ܐ?" 0  0  `` ?В`0&`&`  0 `_ 7` `` 0&`V 7`? 6 (2 (c 4 4 4 `F4 `H d<+2 `2  ```2  ..... @   @Z.@&`& ` &`  (&&&&  &$* `4 <c4 > ,`",  @  y ' /' "& 㿘@` +> ;"*`   0@+$ 2@ * $㿘@ 2> ;"*`"  㿘 沔   2 H /` * !  L> ;b,  H 0 7H 0    㿘 & ` 2` `@ (  J  2`  ` > ;Rb* @ ``n㿘  ]  $ 8 @ܒ H /f * '    H 0 2  > ;","` 8 > ;`@ 4 R* @ 2  ߒ 㿘` > ;Rb* @@H /f * '    ܷ H 0 " 㿘  *`2`  > ;":` `& +`0 | H /f * ' |H p@㿘> ;"  . `2  . ** *  *  J   '> ;")> ;  @  "p 4@ 4  4?`> ;"<` "$`F J$`$` 4 J   > ; "p 4> ;"<  "$ . J$ $  㿘 >  > ;b<" @ "`|x|||||vwTwTwTwTlLmpstwupwvwyXyTwtl㿘  3 &   㿘  J ,  " @ǭ > ;> "$ $4 "$ 㿘> ;""" @@@ "@ 2@@"@> ;b?"b> ;b?"b  J 㿐  ,   *  ,   J ݔ   ; 5 4`     2 +*@* @  { `"6> ;``0s0 ֐@(   5,,4$Z m> ;"`` " @` @`2`i0B"``  `  @`*  `@`2`h@   5,,4$ '"``  2@` r@`2`D> ;"` ` a@`2`3@ƫ ߒ Jpؤ@ơ  "  "  $  $  // h  //ؠ  J   ' &@Ɓ`&`T&`Xـ    ( 2' 7 ( ,' 0' 4' J'7ڐԠ@7`&`D&`Hـ  0 X b' 7 X \' `' d' z'7ڐ@`&`X&`Tـ  0 , 4' 7 8 <' @' D' L'7ڐ@ `&`H&`Dـ  0 \ d' 7 h l' p' t' |'7ڐ@ ڒԐ &`P 2@ـ  "  x  ` " $ 0*` $ *` " $ H*` $* 㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"!% !%  !$  ?@!  !  ?@!A  !@  ?@!|  R   ?@!  R   ?@!t  R   ?@!x  R   ?@!  R   ?@!  R   ?@!\     ?@!`     ?@ J ؔ  ' &@V&`@ &`@ ;    @   Ԁ@  @"  &`@ "    @   ܀@  @" &` @  !$&`@ &`@ !!@ &`@ ݒ!@!| &`(@ Δ ! &`,@ Ŕ !t &`h@ l !x &`l@ c ! &`p@  ! &`t@ y !\ &` @ ֔ !` &`$@ ͔  @ `x! 2! x |@ĭ@'xƔt x" `   &t ͒ J  㿘@`! Oߐ > 3   -00  -0+> 3$ 3#*@  " 2*@ " *@ "> 3 l*@ " - 'H'p'`'l@> |> ;" 'X `> ;`2@`b ?  J   '` @ ` - - > "45 4H`% ``Gt ~'pb      t 2 Ztwt`@` % J'`H@ ]'p ?`U>W d*` €ؐ@֒" ڐ /O D'p@ @ (  pHVڀ 1'А  J 0  '`' @ï `'l''(@ tlp< 쀢` 4 8 @  , 0 4 8 @ , 0  H /` * ! ` ```   l 2 3H{  `$ lP'`@P  h` ,!!ǔ 'p@Ґ@ !$@ !@ !@@ t @ p @ l @ '  @ # @ n @ j P@ 4 T@ 0 X@  \@  8!4#`<#\,!@@ >0'' 'X $ `P 'p`NK$ LW`)'`            @c @  @  @  H 06p< 쀢` 4 8 @  , 0 4 8 @  ,  0  H /` * ! ` ```   l 2 3G 1  ` - O'`@g  d ,!!ߔ 'p@@ !$@ !@ !@@ @ @ @ ?  @ ; @  @  P@ L T@ H X@  \@  8!4#`<#\,!@@ V0'' 'X $ O 'p `Mc'p'`Km`H 0t'` H /` * ! ` ```   l 2 3F  M4H 0JpLY` @ $` <'p 9'X H /` * ! ` ```   l 2 3F ^` 'p 'XH 0 p`> ; $``" 8 J  '` @ 8` 2@`> ;`"W 0` '$ J  '` H ` * @$``@b ` 2@`> ;`": ` '  J͔  '`Đ @L ` 2@`> ;"`$ `'`'p ` >W <*` €H /`4> 3* !> 3!<`  ` `U 2 `H 0H /` * ! >Z!tHa H p@yp>Z' 'HS 'p  7kph'p H /` * ! ` ```   l 2 3E 4 DH`     l 2 3 Eْ v "t    `" ` ""`  `"$ ` ""`$ " H 0p 8 ?    -       48<#\#`,@@0h@o 0x@k 4|H 0H `0 + * Օ x 0 8 ?"8@3 0 2  `0@, 0 2  `` ` `   `H 0p` T'pH 0pH 0 78> 3a  #> = "a>c0a#\ ؔ  : a; 2 H 0f @ ؐ $`$``$` 0  /h/i7j 0ɿ'l`0ɻ 08 `>W $*` €",` ,` ,` ,` ,` ,``> =!<0SH 0#    ` ,``|ɂ `|@ ``w  ``@       l 2 3` ,`P4$`` P-$`"- n* ??  $``"> =SE0!<H 0͐ 7 2@` n2``"`"``R`)` + n* ??  $``"> =S0! =O> =!<3H 0`p> 3!<!<`$`<`"`А`""<<$`> 3a( "a( <`,`H 0@p"H\ 6'pb " `" ` @2  X\ *\p  `2`@  Ⱂ`$`  $Ⱂ $`?$Ⱀ 'pp  7 5 73 *"@p &  -     *`+@ *> ;c(@  `> ;# @  `X ݘ 'p` "H JH~ J p 'pH 0p> ;%> ;"`"  @  ?`  ?@ p`h଀ `R   ?@ఀ `R   ?@ J  xi @ |@'x  7`.6.&ࢀ 2 . 3 l  ."@ '2 2@   ǵ`@'2 2@   Ǧ`଀ 'R   ? 2 3ଠ3  RǑ`ఀ 'R   ? 2 3ఠ3  R|`ഀ 'R   ? 2 2ഠ   ഐ 2 R_`฀ 'R   ? 2 2ภ  22 RE`''tt  *2 'p > 2㬀 6` 6`ࢀ 2M l> ">c@@  >  @;!cH@  > # cP@ޔ  > @ 6` .`76`cX@є >  (!ch@Ɣ > P .`6` 6`cx@ƹ  >   ( .`6`6` > > >!hc@Ƨ  >  .`6`6` > b0>@ƙ >  c@Ɛ  > .@6`6`c@Ƅ > 2  6`.@6`> 2#> 2+> 2> 2> 2c> 2c#̦Ē;= > 2㰙=`+> 2c> ==&`&`>`>` >`(>`0>`8>`@t`Hp `@ M'px  * @̒ J! 3 26 !  l"!P - J!$  ?  p  't@ x@p |t@lt `'t'x *@*`!> ;*`"4t"`2` t#"'|@!t'@@ t.`2 $@ @8t!$'@t!'@   Ø @1e J㿘#> ޠ``@&  >W>W>Z$```ؔ0$ $ $ 㿘>  ` |||@@``llt`㿐@ |` & * 2e     〢> " `4 2T   `K  J> ;#*`& `(C * @Ś * @ *`` >b#p*` €2"  8 "  8  8  瀢   2  `` ? 2  `  !( w`u   4` ` 2 @] `@G [ [`2Ұ ` U+ 2    4` 6`E ( `@`?: *  2 5 (  8 + (  8 ! (  8  gJ?`@=  ?(   *  "Ty (v  @C H @  H @ = 8a   8]  `@ * -(Q  ԑ+ 2    +`2 ? 6 @ 4; `  ` 2/ @8* &@* &`ߤ`2   > ;#D*` 2      0 `  0  `  t|`8"0 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$2* al2 `` "`"* `"`>d܇(      * `"`$ >d(        * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "㿐`H >  H H ''H 0 "N`"`0"`0 &  $  $ ?& $` >  $  $ ?& $` >  $ :` B   & $2 (#  ' (޽%` $ ?& $` >  $ P& $ $ ?L& $ &  $" $ =& $` >  $! $ >& $` >  $ :` B  & $2 (#  ' Xz%P` $ ?& $` >  $$ & $ $ ; & $& `> `> `> ȁ@  $3"$=@"39@"$# $"$; $"$; $ "$@ $# $"$; $"$; $" @# ; ; ; @ #@㿘\ ``z @ 0@ 0`2 `  @l@h`@dRN .`.  0.@.    0O 6   .  &  . &  6  6 6`.`&``&` 6``66`4.`6   .  &  &  &  &  &  &  &  . (& $ 6 * 6 ,6`.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`(㿘```  `` 0 .㿘@  ? 2 2@`&@`*@  ?@&㿘`(!!@ n*   &@`*`2 22, n & "` n"`R`ɒ` 㿘`.!t!x@ n*  S &@`*`2 "   2@ 2@ n & "` n"`R`` 㿘`/!!|@ n*  !?&@`*` 2 022ǒ n & "` n"`R`d` 㿘ataxR ` `2`2  "  2`&R C R`  ?@&㿘aaR ` `2`2  "  2`&R  R`  ?@&㿘aa|R ` `2`2 "2  " 2 22`&R  R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a````  ? 2 2`*`2`&a\``  ?@&㿘`> ;ɐ# 㿘> #` `@#`?@`> ["#` >;#0 40@: &`0>`@+f&`D> `"&`D`D> [!> H#"# >`@*ؐ`0&`4@ 2 *@&`8 <* '' @#\#` ?W  > :`p%@ >9 ( 4 &`@%> b 4,` c @>`<  c`T    Ңc@`@* @ `8@* ? 5 >#?`@`0&c‘:  0$ Є&`@ :`@>`< `T  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0>@ x`82`4 `2:3 4  >@Mc؀ 2'4 ''@*. %>#>h@* @' '`$ @*! > H> [ > [2@ *` <c#@0 @("@ 0 p > [`> H< "0@("0 4@㿘> #   `@`?㿘  > & " 4> :i  4>:e > c  >:Z! 㿘`> :Q  P> #`` 4>>:A!X>k#{#|@# ` >>:/!H0:,!X4  >@` 2'4 ''>!`@)E @ &`<   &`8>!h8z@) @)R>! N`%! +>)>i@&+ a98_@&4  @ C '!#Ԗ N 4'> Z->+>)>i@) @+ 2@& @a 2 $@  '!# @( Ԑ㿘` >> #`>> `@ڔ  >>9!H09!X1> [# >k$   &#>7!@m$>k"#@%㿘` >> #`>> `@  >>9X!H09U!X1> [# >k$   &#>7!@;$>k"~#@P> #`` $`>9.!H0R0`4 @8 &`0`@< @8 >a`&`4@(I $`0@Ò &`<   &`8>"7~@(`0> [>""08 `a4  >@_`Ȁ 2'a4 ''> !>i"x' '"ݐ>`''"Ԗ 㿘 < 2`4>7E"@? ? -   =" @ <  8@  &`0  * * @ 2 &`0P> # ` q> `<2| > `<@"s `  '''#  > < $ . '䀢  ?@> H#@7_  ` '`'?'` '8` !'>@`  >8@`  2'>8@` 2'8 ''@'   "'耢`">i@'>i"Y 㿘l 㿘d 㿘\ 㿘> < . > *``  8@7  >> [#`4 6V"X> [>7ݐ"p #*`  `" @  2㿘> [#`?>62"2. >6-"@ 2"@> `.`!>k > ` .`!>k  2 &   >k#  2    2>6"@ #&@11& 㿘> #`+> H#@ %#?  `*    2 #? ҃@ @2  @ 2     @6C 㿘> H#?@> b @HƔ 㿘> [#4`N> a `(Ho o> #`> [ 8?8` **8H 0 01> [ #8?8`**#8> [ #8?8`**#8Ho o> #`> [ 8?8` **8H 0 > J`> O(2 > [#  㿘> # "   >0>0 >#>#@;`?5C# 㿘?80 @5 > c ?8 > [  > [ > [*c8"4>6#0> [>l#bƔ > a `h 㿘> [#4`>5#8H > [ #8@*@4*#8*H 0 > [ #8㿘> #` >`? > <a@    8@ 㿘 > <"!d   @5W0> \  > [ *`* @ *#c<@ @ > ""Ԥ  > <""(c< *  c< *   #  <`* (>`#h>#>#6) 0 (` >`&(6#㿘> #` V` >`? > <a@q    8@ 㿘>5#Ȓ  0@4%> <> <"a"㿘> #`2>`? > <a@H "   g 8@ >@:#P`?㿘> #` >#А  >@$cؠ 2>>4+#5#>@c  0 @4#> ]!> b a  a& @ 0 @4(> ]a> b    > > \`> <> < "a" > *  *`  *  > [#""cH㿘> #  >`? >@#`    8@  > " > @`?㿐!> #   ?* *   @4! ?   @40? ?> [> ["#D"P" `#  ?0 @4  ?` ` > [> <"c@""('> $"('$@ d@`>3o > :` @ d@"("(40㿘Ho o  > `p    "`p `p?"`p`?H 0 `> H#> [> ]H ! > b   > [H> 㜀g> \ `* `*  `*  `*  `*  `* 㿘> <!d`!!>  耢`d>4 H d> "`(В d$ @"@!> [> "`#< *ڐ #< *`Ӑ #< h*`%> "@@  >4x x d$@> "`#> `, `,$`,`,@ >4a  d$`,`,> " (@ߐ> <3  a`:  d@!>  :`@4:`"`#  >  > [cD> [#P* "+ "@#  >  ?`*`  "* " a`> [: ##"cLq# i 㿐Ho o> <!d` > [#<  'UQ 0> #> [#D@'? 'H 0ӳ 㿐> <!d`> >2W c  > [#P> [c@ ' #> [#D ""  "`0"# ? '> <!`[> [#L# @ > [#P* "# * ?"`  㿘:(;`; :9 8` / /`+* *`(@ ( `.  .` . .`D @E ` ` 43   F,  * + 2!m!n >. P?@`4 * (&@& (.`& ' . (( 㿘>  HTa@Đ @o @* @f &  E& &    >`?    ,R 4  6> *`R $ `& & 4& Ta@2@.& @*.@x <& @" <&@o * @ & @f*  @&  @]*  @ &  @S* @  &  @I* @  &  @>* @ & 㿘> [Y`?!cH  >2! ư!@ > <!d`@>    `@- `-Ԛ> "`H  H  >2u!8$ H`$>@& > H, " H>@!`>!>!Ta@ِ 2P>2M!x> <!d` > H -> [#<`)H@2>  H`!> [#H A  ' `,',',',',',',',' ' `,'*㿈@@㿈@H'@%> [ [<  *  *@`@ c< * H > [ [<  *  @`*@ c< * H 㿘!T!@=!@@6..`@.@/ <.`@ڒ <.` @֒ .`'> <2>>!m!lP`.`", "`",@   & ", "  .`.` 9 5  1 '    2mn 8  > <,@* (@* (* ("@㿘> <!d`0=H >  H H& & H 0 >  t   t   > <4> <\tt\ & "? & ?/a `&& t t "㿘> #` >  : %"@8@s /1> <!  ! %A `   , ᔐH   @  ݒ @`㿘> <! 6 - > <!` "!>@N* :  .@> `@  2a  #P @N* :  ٴ` ᠀  㿘> <!` #> < %>$a!!P  $a! 2$a %!㿘> <> <!`"!"R 㿘> #` >@!`?㿘  0@/" > ["cT> < >*0&!㿘> [#T `*"@㿘  >@q!Ȁ`?  `@h  > # `?㿘>t&`0`t`<> #` > a80 @.۔ &`4> a > <"b@>/ې!Ё㿘 H  8@ > a`& 8& 8> c  Ho o 8> <" ?c 4 2H 0 c Ho o> < 8" ֪@@H 0   > J`> (2  < 㿘`@`? &`0>a@  &`LX:   @2`H &`H`H  >? 0>;!x> #  0 >!>!> <"b@h`H>`"a0`@@S> \ `" `4`8`<@}a`4!>`h@"/[>/)" > [>> ]b(#/O> [JcX cX>"0/ >/"8``"`H@.`H >!xH/ /aD@?H 0㾐'pp:   &!> \ "` 㿘>b@>  .ې"H `"> `"P>"X.͐  $ > ,"h.ĕ: >b <0> D".: (>   > `"c .:` > >`"ؒc l :` >#>#  s   h. >b T> \#: .`>.#0㿘> D#8 8 <, @  ""`l0= . 08" >&"`"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> \ ^  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& 㿘@>cx@, & h& d>c @%& \>c@ & 㿘`? >c@@$`& >c@  >cȐ@ >cؔ $`@$` `  * & * "@>,# * $`l$`$`>$``@ ! &!㿘!  > cȔ @Q+ > [>#X-`㿘`  >`8@@& >`H@  2&  & > P& @/ > @(`` {> v@ & 4>`p @& , `>!>%> )>`   * `2 * `"& 0> +& 0 @u` 4& 8 8& $`@j & L  @e& D`  `   *@ `2 * `"& H> +x& H @E& P LVT P 0& < H 8  ,&  D@ 8  $& 5 >a@) & >a @#&  `> )>`   * `2 * `"& >#+4&  @a  &!8@u 3@ & d>aH @& \ ` >`   * `2 * `"& `>!`*& ` @ɒax& h dڐ h& T >,w!㿘@ Ā( Ƣ㿘@@㿘 ւ>!  @ & T&!>,I!  T &!> D`L&!H&!\ T   & 㿘 >`T  #@2 >,)!@, 㿘 &   Ң @|㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@Z&!X&ƀƠ㿘 H @>H` >c@#?`4 ` >c(@?> <  > #` ` >c8@?`4 ` >?cH@)> =< % ?"?c@?>> 8c(@ߔ?>> <c8@Ք?>?cH@ϐ)> > ="#@2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0# >#@q & @M@i & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!t㿘> > ` `2``?2`` 2` `@ 2`>`0*ΐ㿘> >b`  "b`Ho o> >" `  _"` H 0㿘> #`2    `> H@`?㿘> #` > [# 2">(ː X`2 > [ 0 @)C > ["#>*I h㿘> p > > >*7 >> *0> [c`>>@! *&@>(!p㿘>*!>>*!>>!*`>(|" 㿐>!8€` `>"8)2`> >b> >" " > > ?"#b#"㿘 + #`!>)А"> >b "b>"p)Œ> > + > >b ""bЂ$ Т@  㿐>!8€ ''|㿘 4 > \ 8. @  `@$ ` " 㿘``@ "$ > #`2  > H> #` > H >b@?V`  `?#  & 48@ 㿈`> \, 8`@d$ 2 a0`@"a0>'"`>)7#0`>#()0 `0> >`" ```P,>c@ '耤  >#H'2> \>#X'> \H> >''x,&&&& m& &Ҕ  > >@&"&> >b  &.G.J.H .K @] >{Җ 2   @ H /k * , @B H 0 \`\ \ > `| 2> ސ > "|> > >b @"V"> >c  @"Q  >`">>'#`c[Ho o> > @  @ H 0㿘`" >(w# >(q# 㿘> >     ,@ @ "L |   $ L |L آ@@   耤`> \`  > # "`  0 㿘> \`` + "``H /e * & > >b   . @ "`@` H 0 㿘@j @f   * 2 :@z 㿘`2  >&Z#.`@i 4 @b: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3> c "o c `" g  㿘*3> c "Z *c`R 㿘>  `" F  㿘> *@#`9 㿘 >  `" -  㿘 > *@#`  㿘> \ 0%>  @    > b!`@Y*@S㿘Ho o#> c    c   H 0㿘Ho o#> c  ֐  c. А H 0> \4> >?  @( `(  " " 㿘> \`0㿘> \`0Ȓ`> \DD D " " 㿐> "` Ho o b    bH 0% H/` /1> # b> Z `$ *b`P#`> Z `$*H 0 " 㿐`/Ho o> " `   0 T@H 0> "> >` c\`@j?>c € ?`>&7#-'>x @ " >`@ >> (&'> cH€ >  `H@H>@tc@ Ox'>7>5> > '>7>5> >`J@ 2`J@ :J` ` z$?@X € >%#L@x @ " >@ >> h%Β0ݤ H@>@,` > ]" & @>@ c@ ?Ox `J@ 2`J@ :?J` ` z$ ? @`L7>`H5> >JJ@@`>% `  `$ >% @   > \> >"`4  `-`%zޒ ,`>%q 0,  > \ H " > \"0@&c\c\ @㿘` 5 % ` % `. 5. % %ʒ 㿘   p ے 0``Ȑ 㿘̒ 0  0@n  S 0&  4 <& $ 8& ,& (              {   v  r n j f  b  }  X  T  P 㿘`03  8  a 8   @  `€   @ `F 8   @  `€ "  @ 㿘 0  N L " ? . L `@? \ * L * L * L㿘    8 `P $ ԝ㿘> #   "     2>>!h!`@@ "     ?  㿘`>$"!x 㿘@  @  " d@ @  @@ 㿈 2&`P80 @" &`P`p&`l &`p&`&`d`d&`h> ?`"d>@ `> t&`0 `0 @&`4`P 7&`&`&`   7 *` @ " 2 7+ `p &`p`P&``&`&`@   X@  X`   X> >#`" X>#! X&`|`p  @ @t >#!>`Wa>4 !# 8 7'> #`>>!h!`@ *>  " #c 04    >  <@ >@  >'>c` f>`ؒ`  a> >#'5>'4 7 ``' @  㿘$ pg   * @* }  & @ @ !> >` #@## @ Ѐ 2`a"@   #@Ґ # #  >!"  >%> "& >"ݐ"`   `? p   *@ & 㿘  > 0"  "?>""0?&`&`ܐ T&`,`" @  @ @> ?!P`0`&`&`Xr2&>@#!>"@> & ߐ"0&`@QT>bap  a㿘 D> ?< :  6) <* @ #  T  >#`& @> <"H ":H /d * %   ~!!8 2 $@*0  l >""@ƐH 00 0(& 0H /d * % XH 0㿘 $  d&!8&  h &  h"# h@ 㿘 ` $   & &  "`  "@`$  &  h&  h"@$ h&!8 ̐&`@& `$&! >  *!ݒ@ $ l㿘 p "   *@  *@  * p`  *@> >#`>!"㿘 p " T d  ߔ    T *` " ` + * ``*`*0  *` "` 2 ``*` Ȓ 0 Ē 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& d@l @y H 0㿘a " '> `Ѐ``$  ̐ ? ,  2 > bА?$ ?㿘 a ``?Ր  @  ? $?  *㿘> ?<  :` 6J <* @   p2 ` ` *` *  > >* c  2 ,  "  Ā " # ?  $ $ 䀢$ @E `  *@"     $  $     $ > ?<2 @  ( """ ( "( " "ࠝ㿘>>j!ܘ p f㿘>>j!ܘ p Z 㿘 l > P"0@㿈 $> # l  B`>``>% (>! (> 1"0> #  *00 >  >#\ >#` >#d #p#h0 #0 㿘 dH /d * % >H ! "& l l & l@<H p@㿘H o*@ e@' H p@㿘 "&  H /d * % @ H p@ 㿐   l> P l`k& >  d`2a & lʰ $````"`& h``"@$a80@2H l`>"4*` €& t$`<a$`T$``   & l* T`ܐ * @ " ` "`! ?$ ``$` p ` & l>  耢`ap`o:`w ` ?$` p " `0@2`@A$`@@=:  $`4  /   & (    `" 2  `@t(  ? h& l$` & l& `p`0B D<`p>   *`&  $`` `@+`̪`$a:` @8> H#  !: 8$`<- $`@]/%@ +`(`Ȓ@ >ǐ @P`H> >0@ & `&  /*#`>  >!>! `ܘ`#\  & l& $&  M _, `ߒ@ ` X   R   L   F >   x 怢 " `: q ŀ 25  `ߑ,@ `h ,  `b % ]  ` `W   Q   K   E    ?  & l s`0>   M*`U   p ` & l> ` @ 2<D `0 w  > > 2 > >` ( g@ @> >#`>$`> [ 8?8`* *8 *0> #`#> [ c8!?8  ,,c8Ȑ c8 ,,c804 <`0@ 7"  2> > 2 > > D 2> > | @2? t> >c  0@>!(>!8o >`Ԑ!H`     | 4 x# ?  & |>!p x& x x  & x & l t >`>!` a!; ?  >y"& t x??& x | ?> > ?  & |>!pb B& x`Ѐ``Ȑ `$``Ԕ"  $` $`̀$`@$@_ d  d>   2`@ & & l & O:`W    & l& & &    `   q& l>  * 0@ 8 d  p ` & l> ` @ '   > > >?  > >#`> @B d$`` " p >  㿈 da & x`耊   t   6 " p`   `耊   1& l/& l-& l ">`>!` aؘ!; ? ߚ  >  > > > #p#\#`#d#h0#0 ($0$4 t & t? 㿘> ?a<6   bA@ "@@"  `p@Jb@G 0z ">@Se e@ 0p !@"4V  `m@`q@ 0a )"=@, e g@W  !Q N L   @K " A> @Ka: 7 @ 3 2. n) @)% İ &&& & &&&& & $&$(&(,&,0&0 & $ 㿘> ?a<4`  `Đ t R  2t 7  &, 2:@ƒ t $D$,$0  ```> >c* $H$T$<>" 1H /d * % 3>#> 0"`*` * b   #H 0 # H /d * % ΐH 00(24&ݘ 㿘> ?6 a< !@T@Q""$ (>b($ 8Ĕ  $ 0$ , @$ 4 4 > b8@Ґ !,4 HĘ  $  4$ < 84 J$ X$ $   aW4 $ $, Q4 >aܖ@J1 >"H㿘> #   $ l   g 0   p  ? *@ސ   *@㿘 1>>"P@  " `p2```   *` ( > >( /> ?X=%/> I$%$/> ?d 4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +> c`-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +> c`+?P `-`0+-?P%/> ?X@̀㿘`> G"3> ?a @  !<: a>:"!@>!<5" 㿘> #`2 2 ` D 2   & D @`?P`   "> "0i>_^@b@ J!>&`0@">c@ = ?&`@ 2 4 H &`< L&`8*& D  >@Lb 2'4 ''>#@  @ &`< @  &`8>#;@ʐ@  1>%>#8@@  @ ' @  #8㿘 < 21`0`4=#  ?*@2`&a@Q&a<> #`"`0>#@>* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  <    `4  8@  @ ` @  #@  8@ `# `ޑ+ 㿘`$#>   b>`#h># @v  2 $& 4& $ 4㿘> ?!. @>#  4 #> `"  @  b  2 㿘> b@E a<: 2` ># ` 8`? h` >bԐ`8> ?,`* "* ` 0a& & &`4 > >&``?&`\ "# *` @ * `@>  `\  > `  > > "  c\`" `"c\" `\  > ` > > c\ "` c\" >   >  0  >@`8 >@`H 2>>v P>s XP>#>>b &̐&l&O&!> ?!  &`0Α* !&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 7 @ $# ' ''БH /k * ,  1 . 1H p@&@ȑH /k * , @ H 00` @ H /k * , } @b H 0㿘> ??`2  @ &>Y#*` 0㿘 4 0H /k * ,  `. @n . `@ @' >  > '0   \ 2  T 1 ` , 1, !+  T`  X > `@ 4H 0h?> ? !2`  6 !* @ 2 0 ` 4`p $ $  ` H /e * &  $`lP`"'@ "'H 0> T  '' `  @' ` @ ' `  'БH /k * , 1 ,1, H 0$`@ \`2 $` # %$`$`$`$`$`GŐMH /k * ,  @f x> ?$ pᘐ p$ l$ t  `, @H 0H 0 `h> ' x*` € 2`p 㿘?2 > ? . @ 0 p > ' h x*`  €>; p` Ӑ 㿘?2  > ?a. > '`0x h*` 㿘?2  > ?a. > '`0x h *` 㿘?2  > ?a. > '`0`x h`* @`4@ mA e H /k * ,  ]@ "4```y@9`x@7A `z@`{@8  `\@ "  j@), `m@'`k@*% ǒ 0Ò 0&!:0 $``@v 0 @s 0 @0@& H 0㿘 l? 2`> ?  ἑ*  4H /e4 p* & pA =V  H 4 P & p H(Ԑ  H , P HSK H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!*  `    $ $ H 0l?0> ?a(H4p(p " " p"pH 㿘 l? 2`> ?  ἑ* `( 4``$`@" `  `   \  @,@   " T 2o H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> ? $ d $ h   , , ,L    `, @> ?!a$ d$ h@b H 0@@  , @  4 `G `H*`F " `F `I*`F `F `? "߆ *`?㿘 4 J`` 5 * *5@     & & "@R 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@!  4 5 `` `  D`2 @` 2 㿘 l? > ?2` ἐ * 4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %^ 㿘 `p`|`t = | p i 0,,  :`xT ?$`p$`t `  ,`. L `  `d ``,`   ``,` 1   . 1. !㿘 @  c& @ $ $    ?    $ $  1  . 1. !  ,  , . L㿘  `\   `> &"```2 F D F@ . D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0 >  > > ؀`2>> А #\͐ 㿘> ?  l> '`h x t*` "  4 |   T X `& T` & X>  *"@  8*``p  ,@@ * $@ ? ` p  @ @ P X `& P` & X>  *"@  8*`@@?2`  ,@@ * $@    .  @: x2 `6& lH /k * ,  t& & t t h     `. `1  -`1-`!   `. H 0㿘`p `&`p &`p `H`PP2" > '`h x *` €㿘 4H /k4 E* , E D, EH 0  G > '`h x*`  €  H  . > '`h x *` €0. 㿘  0H /e * &  .  .  . H 0㿘㿘>@Q`Ѐ   ` @@  " 㿈` >a`4>``L`h&h&h&h&`> ?,`* "* ` 0b@& & &`0 > >&`t?&`p "# *` @ * @` >  `p "!> ?  > > >#\>"b! ""#\ " !> ?"  * "&``*&` &`&`&`&`x&`| P 2`p & X`p $ @ T#@ 1`. 1 ! H /k * , @ H 0 > > ` @ H /k * , 鿒 @ H 0> #`&h> \b>@f`  >@a 2h̐ &hh̀`  '>!> ?a'h>!(hȀ`>h!@> ?!'> ?b(>'!P'􀤠> ?"4@> &h㿘 0$ >!X0 c >!x0H /k * , @q `4 `3 ` `5`@ ``,`3,`5 ,`4(   & & $`@닐(& x & |(  .(.(,`L(   ( `.(@z@ H 0( .(@@Ho o ?&(&(@ #a#? @ ` @M(  7#?J#? @ ` @6(  "!(Ȁ 2&(̐@[ #,#? @ ` @(̀? ?>2!H 0㿘(  ` &((.(`   `0  `.(  .( `(     .(>! 0&(ȁ㿘Ho o 0 @  *@H 0㿘H /k4 * , ( ? & @ (*((`@&((&(&@ H 0 @ 㿘 0H /e * & ( 3 /H /k * ,  .( 1 2   , 1, !  4   (  & & (& H 0H 0 0 `G `H*`F (" `F `I*`F `F `? "߆ *`?㿘 0 J`` 5 * *5@  (   & & "@ 㿘 0 K(  58 %  @ % @ *5*% %璒 㿘 ``` q 簐 p 睒 0,,  :`爐 ?$`$` h  ,h. L h  `x h`,h   h`,h 1   . 1M. !㿘 @  闐& @ $ $   s   (  $ $ ($  1  . 1. !#  ( ,( ,(. L㿘 )2 `2 F D F@ . D E  `@ . E$`$` ,h. L㿐H /k4 d* , d& l h& d& hH 0 > !>">"`2>>""#\  㿘 > ?  0"@  h l `& h` & l>  *"@  4S*`5  `p  ` `@ d l `& d` & l>  *"@  49*``@@`       (@ : 2 6& H /k * ,  % &   | (  ( `.( 1  - 1X- !( ( `.(H 0 0H( `E `D*`EH  `H  *(0*(㿘 H /e * & ( .(D( .(ǐ( .(H 0 㿐`* &(` `2``2` // (㿘# @ #@"(!? # @  #@?     ɐ  ܐ&   @㿐>   /@ג#袒 $ H /k4(А* ,(Ѐ  (Ԁ h L`2 (@H 00   &(&(В!  LH 0㿐H /k * ,  /&(Ԑ &(БH 0`> \DD DH 0 H  "@"  "@"㿐(Ȁ /   (Ā   (Ā  / H /k * ,  H p@㿀 ?> "  ` @&`$ &` O'%>#>`$䀢 `48 " 028  3?@/@,?2( `4 '`4 '\'''"a " `$ "0`$0"`4&`$`$"4"<`( &`(  '㿘" > {"8 / $ +#>!> 82 0` <2 0``  0 Vbhא " 0"  M  ۀ㿘" > ?" ) $ % 0" 0 8@2" 0 <2 0`" 4 4"`4 4 0"@  ߀㿘`"  > : *` @ "Е2   > " 㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D㿘 L  `2  8  4 $ $@$ 0 ` (*`> #`> * @@   $  8 8 L 8  8 $㿘 P ` L? T"`8  $: 8  L 8 $  8`  L  4 8 $ 2/ # !$ L'  P`>  `& P>x: P  @?`2?` d& P>aHŔ>  2`@ Ó:`?㿘 ( !H /f * '  P  ? L& P`4 $ 8 D  LH p@㿘 L 8`- 2* 4 8  $ L`4  $ 8 2  ` 2 \ & ` \ `   & \@ & \[ ?? ?㿘 P !!< L  8 $  8% `c#``c   L 4 8 $ @   P $ L 8  8 $㿘 P  ?& Pe d㿘 H@㿘 L | 0@2  <  ,@2 <`  <@ $@ 0& | ,& 㿘 L  ,` `   0 0 ?" H, ?  H@`$ H `H /f * ' H 0㿘 P   L @*``" /n  T( @*``# /d  T)  @* `#  /W  T' @*``& /L  T%  @* `&  /?  T#  @*``( /4  X<@4@   @*`& ``+ /%  X  @*  `+ & ` /  X   @*`& ``0 /   X  @*  `0 & ` .  T  @*``  . 㿘 @/ L`  -㿘 P r d   (""4# # & 0&  0 ! A ! :` ( c  㿘 >>c # (>&`@>`Ԑ"&`8&`D&`H&`L  &`P@ &```L  4`8`$? b &`T 㿘`( `u "`"6`0e^0```@2  [ 0_`@2   `L 4 `8`$`L$`8 `8`$0L` 8`B `L 4`8`$`L%b`8 `$`8T02`@2 4 1` 8`, `L 4`8`$`L`4 `$`82 `\``  $`\@$`\^ ? 0 7 =A 㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘} L  4 8 $ L`4  8 $?b  L: 8 8  $tu,u,u,tu,u,u,u,u,u,u,u u,u,u,tu,u,u,u :` (Q c  㿘 >>cД |# (>&`@>bh#&`8&`H&`D&`L @&`P`L  4`8`$? b &`T㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 8`0 @2   ? 0    㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`>!0 €`0 `0 `0 `0 @ $`0`0 `0 $`0㿘Z L  8  8 $~d~lLL~~~l8 ||LX||dXp<h㿐>    "> \> dc#\    㿘H /d * %  `%>  `6   x  ` @?> \ dВ `  ?6 $ H 0 @>. H 0㿘> &"䀢` >` @ > \ dQ   ` 4 ?# @4 0  `@ p@ b  %h/#\#d#`  @<   . * *`  @k>ڐ 0 㿀@ɒ  ##\#d/#`   @ x@ a" @ //#\#d#`   @ 㿀@  #  ://#\#d#`  :@ 㿀@ c /#\/#d#`   @Ϛ 㿀   @k  /`//!0 ##\#d#`   @ 㿘> &"䀢` >`H@    @א& 0? Q09@ڒ 2 0@ "    ' 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@  w^㿘 & , $ ?& & (. X ` "A   >0<+>09   (>X XH /d* %  #> `   ` H 0 0 ?@Y ?" & ,( 㿘`d2> ؐ> `Y s$` \$`$`$` $`$$`$`$`0$`T  , `  * @*` }? H /d * % LH 0㿘 ,`<*`>!x €; @<?27 , 2  & ,  ?   $"@  ! > >"ܔ  d  ??&  & , ?& ?  ? @ >#! 㿘 ``4@?  p q}@ >!8 `  ` i>!*` €($@"V$(U``?# @4` @%    $,c? ` ` ` "@W?U 05!N ` K +  )2` A?``?# @4` Ӓ` π` 0 0    ?  ` @0 0@ > `!X `   > *`* @ @ z!p>w! 㿘 >`!`>!   d 㿘  >  4Y!!>Ơ!ؒ @QL`` >K!L`` >Ɛ"C  , ` @>ƒ;" , ` ">>Ɛ"(2>/!` ` * *`  *  > "PL` m` ` * *`  *  >Ɛ"h  @]  >Ɛ"L``>Ɛ" `@M  >Ɛ"`B    L@     L@ "  ->Ɛ"ْ >Ɛ#Ӓ  #Β ? '> `)>%>2 @ # @(?`   `ᐁ㿘` ```  ` `> ?"*`1>   @,06`>   >⼙(` `  @ 2 @ 2`  @  >>Ɛax  >Ɛa  @  2`> ?"*` !> ޢ >ƒc0   >⼙(` `  @ 2 @ 2`   @Ζ >>@Œ T R  N  J`F>!ԓ*` € > >Ƅ#8` @ >#X>Ɣ#`  * 4 ) >Ƅ#p` @ >#X>Ɣ#`  *   1> * >Ɣ c 1> * >Ɣc 㿘  A!@|Ē!H /d * % > \aHaH &" "aH& H 0 㿘H /d * % ` "` "H ’ H4> \(> \H  @2H㿘> &"䀢`>ƒc@  0` >e#0=Ґ 2! >Z#02 , [ X, Z ,`!*`> l € ( $" $ $, [ , Y X 4 ( , [ɐ >    , [  , [ >ǐ 0, , [s|㿈  > `Z ` <  a > xM 2 G  ( ` > = 2(  H #d `#\#`5 "H /d * %  0" #>ǒ `   0b H 00 0& 4(& 0H /d * % sH 0㿈  !"Z a avau ! "g  ![v0!pN `& `   &&>&&&&>` `&& #@` *Z &L&4&8&P&D,<  `0<?# @6  6   6   @6 "'   6 @+@& 'В"#\#d#`    d  @㿘! @0!@ "@ !@ 3 09!@", !@.  ! ! @0!@!  """ 2 """ "    ` @LXdp|ܝ㿘`>   㿘>  T`2`> ?"#0`.&`0 2`0 6`06`: $`2`: *$`:>s `: * ݔ  &`4>ِ!`: !>ǒ  ͐ `4."@ `4 Ő!8@zG `: ' `?@g?㿘뫒㿘돒㿘 : 6 4 4, @ " :V  : & 4 4N 㿘` @2 `  "@@"@ `㿘?> ?c   c.  @  c @㿘  > ?  6@ . @ 2 08    ?`&- @6)   $ ?  @4  @` @ 8: 2@@ 9 @ " "  " "` @ " " """    􀠠"A @  \    @"*   @2 @  *   *  \_ \* @ 00* @ 800* @ 0*  @Ò`*`>"      ` `@2  `  >> > >> ">">d">ʪ"b`3 `.> ,` €>(#>%#>"#># >#0>#8>#@>#H>#P> #X> #h>#>/#>ʲ#А !   p   >ʐ c#\#`#d>#>ː #h #l 㿈 4.`@.` (   >  0$@ $`!> ?$` > ?$` b$`$`$`$` `$` $ #0$`$$`4`4`4`a,`,`@xP :#0 Ɛ * $*  > ސ! * $*   2   >˒` @w >ː `@w 2 >˒` @w >ː ` @w > ? yc4@      ?`# @4`  ?`# @4`  ?`# @4`쀢 ` 4` ` ` 2  4` ``,@ 8 *@6 8   8,`,`` 4`  @<  `  `02`0 `      $'>#`' . 4.`" c0ǒa>Ֆt0 { > ( 㿘 2 '5 @ 2-`2)@}`` @}V 2` @} `  @}K 2`@}@` @}@  @@'ϲ@x@w> 6 U ///#\#d/.`.@#` x\@w! 6 Z(///#\#d/#`h xÔĄĄ (@Th|ɐ㿐> Bb̔  x㿘> B&`` "$``$` 4` > B"`0`&`&`X齐@*`"  `2`` &``"">>! &aT>ΐ  㿘H /d * %   $'> Z)> ` $ $ $0"4h"0n $2$H 0  ܀*`> Z>"a@ܐ  ܠ `! > Z>"c@!  ! `, 㿘鍐 0㿘? 2  @> B"4  0     ` 9s 30mr!   Ĕ! _\0.``4` ! 2F `  4`@9 4   @   `+ ,@ `$ "      *@$  *@$    @ $ 硐0`?# @4`   Q!`?# @4`靐狐㿘?2  > B "_6   0> ~ r05"      **@$  **@$    $  Ē !@ #?c 2 `!     Ēb 2P> 㿘 D'? @2  `@> B"2` 2`Đ =& 4 `2` 6& 4 <(@}  -& 4 ". < D   ` `@ @*D $ &"䀢` >˒`@  + `?# @5 0 `$ ~ $"`$ `2   0 ( <$ 0$ 4$ @lGj ( T@|4  D ` " <*  @  <?@| "?,@ @tÒ  0  4`4`///// @t  0 * (4`4`4`4///////  0 H <!0#`#\ 0 0( #d   >ː   2x 㿘  0` `@ 0`<Ւ"@ 㿘 D? @2  `@> B"2`  "  ( <*`" 4& <`㿘>>!! M㿘>>!! A 㿘? .!!@{.@!@||@{ے K.@|u K. *  ( ` (("  ?jX? @2  `@ `> B"堓2`    ` Z ! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2    @"2Qc@/)c@"!Tc @"!T!@] `q c @c@ `h c@"E c@Cc@ `Z c@% c@ 9c@c@ `G c@ `p@`s@q `8  #@"!T2 #@ "!T# e e@ "e  r @ ` @Y #@ ` @ "!T# @j `  `m@T`q@ܐ `  e`g@`f@D  h@"8  #@q `퀢  !@ `怢 0#@"p 0#@0#@ `Հ 0 @2@Ȑ `ˀ   @Ә 0 |!0Ȓ `& *`` & 0 憐  $   @'O   $ 0` € @` € #\@!T` € @} ,@@< oˑ*   8zc   @H Y  d ?# @ `*`2 @7|4 0F#$ ǔ #} 9 @  '```"  !?#?*`@  &@  `$@   * 2` 2`*`  d ?@# @ `*`2 @6@@?8z >    l#$   @˚ @ , `$`?# ` * 2` 2  d ?@# @ `*`2 @6@@  ` 8`& 0!T@ !T    @     !T@     !T@     u@     k!T@     `@ \@ W  R   L  GV "A !=2  8  3 @  + 0(2?#ϒ @"2@ې!T`@J@t    oŐ㿐@q!@q"`Ƞ d &(&0&,`@x d &4&8`Ĥ  ?b  >˒`@p  >˒`Ȑ@p~  6>˔ `@pw` !W  &&!,&<6H6J&X&&<6 &6&.@p    @ "@``{`,    #  @ k`Ĩ  d   *   *` *   * *`  *    @>  `   d    *   *` *   * *`  *   2+` +`""#` "  ` 00  `@$`Ā ,  @p;  * 6h ? 2  @?`6 # @ `* * >a@$/p(" & & h2; ̠ @p  h %/#\#d#`  N  2% * *` *  aa(& * *` *    c8& "&  ́x @oɐ Ô@6`6`6` E6////#\///#`#d     h@& 4$ А@ " 4Ҳ@ &.`.   #\  @  x\ @o}   G/#\//////#`#d    x @ob Ē K'/#\/#`#d   ﬚ 㿈 Ē'Д"#\#d#`     x@o>  B`/ / 7` @( //#\#d///#` { x@o  C`/ / c7 (/#\#d///#` [ 㿘   ښ 2``#  +    ˚  㿘Β   ? `@nҒ В @n΢@` >#|*` € a0  (//#\#d/#`      װ 2 .`` ē*``0  (///#\#d#`    ʰ `I ` ē*``0  (///#\#d#`  Қ   `-``* ě2`!0 2`2` ////#\(///#d#`     Ԓ`2 2  2  .` .` .`Ք x' 0{` ē*``0  (///#\#d#`    d װ _.`` *    ///ђ/`w  a0#\#d#`  e  A $ ` *    ///ђ/`w۔  a0#\#d#`  E   .@  .@ ` ĕ*?0 //#\#`#d  )      @mĒ  T@m@ Ēa0`  T(///#\#d//#`  T  M` @m ??(*? ?(*` +`?*   ?@?+ *? `?*? @ ? ?3    ` 3@2 2`  23   ` ` .@.`.`.`.`.`.`.`.`&` &`&`.`  ` p@mU  @mQ `a0@  (///#\#d//#`  퓚   .`.`p@m, (@m(` ē*`0@ ( (////#\/#d#` (h  `v( 㾸@m ( @l @a0  (///#\#d/#`  A  ()*  `&``v,  p@lђ (@l͐ a0@  ((//#\#d//#`   *  &``v  㿘@` >#*` €Ӓ=a  㿀 >ː! @lq @ln B b  (/#\#d//#` 쵚 㿀>ː!@Y  @lK.@ b  //#\#d/#` 쏚 P     ``/ɔ P    ////ʖ P    Ű .@.`.`.`P  n  ` `/`@/////˒  p b #\      //// | p b #\ ؖ     .@.`.`.`P b #\  q  " N #\ g  ɒ@` `/` / ͔  Ę //2  x @kj Ô@ /#\//#`#d   벚 㿐> Bc4  ј㿘> B&`0cH >"2 !J"@x?> B 2 `  u  * @ 2 00m` j  2` 0T 2] 0 H  @ "@ `> ?#0@] >ː! F 0@     @"4/ 8 L>ˆ!؀ >!>˖" T >>!" H#\ H`2>>!"#` P#d P`2>>!"#hϒ 8 $ 4? c 2 ? 0> B * @?0` 2`㿘? 2`> B  * c  # #  ^  #"Q#"?8#"+8H0 #"(HA0 # #40 #"-0@0 ,@~ (@ $4"  "?@$8   44" "H"L"P" T "@.x@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @i@  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   4 x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @i  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d   Ú x@ * 0  H `  '  :` @iQ  4, `4  +24 ////쀋 / / 0ab#\#`#d   錚 㿘H.`  S   $8 @I$ ;` ` ` *  ut D   @0 "` ` `*  >ː"  j` -@ `@q` `  x @hϐ 0a6`67  7 (////#\///#d/#`   h@h ؒ @h#p 0` h//  //#\#`#d    >D"Pߧ, ,,`,  @  +((+`   @ % T% 8% H% <% L% @% P% D@hc  @h`  0`////#\#d#`  觚  >ː"R 0 X@hD  \@h@  ,@ , $  0 ` 2`㿐> BcX& d   `& d㿐> Bc  㿐> B&`c `0 .aT$`$``> B&`X`&`ڐ@͒`" > >̐ &at ` 2`` 4``" > `2>` &`>˨"``   > ?#0 Y aU`@ a^`@ ao` @    at> ?c0`Ƞ`>˴ 쵐" ">  >0>0 !>ˠ"@oO@oK#\엚0 씐#(0>쐐#80#P싐"> &>"0` Ֆ &ax>ː#x} 㿘H /d * %   $)> Z+> ` $ $ $0"4h"0^ $2$H 0  #܀*`> Z>#|a#ܐ`rQ #ܠ a 6!x> Z>#|ca`r: a ,!x`> &"0 㿘5 0㿘? 2  @> B#؞4  0  ڼ {  ` 5o  ! j` 2 ` n! _``4` N! 2J `  4`!t@  Ȁ 2 3  @  `+ ,@ `$ "      *@$  *@$    @ _$ M0`?# @4`   !`?# @4`I7㿘?2  > B # 6   0H * "A"      **@$  **@$    $$  "  !t €  Ē 崔!@ #?c 2 `!   弔  Ēb 2 㿘 D'? @2  `@> B#׳2` 2` B& 4 <(@na  9& 4`    /& 4 ,& 4". < D   ` `@ @ $ &"䀢` >˒c@@  `?# @5 ˶0 `$  $"`$ `2   0 ( <$ 0$ 4$ @\w ( T@m94  D ` " <*  @  <?@m* "# @?,@ @e^  0@  4`4`///// @eL  0@ * (44`4`4`/////// ~ 0 0  0  &  H: <"`#\#` 0 ( #dv   ~ >ː#  2k 㿘  ` @ ?"` 0 `0 @ <c"@ 㿘 D? @2  `@> B#֌2`  "    ( <*`" 4& < `֕㿘>>#(#Ě 㿘>>#(#Ě ͖ 㽘? @2  `@ `> B#P2`    ` .  !@"! !@"8  p !   q@ " m@  0!@2      `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0  @ 0{@z 0tn!0p `& *`` h&T 0 a $   @ 2  e g@2 ? @2  `@?`4`# @ `* * > c(@   $ 05"4    -$ ?*$  @ a " "  !22 @   *Հ㿘@c!@c"`&(`&0`&,`p&4 &8 d&8 6aT` >>˒cА@c? aUc@c9 aU@iΐa^@iʐ   >˒cĐ`ؒ@c" `ؐ.( 6H2` 6J& &<&&Xo&&  aW6&&.՟? 2`  ?6  +  *6 >c(@p㿘  !t € x@cB  @c> 6`6`6`  //////#\#d/#`  ~ 㿘  4`?  ` 4 ? ( ;?  7 3  >˒  #o#@%?$  ` ` >>̐     H  q  >̐ ` ? 㿘?2  @> B#i4   /? `*@2 `Đ  2?` `, ` `"(? o 2`   ) 2?W㿈)> !Ԁ ?> B2  #@2`  ` $#a#. @   (@jϒ R @j*.` @`,    @ > ? = !T`7@ @bZ 6` *6`6`4`///////@bK  @&  #  &&& &&n&(& &,n&0&$ @€  %!԰  _(*``  @*@ @b  Ģb  # /#d//#\#` S  M  `  " `  > `> `;   6 *` `*  * `+ *  @ 3`  @ .&` &`&`&`&`&@ Ę#\  &ꗚ   ѓ*`@ * ̐ &@&`&`&`㿀@a , @a cp   //#\/#d#`  , P"&`    @a cp  ? ///#\#d#`  ,ƚ   ʑ* ˓*`  &` &`  @ &@&`@i (&`&` h.&`!T`Ȑа  8 ː ``&@ ` *  *`   &`ґ* ӓ*`  &` &` @ " ` " ` 2 Đ"&`  `&`@mp @h&` \ , ː `&@ ` ` *   &`ґ* ӓ*`  ` `*  &` ``&`mE@mC D&`` c "`&`  * 5 ˔ @  &@&`` `  *  *`  *  2 &` &`ґ* ӓ*`  ` `*  &` ` " ` 2  ` ( "%&`   `@2 Ā` >>̐ 嗒 >̐ 咒 >叐! ߍ @ 4 "&`&@&`&`&`  x @  "`!@`h aba 5/#\#d#`   ౚ  >̐!(\ 0  @& ```` H d `        ,  X l  㿐> D`ؔ  裘㿘> D&`L Ȓ $ $ 4 @L>#h`X>̖``#p>#x>̔#   5> ?01`  >0@` "`d>#a>#```>>#`0#`0>̀`#>#>̒#ݐ a&a&a&a ?# @4 㿐> C L`( B  & X& h& 4@& @㿘 X  l  @_ @ ,@ h@`" $ @ ,@   , @ ,@   㿘? 2  @> D  2 H  *@ 2 L0@2` ` >̐#v 5   ޙ $` 4`%  D`2 0 @Ӕ  0(`@S$ D`   0  $ 0 @ `?# @4`㿘?2  > D`6 *  0 a`  @   " L     L @  L  `2  L @  L @  L? c 2  㿘?2  > D`6 * 6  0 h Lf ,``@$ 0*  l@ h $ 4 @ T  4`"@ I"@X @@ ; @  *  t, < d, < 0 ?$ 0   @J  0*  p@$ 8$ 0@ >͒ !@ 0 h$ 0 4 ㊒ 㿐 0( L @u @ @ @ !@` @ @ 0? 7& 0  @ 4 L" P0`"0"" <T2 <0"82>(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 㿘 D? 2`  > D2 *  < @@ 0 " P 8@c%  8>͒  (   T  >͒ ܐ X & 4H /d * % & $ `( $& (`("@#"`(H 00 0(& 0 <& @H /d * % TH 0㿀> &"䀢` L>͒`@' ` ?## `  4`Ù0!  $` ("`(&! (" 0h"`` `` @4` 0$ 4 <$ 0T$ @n` 4`"" 0 0@  @ " 0 0 <h$ 0$ @T$ 4T`  0$ 4 < 7$ 0$ @ 0   0$ 4 <($ 0$ @ 0 T& 0:` @](  0@  0 > /& 0% /( 0   / 8@[ <2  <2 2 /// H <# #\#d#` R >͐  ` 2j`㿘? 2`  > D഑2 * @L>`# 㿘? 2`  > D഑2 * @L>`# ̖ 㿐? 2  > D`2* a2 8  <@   a@a@ 0 !@7  @Y @\ 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0`" 0 6 0(" H 6 H6 J64 J4 HV`o>"̓*` €@)   @O &@  @   @?   @   0 @K  @E ~ @ v Д  0*@:$ 0 0 5$ 0@U c`2 P 0 ?`@  T  @ T  T@$ 0N  0 $ 0 0$ 8 $ 0`EC  , <  =  Lܖ6@ޒ >͐ ڒ , <$ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@    <* * t  * 㿀2 @[  0 `/ 8 `/@Z: 22///66/// Lc #\#d#` ǚ x`L  % @[` a0h /#\#d#`  ۩   * *` *  $`T$`P0 @ L @[6 a0 h/#\#d/#` ~  &*`** *@  @  & \& `. d 0  0 ?& 0 @ d  40 @ 4 ` L"7 @Z  /@Z/   03 <//// 0 "  @ 82 2 /// @ d!0#\#d#`  㿀@Z  `/ 6/b /c  L #\#d#`   㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @ZI L66`6` ///#\//#d#`   ڍ  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @Z L6`6` ///#\/#d#`   ] 㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @YƐ L6 /#\/#d#`    x   0 =& 0@Y  L /`/!06"#\#d#`    㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 8eА& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4>͐ J  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 >͔"  1  `   `>͐  $ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ M  6  '$$`8(`82`0`0    ?$`0     ْ 0 2`8Ғ   㿐> DcT  㿘> D&`4cD "2 ">͐ c@^j  2@ d>͐ c@^]  2@_ d@ d$  `&`&`<.`N.`O.`L&`86`@6`B&`D&`H.`M&`&`㿐> Da  @ʘ >ΐ`&  $ 2&  > `#. ^@? 0  ; !> D @X- , . ^& ԁ㿘?2  > D0 6  6& 0*@`2`4    >ΐ `  !!7 ? # @4    4 㿘?2  > Dc06 *   쀢`" 0@   0$ P ?$ 0 4? c 2  㿘 D? 2`  > D02 * @ 4` 䀢€㿀? 2`  > D2 0* @`0 #>`܀`@ "`00  @W  //`4c#\#`#d    `0 $`0>>ǔ! l 㿘 D? 2`  > D02 * @ < P 8& < < "& @H /d * % & $ ``( $& (`( "@"`(H 00H /d * % NH 0x 4` C?a#b`  4`?06 3 $` ("`(&  (" 耢€` @W  (/ <(2`2`/// H <#d#`#\ T >ΐ 8 ` 2`㿘? 2`  > D02 * @# : #( 5  # # *  ` 8@ ( 8` (0# ؀€ @0 쀢` -@  0 ? $ 0  -   4ۜ0 4@V  $ 0///@V/ ` `2`// (// 2 2 2 2 2 Գ2`55`22222`2`////////////////////`   "` / `   8 ` " ` / ` @  " `/ i4/ g // %/ " / /  a  ' `"  ` * * @* @ ' $" 2`// 0  (c#\#d#` 1 㿈 2 4`*2##\#d#`  3 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  6 h 4@U a" 4 (//#\#d/#` ؘ ޚ >ΐ 8ډ * *` `<  &`<㿘>Β . ^t H`>ΐ `P@[S 2` >. ^f ``>ΐ `@[E > E >. ^X > Ell& & &  & & & & @& 㿘 0 " ` @N "`  @]}`$&`  @]w@$@&` @]q`$&@@]k $@ [&` #؀@U`S!@8Y `!,  @]Q* 2 $` 6`!,  @]F* 2 $`* 2 "U06` *`2 26 ` @Z?$? H!.`` @Z?$? .`` @]$? P .``   i4  g6 ^   ^.`& 8^ (@u 㿘 \a  X`<2 @\$&`<P 4@bؐ@T   //ܐ@T  D @\C/Ȣ H@\?  8@\; @ <@\7 c4`4 42 ///#\#d//В///#`    2 @Tb  / /@TY/ @ a,/ @\ /@Y d / M @RԐ? N/@Rϒ / O @[/㈐? p//#\#d/#`  ԃ  2B@T$  @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   K  2  <@X   㿀 P  4@Sݒ # /#\/#`#d   &   㿀 4@S’  \  X` /`<2 @[n`H #44(//#\#d/#`   >ΐ ة 0 T"& T`< P" & P x 4@S   #//)>'>ΐ(#d#\#`  Ԛ  2;耢 ` >   !\ ($* *` * T@  >ΐ!_ P !>Π!8_N 0 `  㿘 L "  i   6 \4 @ g 6 \ @_ 8@Zܒ$ \ & X` ?` ?& X B_| <@Z̒$ \& T_u X2 _r& P㿘>Β . ^!h`>ΐ ap@X  2` >. ^!x`>ΐ a@X  2` >. ^!`>ΐ a@XҔ  2` >. ^!`>ΐ a@XĔ  2` >. ^א!`>ΐ a@X  2` >. ^ɐ!`>ΐ a@X  2` >. ^׻!`>ΐ b@X  2` >. ^׭"`>ΐ b @X  2` >. ^ן"(`>ΐ b@@X~  2` >. ^ב"H`>ΐ b`@Xp  2` >. ^׃"h`>ΐ b@Xb  2` >. ^u"`>ΐ b@XT  > E >. ^g"> E  &  &   &  &  &  &  &  @& >M"0 @  >>C"0@"㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 8[ (@ > "@d > #ք 㿀@ >"@M ">>##0#0`7'@X@4 > #8Z`㿀 4@Q `<a`H22b /(//#\ /#d#`   >ΐ#X֫ 0`< P" & P 㿀 @Q 4 a66 ///#\#d/#` ٚ 㿀 @Qz 4a66 ///#\#d/#` Ѿ  8x>Βch2֓ <>Βcp2֌ D>Βcx2օ H>Βc2~ @>Βcx> Bcr L`&``"   \4`"J } \6 \>  `, `,  `,  `,  `, @WL, >Πc X c6 \>Β# ` #, `,  `,  `,  `, @W5, >Πc A c 6 \>  `, `,  `,  `,  `, @W, >Πc ) c6 \>  `, `,  `,  `,  `, @W, >Πc  c, ,  ,  ,  , , @V>Πc  c, ,  ,  ,  , , @V \>Βc M>Βcؔې N>ΒcԐx$ h`8`<` `L   ?$`8$`< 0 >ϖ@ @>ϖP P/?@VՖ > EO`Ƞ   E> EOJ@  d2`J@   I ?А  >J+  @ *`В@  `L $`X+ $`X```` ?@Va/ > E `  > E`Ԯ`03OJ@  d2`J@   2 > E` ԗ`0?А  J,  @*`В@ `\$`T`X\M 2 \J$`P 㿘> E&`0` >"2  x">ϐ ے`㿘?> EБ2 `   Б* @`2`00  2>ϐ 2  Ի` ? 0> E А* @?0` 2`㿘? @2  `> EЕ* 0㿘`"!@> Ԍ !@>Ԉ Ё 㿘``@S  >@S "   > H# `X&`48c@ P "8, 2  80 @I &  >&`D @S` 2#> >@}`>@S` >ϐ@Sa 2 `D`D* "`D "\ " > c   @ " >a@a??&`T&`T`T &`T>!`D<@ @ &`L `>@">!>$@>(@">>! >!(>>!0>!8 >!@>`Lސ!H>ې!X` > E@ 􀢀>>>ѐ b>Ґ `c&`l&`x>>>>ѐ x`&`p&`t&`|&`c I&`P 28`0u8 >@S`  >8@S ` 8@S 2'8 ''@`P %>ϴ#>ϒ`@Ɛ@ה   'aw @א `0>@Rے`  >`@;!h &`<"# 㿘 D@$!@耊d! ?[9  Dd ?   > D@!p>ϒaG!P>D! D@ < "@ D Ȓ`"[ D @ ?"@ D " L@  `  D " L@(@2)& H D* " T   D " D D@0 "& H D " T`  D@ 7@("@& H㿘 㿘``@RN 2 ޒ@ 㿘t  D  D 㿘 D@#> $ %> @耊d! ?Z  Dd ?   > D@!p>ϒaҬ!>! D |` "& d& hb  >π!@@ җ  d?@@*" 8 & `'b > `҄" 2 d ``  d @& \ & X>"  D"  L d D"` L@2 D> H d ` @  *  D"  D" >! "@  D  " H㿘`D`<> "` >>"H"h`4>`D>ϒ }"`D"` ##h ?`H 2`D>Ѝ"@$"!`L@耊d! ?Y `Dd ?   >`D@!p>ϒa">k!`L @`2`D`D@ @@ "@`D`  耊` ! ?Y `D`  ?   `D>>ϐ!paʔ">:" ="```($`Hb "%>  € @€  * @  € @€  ќ   @€  b >ϐ#ш 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,b  > @#0 € @€   @ @€   5>`d!H> #`2 `h`X "`h`\@```h ""`d@"@㿘 D >ϒ }" D>h` " "  l@ 㿘`"!@> #x!@># 㿘``@PP 2 @ P "8, 2  80 @Ɣ &  &`H8&`L @ " >c@ ??&`D&`D`D>`L c&`D д: &`@ 28`0n8  ''@ %>#>Ғ@ѐ@   'c @ 㿘`"!@> {#!@>w#؁ 㿘``@O 2 f@ P 0 @T &`<D&`H4&`\4 2&`L&`@@l @ " >c@?&`P>@#0X >9 0Q>`0@x??&`D&`D`D>`H `@&`D`P: > `>Ж h &`@ 28`0Ւ8 "' '>  p@@V #>!>Ӓ`x@4@E  @Y '! @E `x㿘>Т  @@  M  & X>А  Ԕ05 @R|& T X @@і T (`< * *    X`8  @2 `   " `8 X@ ` "   T&`<㿘 0"!<.` X(   \ &@("!@ 0.`( T @` 4   X   & X @` @ޅ.`㿘`< $`  W7 ?   2`P>А J`0@H`H$  `P$```H@Hœ*`$ `P *``H@H$`d$ $ `D @ 2  < $㿘 ` ` `S@`㿐H /f * ' > "XŔ H 0 #)>  4 H /f * ' > ߔ 2H p@  $ $ 4 $$ $ $ 2$  O 0$ ) ܑH /f * ' > #HN $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ '􀦠y> ߦ# dܑH /f * ' "X H 0  4 H /f * '  4H p@  $ $$ 4    +*H /f * ' > #Hޒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(8  S$ $@&@㿘`@M`?㿘4``L> 0>`@T?&a>ؐb a80  @ 4&a<  @#`&aܒ H @ &a&a <@*&a>`@2??&a&a>a@)??&a D&a D>aa &a&`<`<&`@ @ǀa@a>>۔H} @ ?( # x ! # r  #&a ! # g  #&a & ] ! & W  &&a ! & L  &&a  ( B  (&a   9  &aaV``dRH >>>?&`L"ܒa" $$$48$ $e)a!>Р! P8 >В`@L `@"&㿘b $ 8@/ 8 $@ @hb#b  Ѐ  혒     €  D Ѐ  탒    €  "  ,  & & $  ?&  , " ג a* @ ƒb8  ," a ""  2  8$6 8 a$a"`b  6 6$b $b㿘"0 6 "!"" !b " !ܠ T !" `?"# !c   T !# `?㿘H /f * ' ː@H 0㿘>Вa8 8  `$ 㿘!ؠ  !``!!`@K`@!  ``@` @㿘2      `  `>Ѐ  !P  >!`>Д!h>И!x- >А!)㿘 @ >К!  >!`>Д!h>И! >В !m"  L!""*`#`` T`a"T  *`"#`` "T$26"  #"#" 828" ?!#! #㿘 L 㿘"", @ # % @@  "*  "@!`  "@ &" 㿘 L!ܑH /f * ' b@bDbH@ bL@ \@  \#b@#bD#bH#bLLH 0>  "㿘 H /f * '  a2a1;a a H0!5=0 !69 = 8 6 8 ` @H Lrv0; 8@  2 8s 8 ?/6 8  @h@.0$ƒ L8 L`4@ʐ ! L6 $  H 00H 0㿘!ܤ L!!ԑH /f4"* '"  " @~ &"!   ! @t &" "@ "* " + @" " ("    " "*`   + " ""  "   $"&" &"&"@h&"@!(!*  $c!!* $c!!*`@ $c $c @DRv  $b  $bP $@"$ "($ `Q!$ $ $>$  $_d? $ , , $ ($a$ $ &!$ $ $b,$ 0b  $b c `$c 8 @ ;48H p@>  |!!    ?#d ?#d#㿐!!耤`>А"( ?0# $   '$   'R   &!?$'0  ?&!$'0>А"H 㿘!      > "xM1? @ @ݒ @ڒ @ג ` < `@ѐ?< >@ `@ɐ?>@! @U@S @P *?@@I@G@E@@ @ *?@@ @@㿐! ! $   '$   'Q  2  >А $   '$   'Qz  2 "xɔ 㿐! ! $   'Qd  $   `2`'0 >А $   'QR  $   `2`'0"xh 㿘!     >А"xY 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?>􀠠 `( (   #d" #d#㿘%  L>В d" P`$ P!`*`   2 L P  $ P , `$ L ʒ2㿘 ǐa !"  0 2  & & #&`  `   ?&`㿘! X  H D  # P ?    >В ;"z ` ``*  !ܖb " b ="b ?*    PI ? L $ >  "Y 㿐!ܰ L 8!c  @$c 0Sc ?$c  8b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL 8="!d7777& @I  ?;n #       @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cL 8 =6 8㿘`@GY`?㿘 L`L>"0n>Вc@&?&a̐0  @ϖ 8&aĐ<  @ɔ &a&a <@&a>Вc(@?&a D>ݐ &a&`<`<&`@@l a``dL >>&`L!b>?a 0`"$`$`>>$`4`8$ܐZ<  ^ # #} $`` $`ǝaa!>Р#8CLj8 >Вb@F `@"&㿘 8 $@ @[ Ѐ  ْ     €  "E$ Ѐ  Ē    €  "  ,  & & $  ?&  , " ` `ԑ*   8 ' ,`" Đ `"a"   $ 8$6 8$㿘! !,   N ?    $@@`  Nڐ ? @ 㿘ڐ@*㿘>А cXř   & H /f * ' H 0㿘!! *`2 2! `#߀@q?"  @  " @= 㿐! L $!!ܓ*( ' 2!  T # T !?  &!!ܕ*( ' " T!䀢 "3 6!耢  &! 8$ ;3 8  㿘! !ܕ,`@ 2&! #  @ @E` !ܑ* `"@a   !@&! 㿘`L@   >В`=#p X `$ X@ X  $ X@ >В`*# X `$ X @ >В`# X `$ X @@ >В`# X `$ X  @>А#` @>ѐ ` @  \  Xa!$ \$ X@>ѐ `  @ >ђ` 8 X `$ X @ >ђ`֐ P X `$ X @@ >ђ`ʐ p X `$ X @ h \  Pa!$ \$ Pd P !$ Pb P !$ P `>ũ  P `$ Pa >ђ`ş  P  \` $ P$ \``@ P !$ P` P !$ P `>ņ  P `$ P` `>|  P `$ P ` `>q  P `$ P ` `>f! P `$ P ` `>[!0 P `$ P  >ѐ!PN`>ђ`H!xW?㿘 H /f * '  a2a1;a a L0!5A0 !6= A 8 6 8 ` @L Ll<0? 8@  2 8 8 ?36 8  @@20(Ό L L`4 8  @ Д! L $  H 00H 0㿘! L!!H /f * ' !܀ ! @> &!!@?!Ԁ !@ @2 &!!@?@  !ܑ* !ؗ,  @ "   # !ؒ !ܓ*`   , " 4 !"   $!!$`!($` &!&!&!&!$`$`$`$`$`0$`4 `K!$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ ,    dL" ? $!  !,!,!,!,!,!,@=,8 `@  {a48 , H 0㿘%  L>ђ d! P`$ P!Ԓ`*`   2 L P  $ P , `$ L ג?㿐! L 8" , `  dK ?     ,?0R 8"6 8!d7777```- `@D  ;n # ? @    @2?2 $ @22*  * @5 ``ڐ , `  dKo ? $   @ , $ @ #"` @ ` "` "`   㿘``@B >@B!  >@B!Ѐ  C@ 㿘4``>;!0`>3"08  @!0&aD  @<&bP  @H&b\  @T&bh  @ `&b >&`Lb @R? &b &bb  `!&b>b(@???&b @&b @b @ @&b`0> \&`<&`@`<@ a>b8@  !>!>Ѡ"Pˊbϐ>>#ؒb>`P!&`&`>>&`t&`lt<???A `t   " n 荒 "`艒 ``G{ >>>?"`l4" $`$`$`4`8$`$@` $`˜\8`@> E"@A >ђbp@A >ђa@Aې &㿘 8 $@ @G0# Ѐ  ϒ    €  "/$0  & & $  ?& "#$0 ,  @8  ,`"  `"` " 4  $4 8$6 8$0㿘! "@!    I !`   2 |>ѐ"x  | ?& |㿘H /f * ' Ӑ@ʐH 0㿘>ђb   `$ 㿘H /f * '     H 00[a2@a1@9a @a@"8F 0!5@;0 !6@7 0;8 48 ` @rhǒ0-@  28m8 ?"48  @b@Y0ˊ 4 @  P_H 0㿘" 2 "(" @ &" "( 2 "p!@"$ @ &"("&"4((&"0&", @ "( #@  `&"8  ! "(*  #@ # 㿘" " !"@}"?#$"`"  ?$@@!!*` @  $bP! !*`@$c ! !*$c!!*  $c$b,$b$b" %`" (% " @  $  $ >ѐ"ڒ $!$ % ,   %  %@H@">ѐ"Ē $c @H b  $$b "`2"$@b  P`$b c $c 9856`@ {58㿘"  " ?#"`` Ȕ "`" Hs&"㿘" $b0Hj ? b  >ѐ" 㿘" $c0HU ? c  >ѐ"j 㿘>ђ c# 㿐" HLD @ `\ @$`\"H"L"D"@", `T { 4`8 $`T "4?&"4"4  , "(@E  6`8&","4 "4`6 㿐"8 @P $P@ ", ! 'D   " ", @Dߔ `2 &"8 㿘  & *     & * ?" >>іP#0  㿘a?a" ֒ f@h@㿘.`* * "$* @  > ߤ#'> )>  `2GH /f * ' V* 4  ""8@ <"`<<8"`8"($H $0,4&0 ?6"XH 0KD4@H /f * ' V* 4d  ""8@ <"`<<8"`8"($kH $0,S4&0 ?6W"XH 02n 㿘%  >ђ # P`$ P"$.` @  g  P $ PŒ  L , `$ L ʒ2㿐"  8!c  @$c 0]c ?$c  8b?c$c@$cD$cH$cLc ($c 0M?#$c@$cD$cH$cLc h$c  8"A6 8!d7777& @?  ;n # ?      @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cLc ($c  8 }6 8" ` "   " 㿘" "FK ``"   a2" "   b   &@ 㿘"  #" *? .`c   $` ` @@ F ` ?  3>Ґ 0 0. $`       >@ `>@ > `> > `>$`㿘" " % *`@ .` $` ` @@ Eɐ ` ?  >Ғ ݐ 8B ` 1?#=  $` W ?R O L I  >@ `D?>@ > `<?>$`? ;*? 30-㿘 8 k 㿘@ P &` |&` "b b "b 㿘``@< "  > H# `A&`48]@ 㿘>Ң `P @A > Ebd&`4`?`>K X0>Ґ x D&c( 2&c80 @/ &c&c$ [ >Ғ`@t &b>c$`@n?&b" &b&bb耢 6`$ 0&bb@6b@ &b&c & <`@ܐ`P &c " <> >w b  ` .`.`.`   `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@6Bb`&b``>h!>h!@&b &b@&b@6*$&b@&b>h!&c` >v c`$Wc>vS>vbXc(&c c &c@5 >Ґ`G`0 "8 6> E>Ғ`@;ސ /> E <@   #> E `@2> E @$ > E > E>Ғ`@; > E ? > E `@2> E @  > E> Eb@NTb `&b@ #*` #*`( 㿘#  t@㿘#  l@㿘#  x@㿘#  |@㿘#  @# D"# Hlxx< `@|㿘> #`>@;H#`? 㿘!0`>Ґ#Ӓ06 >Ҕ #0̒ 2  N 0 @  N.` .`&`.`.`.`@ `> \"!L>@֒b>!&`@`@&`D @V >Ґ`hcH> E" @V !* *  E** *  C*  *  P2   " P" " T" " " " "  㿘@Ȑ@& P?    @" @ >PP"`  2`"`"`"`   >Ғڅ(@X2 (@2& * ((0 >҄ڇ(a2$2"(@>2"2$  -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `T @ ` !* *  #`T@ #`#`#`#` `T @ ` !* *  #`T@ #`#`#`#`   !*@ *`" T   !*@ *`" T 㿘> Eb?{ 0 @``& `" @>ԇ( ` * ` * ` *`    `  ` * @`` ` @>(  *`  *` *` "` "`    >( # ? # $# # >X # 8# < # ? # # $# >h(h # ? # # $# >p # p># c`3  # <+ c`# (3 , + . # ? # # # $>#  # # <>``# (3 ,m+ . # ? # $# # >>҄# 3 # (+ cX# @X# , # ? # $# # > # >3 >+ # (hh# ,# @# 0#p#p# D # H 3 L # X4+ N # ?# # # $> ?# # # # $> # ?# # # $># 3 +  ?# # # # $># #   㿘  H /d * %   @(  H 0  @ H /d * %     H 0  @ 0H 0 /> E%P/> I$%$/> \L %   ,%+> c`+?P `-`0+-?P%  ,% +> c`+?P `-`0+-?P%/> EP@̀8Lp<X4\\$L$0,Td<„œ$\Ü@xĘĸ\x0XǴǀ㿘``@8 >@8#   㿘4`>#0C >Ґ#0:8  @0&`L>&`h`@ʔ??&`l @&`l @`0`l <&`l>"&`<&`@`<@ >Ӓ l >Ӑ`P+`8> El#X   .`.`.`.`.`.`Á L( L( L( L㿘`L@  $ >Ӑ @<`  " " 2 $    ,    ϔ  ˔   Ŕ   ,  $ `t` ` `` "` ` 8    "` $ 8$ <@ €`   `` ` `` "` ` (    "` $ ($ ,@ €`  #" > F @?  p8      ?"?   &" *`@  #`#`   @㿘 p  LB  & p& & & & t& x& $`?b  $`?^` ` $`?X`W ?$` @` ?N ? @  2 >Ӑ Xa   @  @      㿘    @  Ð 2``?   Đ 2``? N    ` "N     `N 2  N 2 ` 2 ࿐ `        "       @   ɖ `0 ʓ2`2  0  `  ~ 㿘 L@w@e ,  , & p e >(>xx"R >"  K*> >"  ="> " "2  "*"2"> "  """%">ด >Ȕ " "2   "*"">؄"  2"""  㿘? `  > *` € X A  R ;    "5 G  C ,     7 >!  퀢 , >"  • ! >"<     ? 8 3 2 &' $  $ $$ԁ 㿘 ؀  L  ӑ*  ܒ@ `H /d * %   @,@ I,@ ,` H,@,` `W `c= ? @   \>Ӑ   \,@,` `W `c= ? @  >Ӑ! ,@ @W` #=t ? @   >Ӑ!   ,@ `W`  #=] ? `  >Ӑ!@q H 0& ؁ L?`"` *@ ` *@*`"L?ۄ"` *@ ` *`"㿘> Ec: 0 㿘@` > D*` €`2`   L *(` 2 L*@`  L * L*@` ` 2`   L *` 2ڰ L *`   L `*  L*`  L *`ɠ ` ư` " 0` 2`   L *`   L `* 2 L *`   L `*  L *`  L *`` 2` 2 L *`   L*`* ` 2`  ` . ` 2|` . ` ^. ` 2s`? (` l Q. ` 2e` @ ^. ` 2[` @ T. ` 2Q` @ J. ` 2G` @ @. ` 2=` @ 6. ` 23` @ . ` 2)`  ` . ` 2` . ` . ʐ ` 2`    2` .    >(  L *L9* L(L* L(L **  L *L*  L(L  * L(L  *   L (L *  L(L   * L(L y* uq L(L 0i* e * \ * * SJ M@ JJ D@ AJ ;@ 8J 2@ /J )@ &J  @  {*  * t*     "  I >( " ? "$"" >p "@"< " ? "$"" > "2"< " ? ""$" >" !* " ? ""$" >2 * " ? ""$" >" ""<>xx"(2,*. " ? " ""$> "H  ?""$" "  ?""" "$              ?"""$" >" *"(>2,>*."@Ḅ "X"D " ? " ""$> "2>* "<!x!x"( 2, *. "  ?"$" ">Ȓ "2>* "(!p ","@>"D *H"X>2\>*^"pင "a"t "? ""$" > ">2"(* В ",>"@"0 "D>"X*Hؒ "\"`2d "p3*f "?" ""$>" ?"" ""$>  ?"" ""$>"" "?" ""$>"2*   㿘 rb  @~ $ ` $ $$`t  㿘   2 @ @ދ $@s0 @ 2 >Ӑ!   㿘 t  L>" =  "& t"   2 & >"H) ""@""   "8"<  ?# @"D " * * ** * * * 㿘   >Ӓ g"pU  $ & $  ` 2@`& >Ӓ U"C $ $ @$ $ ` L" ( L"`, L `D ! `@@"       ؒ  L $"    `  $   (    $  L" ( L"`, ̈́͘$㿘> \!T> \aP  㿐```t>>> #`l`& 0& 4& 8 (\ 0`2Y 0> <!@ D 4 H`"N 0@'2  E"G 02  E"A 02  E2  `"6 02  `/>#*` €$!##$%$"!" 0J "$   $ 0  %  0#&@%& 0& 4%& 4& 0 07 8 & : 7& <>Ӑ@Œb& 8>Ӕ@b& 0>Ӕ@b& 4 8 0@)7 87 8 & : >Ӑb@& < 07 8 &  <: @&& < 4>" 47 <& @J   J* (J А 㿘 `& t 0& t3> c 8& L <` 0& \ 4& T& X!> \>"@TcԒ "">@Mc ͒ Pc  L> <!   " Q` P "  L P P L@3 㿈> #`@Ӓ '' & p6 & l " & l?& l l` & l p` & p 8 >;> G!0                  U .            > G!,   `$`  > G> G> G> G"!8","0#!4`$  L 8 !> G> G!0 L, @ !   @ p l@> \> \"!T"aP@#``#dd"@@d`?"@0 d0E Ed0# H2   H`#dd2 #㿐 , o  `K > \!l` 2 #\     0(  o  &` &@@  &` q. q+ " `#\`\ &`&` &`$c$ $ `  $ $ $ $ , (㿐  " & _    p p 㿘@` `>>>Ӑ#`cp!h"`N@  `  `, @ @2  @&` 㿘>Ӑ#ؒ >Ӓ@#.` <>@#}@ `">>t >q 㿀` R .` < L  8 2 0E   4耢 8#\#` 2 & 0  € 40#H /e4 p* & p    0    ` 4$ l$ pH 0@M 㿘@ 6 @ p "@ l&@@` *`  <  `@( `  @( 0 㿘` > ' h x*`   € > `!    <> Z#>c,  #  , 2  @  *@ 2 (>. @   3ǖ 㿘` J .``<  A > \!l@";   27  / H /e4`p* &`p"$`p&H 0  "` `0 €`4>Ԑ @`f`       㿘@H  '> >#\> F`؀ !> `! `> Z#>c,  #  , 2?c.`  \* "`㿘`> X  㿘 @  㿘`>  X 㿐> @) h &">n p" h`;&"> \!h` !> \>>>Ԑ#`cpM"! " #\>>>Ԑ#`cpA"#`     W& <> \l>  $!"@" >Ԑ!’` <& l& p >!& 0& 4& 85> F#>  t%>9> F@  = "`@&@ `* @*`" * &  : & @&  & @    > &>"0 і  ' 㿘#> \ah "  >>>Ԑ#`cpє"`4  >>>Ԑ#`cp8Ɣ"  >>>Ԑ#`cpH" >>>Ԑ#`cpX"&  >>>Ԑ#`cpp"> \al"al>$ $ @ː!$  @> F`> > $ "\$ah㿘?2  @> F  2 6e  *@  `` Z *` < 2Q  J> p>2!``$ $ Т` $ l"  p`" p8 ܣ  a# %$ $ $ $ $ $ @ ސ p> ' h $ p*`x  `" ` "  ` 4  `4    $ 㿘 ?> F`6 W* <@ "'   " H /e * &  @ H 0 > ' h x*`  €  " @   ?&  $€ > \!``   $ > \aX ?& > \!d@&S > \*!\ 㿘 > F?`6  *`<@  > ' h`x* `@ 㿘 > F?`6  *`<@  > ' h`x* ` @ 㿘 > F?`6 >|!*`<@㿘 ?> F`6  @9+*`<   > ' h`x* `@@ 6  6 @? 㿘 0 4 @ 㿘b@(  L"<#K "*` #D"``0#RE"y`0 #Q"V"`0 #PI0 #U`0   :& 7&5& @ `#` ?&`  `` &` @ ` "`0`t`0` `@Ґ@ ؐ`0 `0`4@ `0 `&8`0@ `4 r@ `m`$ € 0g`?[&`(`0_  2`4Y -`M`0`> *`" *  @#* &`*" *  @#* &` =&  $` > ` 1F @,#` $`$`$> ` 16 @,#` $`$`@V 0@f  `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0|@Eu mڔ 0hcL^@ X `T  P(0$0@E  i8,S "&8kf 06 0   4 kZ 0**" *  - <0 * "@*` `- < ?2 " 2"@&"@&} 㿘 > F?6 @*`< `  `0 `4?㿘> F?  2`   * < ` ם㿘> F?  2`   * < ` ͒㿘> F l  *@H /e4 p* & p  H 00 H 2 o " p o<* @   & pH 00& pH 0 H  `% P ` >>>Ԑ#`cp%@ܒ p2  ( @ ߐ@    @ 忒    P `2 >>>Ԑ#`cp%@    @ H /e * &  p> ` ? & p` 耢`&`:` V  H   p  ?& p H H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `   㿘     > '  h*@ `㿐  >>>Ԑ#`cp& p E  A}* 2  o!<@ 8@>@  > '?#@` 2> ' x h *` ` * 2 €0 +   2` ?> '  hJ*@ ' ?㿘" >=!4 " *>Ԑ"  < ` >Ԑ"0*   """ ?>"`" $"$ p$"$"@d   ?$"` `  㿘 >"J  , >Ԑ"g< ` >Ԑ"  "$l ?># $)$p$$@% !$p` `> \!` >"  # q㿘" ># B " ? $"$ p05*>Ԑ#H  < ` >Ԑ#p   "@" ?$"" ` 0 4> \!` >#  @ #e 㿘  ` .` <@ H /e * &  p` l@`2 "2 "H 0 k   H 0 ` &"&"H 0  p 2 l?&"K &" `2  .` < ` 2 @  2 .` < ` " @ ~@   .` < ` 2 @ ~  " "  > \!` >! `#  2 㿘 2  p>>>Ԑ#`cp#'4``` 0 @   $€0㿘  " &  @  "&  &   " "   @"   " ` *`   <  * p?l㿘' H /e4 p* & p  3>Ԓ!c |  p` !H 003` .` <  `) H /e4 p* & p@ ` >Ԑ &` ! K @  ` ?&` H 0㿘` p "``"`  㿘!> \!`"   @b  !㿐> \!h`/> \! > \ < ` l     㿘> F 6   * @> \` "!`0 $> \`4€> \!€> F> \  ᄁ > F>؆x> \  "!㿘> \!`  `< `0  `4@㿘`   p` `  0   p 4㿘 @` 0 `  `"  t 2& 㿘 0 ' 4  H /e4 * &     t e&   &  `?& H 0㿘㿈 #X @'?"'?  ? @    @. @*   ?  @\ ?㿘  * 0  0 : @ 0 *`:`@ 0@㿘 ".`  `0/*`0,` ?&@   0 0@@kP@y@g@@@c0@B@_ @@㿘  0 `> FM "!@Ԑ> \*!\&  > \*!\?&2   &1>Ԑ (#     )' 5> F,  <`" @ *2 @:`6`<22` 2 "2`$2 &*`(   㿘> F!`p`  @#}@ʐ.  :` ?@ ?` a.` p:`   ? ? a `p`*u @4 `p-`2 @  `( @ 0@ a p `(  @0*`(㿘)> F!. p6 `4@t0@#5` '!,  p4 @, 4  ` w @S@"  `@㿘> F!`p *.`* @6`. 2    , 2  , 2 , 㿘#> Fa p @`"  @"ʐ "@  -2 @8. a-p5 `4@0@" .:   - ? ?  㿘!> F! `p  @"%@ -2 &  -`p: @`4@0@"m  2? 㿘+> Fa)>p#@  `@"P. "@4  @@"C40 ` *   .2 8 ``!-p2 @c`4@r0@" * @ߐ` 2`㿘)> F!'>p  `@!. < &@I@!40 ` *   .2 @& ``!-p: @`4@#0@!ΐ * @ߐ` 2`㿘)> F!. p6 '>` 04@@!! p* @.` 6` 0@4!`p`@! *   @ 㿘> \Ja\ !> F *a\!p (`!@͐ ! p (`!8 !  p2  p2" p 2$ p"2& p"`2 ! p (`*(!`p ( *(!`p ( *(!`p ( *(!`p ( *(!`p ( *(!`p ( *(㿘> F!p `( a@ a p (`a ap`2` p2"p  `4@Y0@!   a p`"ap` a \a p ` " 2` p" 2"p` 2`$p"2&p`" 2`p" a`p ( *(a`p ( *(a`p ( *(a`p ( @*(a`p ( *(a`p ( *(a`p ( *(㿘%> F`p  @ ( @ p (`g  `p`'4 `p` ?@2"`p 2$`p`"2`&`p" 2`p" `p ( *(`p ( *(`p ( *(`p ( *(`p ( *(`p ( *(`p ( *(㿘!> F!0`p ( *(!`p`( `"` @! ! p"`2㿘!> F! p `( @@! p `(@!@! p `(@|㿘> F!`p ( 2qa :a8 a p$@ a  p  @2  p 2" p 2$ p` a a  p$ @2$ p$?2  p$?2" p` a p ( `*(ap`$` :a`" * a@( ap$?2"p`$2` ap`$` :a` a@ ap`$2` p$?2"a`p ( *(a`p ( *(a p``$ *` `" * 2  a* 2 a p2"  ?*` 2`a*` 2`a p2 㿘> F!`p `( 2a`"` @a2 a p$ :a"@ * a& * ^2 a p&2"a p&@a $  *`K2`a p$2 a p$ *E "А a  p * @ 2" p2 -"ra`*` ^2` a p " , 2 " p2`" * 2 [aa p`"`a  p, 2@2" p " H * 2  Ca a `p? *`"3 `p2` 0a* 2  a p` `, 2`  p2  *`ԓ2`aa p` `a  p, 2"@2  p @ *` 2`ap `( `2`pu`㿘> F!`p `( 2`"` @b  p$ :"@ * & * 2  p&2" p&@ $  *`{2` p$2  p$@*2"@"2`p @@* 2 %r,`"4` 4"`p*  "4-`p"2` * B2 , @ p ` @w* 2 %G ,`4` 4  p*` "2`  -` p 2 *`2`p `( `2`p`㿘 p `( ` p `( *`(㿘> Fa  p `( B *`(!! p`` " "! p`"` ("" ** @ !p 2$p` 2`p`2`$p"2! p `( @! p `(@!@! p `(@㿘 p `(  *`( p"  p `( *`( p ( *(㿘> F!`p   9> \$  " @ I* 2 ? $E- a-`p2 @`4@0@d!X-2*@ !XJ `  a  p`@L? `-!X2` *   `*`2  -2 a-!X2 *@㿘> \J!\> \aX@* `> ' %> F p `h*  € *`  㿘 > FaA 0a= 㿘 8> \d `H /e * & )> \   $ ,2` $,ad2   `"4 @!X!X^ƒ 4  ]  %!X>#%ad%adH 0㿘 p (` 㿘 > FL > F !!`@   2 *l*l*l*l*l*l*l((()))())*l*l*l*l*l*l*l*l*l*l*l)-----------------------*+P----++-----++--,D----,,,-H----------*--------|----------,,------------,,,..p.p.p.p.p.p.p.p.p.p.L.p.p.p.p.p.p.p.p.p.p.p.<.p.\.p.p..(./H/H/H/H/H/H/H/H/H/H/H/H/H/H../$/4/H/H/H/H/H/</H/H/H./H./H/$/H/H/4/H/H//H/H/H/H/H/ //H/H/H/H/H/H//,111122`3`3`3h3`3h3`3h3h3h3h3h3h3h3h3h33333333333h3H3h3h3X3X`" "`$" `" `" " " " 㿘#> \a $ ($ $ $  a> G  , @  a`   @ 2$ $ P$ T$ X$ $ |$ x$ t$ @㿘  > \! (`" >>>֐ ` pz ̔ [ \& ( & $ [x & P  [s  & T@e   & X[i!&   [d"& t  [_"& x  [Z"& |  [U"& @ Ȑ@`㿘 &@ & P " T] & P T " \ & T " t\ &  t " x\ & t x " |\ & x | " \ݒ & | "> \\֒ & > \!\Β 㿘`  ` 0@0@ w0 @ & &   0   `@㿘> G,> G0 `& 0 & @ P& D & 8& L& ,& 4& < & H  @ѐ    :  t  P*   * P t  & p& h& `& & & & d& l& \㿘 0 ! !'` H L  " ? &  T "& XJ    2  ?@ & X& & X@  0&  ?& 0` d `* @` `*` d &  \ d* @``* @` 0 "   X 2"   ? + *@*  X*@    4@  X 2 " &  0 & 0㿘``y>"h*` € $0p `m 0 ?& 0h&  0&  ?c& 0 P" X  X2  " W`@ :S& J 2O&   `@ :I& J "`C&    2@ ""@  8 Β 3& \1& \> 0* ,   $& ,"& , H L  " ? &  T "& XJ    2  ?@ & X& & X@8 㿘`?`^ՠ >"ؓ*` €. & & & & & & & & & & & .     &  4&  8&  <&  @&  D& &  d  @ "@ ` \ `& &  Ș d &  &  & 4 & 8 & < & @& D   @ "@ `  & \& ` 0 & 0 0 ?& 0&  H L  " ?  &  T "q& XJ 2< k& X@Ò 0f P2  >>>֐ ` <! X*  U& ` R& \ O& ` L& \ I& ` F&  C&   H"@ &  T`"8& XJ@ "4& X  2  ?@,& X*& @ 0%& & & & & & & & & & &  @ & & `?&   `?&      `۔  >T( dd( d tdxd|(" ``5ฐdt(" 㿘`ۀ`5% > ̓*` €   d t* "             @=㿘``6@4      Ā ( " ā 㿘``\ @;  `0 9;  ` *`  ((Є " "   "  " ``$ 4`|0  ``p`q `t   " " ā 㿘`̀`}>!*` € X t   .`    @` 2 @    "  @ 8 T *@X& X X T 2 ?,  .`  @ <  2 @:     `  @ 8 2 @*   T +  & X2  ?@8!& 0  :&   @    E 4@` @* * & &  㿘`?߀` >!*` € +   `*` * ?А "   & .  .    &  & @`  㿘"  0 ( 2 0>w Ѐ @    X*   (> F!!>@   ` ,``  `(M!* @ €& ,`2@ 0 @    X*   F(F@GtGtGtGtGtGtGtGtFGtGtGtGtGtGtGtGtGtFFE0ETEEE\EdEElEEEEEEEEEEEEEEEtEE|EEEEEEEEEEEEEEEEEEEEEEEJ,J,IJ,J,J,J,J,J(J,J(J,J,J,J,J,J,J,J,JhJJJJJJK`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`JK`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K4K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`K`㿘 L@ 8 "  H   @ T H@   H @ 8 T`  H@@c  T`"& X J@`   2  ?@& X& & X㿘 L@ 8 "   H @ T H   H  8 T` H@@'  T`"& X J@`   2  ?@& X& & X㿘`"1 ``" XT T"DP T  2 "  * *   @ 8  " ?`<`   8 T`4  @@ , T   8  T " @В    X`*  @ 8 T     8 T " T @  T`"& X J@`   2  ?@& X& & X㿘`"``" X0"0  2 "  * *    X`* 8 @ 0   8  @ `N `N *`* @@`m"H < `M `f`L6 `C"w  `H`A"= 4P `@" 0" 0`J`D"t 0x`Kz0"w 0`h`X" `c`P" 0" 0"j `i`l" 0}@'"p@ 4p`r"y `y`n"@ 0!p@0@ "4u"q@@w@" 0K@1iu@">~w@ c@J@0n@"d lh@"' 0d@Aɐ p@Q0\> $a 칔 0V 0R1 0O @L ,` !@ِ `@ ,`0@ @= ,` !@ `@ ,`01 @. ,` ,@ `@ ,`0"  @ ,` ,@ɐ `@ ,`0 @ 70 @ 70  8 00   P   >>>֐!0a@l!V $>֒aN   !> PJ@  >֒! >!>֔!   $1  * P> $a& 0 aЀ`"   X 2# 8 #  + * *@  X ,@`ו*`"   H" 8 "&  T "& XJ 2 & X"  H L  " ? 8 &  T`"{& XJ@ "w& X  2  ?@o& Xm& "   X 2 " ? 8 ^&  "  @  08" "   "  L@8 H  `"  8 ?&  T`"& X J@`   2  ?@& X& & X "   X2@@ 8  0 ?& 0& "  H L " @ 8 "$ & L`L& H8& L& L& H`"   X 2# 8 #  + * *@  X ,@2"`*`"   X 2 " 8 *  *  8 @ 0ǀ > $a" 0 P`2  >>>֐!0a@.!Ҁ   0 *@ @ ' 0  < @@3 D,`   `/(> !(*` €@> G> G!, a0     ? ? ? ?  ?  ?آ`@ ғ,`@j e& D& 4& 8& <^& @?`Z>  Г*` €> $a걔 0N 0 "   H"@ >֒a $꜔09> $b> $b꒔ 0/> $bꌔ 0)`"     `?  8 " ` 0& L & H  &  & !,> Ga0& < & @& D& 8& 4㿘`  "  @` `; `  `  `` `   `  ```  "`"  2  `  @  㿘 `<`7> P 2  >>>֐!0a@"@   Ĕ    J `/" `94 đ* * ? $  P*?  Ė&   P*?"(&  > (!,`0`0"`0`0    㿘`0`CF > "4*` €!, " ?4 5 3 !, " ?' !, " ? !, @" ?`0 @@``` `!, " ?   $`0㿘 ,    t   $>֢"P ,  x, ` @    >֢#P ,  |, ` @    $@ 㿘`   >>>א!a@ .`,      $@>ג`*>ע P  , @ * ` @ ` , NOTOTOTNOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTOTNNOO OO$m(0  *`?Æ0> F!@(l(0 *`?Æ0> F!@(mo(0 *`?Æo0> F! 08mЅ(0  *`?ÆЅ0> F!( "*`?Ç0&(>(>DŽH>ĄP>X>`>h>p>x>` + > (؄" + 0<#w>4#"q>"""x ""j>ׄ"} 0"n 0O> ""R>ׄ"S 0wC>ׄ#H 0oH>##"O ##6>ׄ#< 0[H#M 0T> F ##>ׄ#  0F>ׄ# 0>> Fx| 8">  >>ׄ"# ">>Ѐ">>">>  >>؄" 㿘&   & O&  @ 㿘 Q 㿘` f (H /e * & @`  %>؀:$`!( nk 9@` ` !`" H 0` 2 4` *@.c@@ ``$#$@  `0H 0 #H 00 4` c.$@㿘 H /e`A* &`A   @ Ȓ H 0mPmPmPmPmPmPmPmPmPmPmPmPnlnlnlnlnlnlnlnlnlnlnlnlnlnlnlnlnlnlnlnlmm|mmmmmmmn,n,n,oopLptp,p ppqpq8qXqqqqqqqqqqq`  " 㿘`> ` `       㿘&`h` &`d`  " >>c p?>]  > ސ!&`0  NÐ $ $@ E&`0`0"@`0>`uYa`0 " ?&`4 ``0&`8&`&`<&`T&`@ Ɣ` "`0> > F`> F&`"&`l&`p&`t &`x"&`|`&``&` (>> !` > >>>ؐ `h!a䀢 " >>>>ؐ ` \!"a!@ &`h>ؐ!X`>!h㿘#> a  !> >>>ؐ `p=!$!!E>>>! $ $ bt $a㿘!> !  > >>>ؐ `!Β!"!"`"`$!㿘H /e * &  `2  hH 00" %>  6  0,     h & 0 @/#tH 0 㿘  `. & t  d > a䀢" "a>>>ؐ `"& @  A> `H /e * &  ? *&   $  `8$ B   " $ nF  >  ^c >  >ؗ*`" * lQ >ؐ!  H 0> `!  > Z#>b\  #  , 2    㿐 6`2  0 h " 0u  0@ ^  h#>  0< c€  I  @6   0.`  `8 h@& 0 & $`@t#s08 T 5 @  `,`  a ? @"@ 2# >ؒaД b 0[q$ H$*"@ *`@ *`$ $   " $ m   ] 㿘 h w` <  ? < 4 € 8& <㿘`2  4 "   h " 4 € 8㿘?> Fȑ2 `   ȑ* @ 2   ` 2 T  2  & TȐ @& ǒ  㿘?2  > FaȰ. @㿘`  &  @& T  㿘?2 > F Ȱ. @    $  @ `$ m  㿘?2  > FaȰ. @㿘  & @  ? & l㿘 "~@ "}@  0  v@  0  @ "\Ta  @ @? 㿐 #@$c@ "ɰ | #@E#@" . 4#@ z l#c @> F! 4@> F 4 #@ "1# #@ "u #  #@ 4@"  4@ "Z #@2 40# @" 4  4 c 8 l  " p & t &  x & & 4`  8͒cΰ  l " &  " &  "   &&    & & &&  !:U > Fڰ!!  |  > `H@ #耢 "   > `<@ #耢 n " &  "  && y   & &&q !:T k> F˰"":@@H*` *   K"   @   v  0  $ LŒ 0? 8&*  * 3 0&2+ ?# a2 0 !  ? ߀" 0 @  '@'  0$    8@㿘?2  > FaȰ.  @U> F 6?Ȇ* @" h * ?㿘> !䀤  > F$ hb  @@  㿘` `h d 2(   h      @ & h  & h>ؐ!   >ؐ" `  h@ 㿘  > F  6 ȑ. @2    T  > Fb @@㿘  > F  6  ȑ. @` @㿐> !` > !䀢 1> F %> / %> #> "(?`&"(aܐ*  < 8@$a /> @ " `*`2   @&"($a܁㿘> !`> !䀢 >   㿘> !` > ސ! `  x h !0'xcY @'䀦  '܀ 60"''0 h^cZ㿘.2 <!@ "@4!! @ @& @@!   0`  ` * "`    0`     0`  ` * "` @ 2 .2 =`,`- 0  0 `"  h | ? x  `"   h p 3 l 2 2c 2?Ò@`+\> *` € d > &"` @ &@J  h 2?Ò 6 ?  h ; ǒ 7  h 3 ⿒ / =2 $@ ? %@`? =2 '@ ? (@`? =2 *@ ? +@`?  0 㿈 `'H!  ?Ò " @ & `2`2` "  <@ 4 € 8 " < &  6 . * @@ݔ  =@!`H`?Ð"@`}>!4*` €H   & ?& H   |& ?y& H v   r& H n   j& H   b& ?_& H   X& ?U& H   @N& ?K& H   D& ?A& H  !:& >7& H 4    /& H +  "'& $H 2  (&   h  H H`` 2= `  "6  H "$ $ nƐ $ H  ` ` @ b2`d2`h2` " <@4 €8 " < !@ ` 0"`" * 2  o< 8@> @  $# b       * 2  o4!< 8@ >  `?# > > <@"* 4 >@@ , !=@@,   ,  ; &  &   2  ; & & 6  , =2`!@2  ` @ b2`d2`h2` "} <@4 €8 " <  "@*` 2  ? & d @   {&  ` @ b2`d2`h2`  =<@4 €8 " <=* 2  o;< 8@6> 2  ?# ` 2,6  0?* 2  :, 2 ` `2 ?  * 2  `8?"  " 6    6 6   6  㿘 ` @ b2 d2 h2   <4 €8 " <`     ( " zz8z\zxz㿐> G(=> F, .(@77 7..`. (06 @2&`' @`6``6`6` ((7@0~0 "!(> F,    68(( @ @ @ @@ 6868261=!-(0 @#* =(0o< 8>   * ? 2 ** 0>؄( *2 㿘`0>#x.` €4a666$666666 6666 6 6  66 6 6 6㿘4a66666   2  (` ?#!>* 2  ov< 8@ > n(`` i(`@   (`\X(` * 2  o< 8@  2  =@ < a aa26  * @   ?#  38 1>( }* 2  o < @  @ 2` @`@  >#(20 (` *`2h㿘 . @F . * & D &@ 4! @ 2@ @ 2 @@ 2`@ 2 @@ 2` p ? >  `  2  2  Ȑ#P * "  ` I *@  *  <?# >}* 2  o- < 8  > 2$ `  2    < < 8@   * 2  * *`c Г*   * ?#'8->%>}* 2  o< @ > @ 2 @@"E< @  @ o " `  * 2  o<   2 =@ < !   !! +`+`@ *`2     * @  @?# 8>,` }* 2  o < @  @ 2  @`  `` *  ,` * @ *{ iа @"` 㿘 l C   l@ >ؔ& `  &  㿘  C  2$ 9 $ $ $ $ $ `` $" ``$ $```h "`D  #  € "  ? `#   * @`T`X`\  " 㿘  ># `  2 2 h>ؐ#߰ 04    `" @  "   ` €  "`        "@`"  "` "@Dڒ  㿘` `  0 @2     "@ 2 '& D 㿐 ca@v  "}@  v@"`D`D #`@"`Dcb@"i`D0A#c@"j```D  `0H /e * &  ``` ?&@  `H 0 4  .`"$ $  P$  $ *"@ *`@ *`$ & )  " & c-   SJ H 0X  T &O L ?G   " `" 2 &3  @ -$`La  &@ 2```h 2``    @2   @ "  2 2 㿘`?    `" @2  @ "  2 `2 㿘` ` `h h  C  > & h>ؐ# w ` `% ``  " `` `2@``@2 @€` 2@` "@`2`2 2>ِ  D  h@ x                                    (@p|p|x`" "`$" `" `" " " " > G0> G,  " L" 8" @" P" $" 4" <" H㿘#> \bܚ $  > Gb> G4  !8@ D b`   @ D 2$ D $ T$ ʐ㿘  > \" T`"& >>>ِ P``~ǔ  @Ґ X\& T& 㿘``_>""*` €؂ 0V `S 4 ?& 4N&  4&  ?I& 4    "@ " @8   D @ @  @" ,&  4 (& 4     @ 4&  ?& 4&   ?& > 0  & $  " `& @@㿘 4 "  " `& @/ 4&  ?& 4`    D <`@  " `&  4 & 4㿘``[2  (& 0@  㿐``3.># *` € ( "   # 8  @   #  @    (`"    "& &  (`"   " ? 8 &  (`"   " ? 8 &  (`"    "&  (`"   8  ,?`&    8 ?&   " `   @    X"  ( "   " @8 @ "   $   ( "   " @8 @  "  &@    "@ @v  ( "   # 8 @@     # @    " @ @U  0  H L@' P,` (  `/>"#T*` €@C> G> G!0  a,      ? ?آ`@ ޓ,`@ 2 & H& <& @& L& P> G> G!0a,> G> G!,a0 (  8 & 8א  "  4 ?!0> Ga,& H & L& P& @& < & 4㿘` 0  9 ; 0  0* ( *` * ?А "   & 0 0  & 0 & 0`  㿘"  T 2>|!    "0#>@`ٔ#`" $6 `      $(  & $Q|}a8& $`2@    㿘 `  @` `; ` `  `` `  `  ``` "`" 2  `  @  }(0o < @ 8> @ 2- @2 -`2-> (  -(0 * ?,(0 * ? -o(0 * ?Æo0> G!<( ",v(0  * ?Äv2`> Gl* 2i"<➑2`\>&㄄♀a>⛄▀^>╀R>ل☀U 0\"F>A>ل✀8>ل❀1 0N<>㇄぀(>や⟀< 0>%>لダ# 06,> ㈄ㅀ >لㆀ 0( >ل㉀ 0 >  > >ل("  08>@>لH" >لP" 㿘 > \&@ b &? 㿘``"00     @ 4&  ?& 4& @    㿘 8` &    @  0    "  8  "   @  8 " & LLLLLL LLLLLLLLLLLLL,LLLLLLL<㿘  *@ #    @%    @ >|S!h?  @R  4& >|G! ?@  2?@ 㿘H  ` ? (>z!   ( `  \& $ $  p & 4 $k @ & 8& 4 8 4& 8<)>('>)5>)+>*7>*/>)->*& 4 4R  @ & D $@ 8& @C : $@& H& L& <& $&  82 & T $3& X (/ $ (` & P ' @1   (` %& \  <: "  :  ?@ 8&   " :  \ " @1& & d  \ @ڐ"@(* & `& d& `"c & & & & & & & ̀&  ( >(>(# #( & & ?`>'!*` €@ (@I (@ ; (@ _ (@.  ( ( ?& (H p@ ? & (H p@ 㿘 2>y!耢 @ΐ    @ &@   &  & " > G> G,0  2`>ڐX 2 2**` #      ((# 㿘  $F <:`:` ` X< @ X7  @0 `$* ?$ @@ * ?""" " """"    ?" ږ㿘 T X  $ߐے  㿘 ( "  ̟@ & `& $@` (` ̟€& (0 ( ?& ("*>-?>)?h"h ?* 0v h* UUU?""h"hh ****"@0YX h  , @ /8 /(( -  @ 08 0((@ .  @ 18 1((@ *`4(*`@(  @?( @*`2 2` @ `(0#@#@`2 2 "@" "㿘> h< @2 < (    :` \  :` < ; $ ;  X  H@  """" """" `"" 㿘 $ X   TƐ   " $$  : ??C ?8" ?2 00??-    8*`82? ` `8"  8* 82?2 㿘 Tk Xg b?   < h@ B$``??x> ?"?2 0g??c> ?2?2 0R?P ?*?2 0?  "@ & ` &>>??2    *2? ` `"""" """"  " *22?2 ` ">,>+>,\\"``  >->->-#̆"`"`"`㿘   X <@  @  $  l h" h l@ 2 ?     P& 8 (@ Y- >ڕ, c@8  B @ @ &@@9 `2   *  *` * @82 @ @&@@    *`  * *@ 2 @ @&@@ ~ @  * &@@ @v@ >ڐ"* >ږ, 88 @  @U @` @ @&@&`@H  `$"?   *  *` * @8`*  @ 2@ &@&`@"    *  * *` @*`  @ 2@ &@&`@ -@  * &@@-@` @ @  &`&@㿘 X  T   `$ l h" h l 2  + .%   P& 8` (@  @8.@     @.@   * &*㿘 Xb  T]   `$ l h" h l 2  0 6*   P:& 8` (@  8. 8 .     . .   * &2㿘 ` ?  h <@ X > `$  + .>ڒ@ # ? ??8 ?  #? 03>ڒb+ @ >ڐ"*  : >?/ ?/   # ?#?  `   #?2 㿘 `   $ X  < `$  *,>ڐ c??-@@?  #@?@ 0">ڐ"* `>ڔ*` ?8 ?8 @@ #@`?@ #@?2 㿈'D  VRND XI $` WD> < ?  ? >ڔ #*.>ڔ " . @: $``* ?  >@ *  @* @ @"@@ @ @*@ @+ @`$ ` `@:  `D?`?@Ų@0i>ڒ." ` >'b- @  "'  ?: ? 'D ` <>   "   ??5>1>ڔ #*,>"@ " .D @( : %`*  >@ *   #@*" @`  @ #@#`쀤`?   : #`4#@* #@ 7 : %`* ? , @ * #@* @#@" @ #@*@#@*`% #`@: #`?D0D<` > ?  ?>;>ڰ#,.b - D @ A  :  '`* ? .@*  #@* @#@b@ #@*@#@*`'  #`>ڐ": #``쀤`?   : #`4#@* #@``% : '`?* ? >@ *   #@*"@` @@ #`#@?vD  ">0 >0 >/">1>/H\" 㿐 Xg  Tb?  h?  < @ <@  ` `$` //=  + 2 - ` P7&  `(`8 @ ` `*  ` @*`*   @ 2*+ 2 `   * 񀦿$, 㿘>`<h>`<7> ޸ > ?&P"  `"&&"`./ &"`./ &"`./ &( 1?@@.`(6 6`&``Ӷ㿘> "T` ""T$bTF0N> "P " X X  T  $* > $$     P&8 (@> ޖ" 2  < $ *  <  $   >  bL* $$$ bT?$bT㿘> "T` ""T$bT0U> "P " XG XD  T?  $0 > $$ $   %  P%&8 (@> ޖ" 2  < $ *  < $  2  <  $    >  bL* $$$ $ bT?$bT㿘> "T` ""T$bT0Z> "P " X Xސ  Tِ  $4 > b$$ $ $ *  P&8 (@> ޖ" 2  < $ *  < $  2  < $  *  <  $    >  bL* $$$ $ $ bT?$bT  ">2 >2 >1">3>1D" , * ,* /`  * -* .`* 0  * 1㿐 X]  TX 7 7  h < `<  `$` ''?  3@`2 / ` P.&`8 $@*  *` (*     2*  *3@`2   * $4 㿘6` h<6`<?> > ޟ(.bX ش   "''bX&bX&&(bX@&@` 㿘> "ܢ` ""$bܐQ0W> "؀ " X X  T $> ޲"X/ $ $ $ $ %  P&8 (@> ޚ"X` 2  x $$  *  x $ $    >  bt* $$$ $ $ bܐ?$b܁㿘> "ܢ` ""$bܐ0b> "؀ " XJ X<  T7 $> ޲"X8 $ $ $ $ $ $ ,  P&8 ( @> ޚ"X` 2  x $$  *  x $ $ 2  x $ $    >  bt* $$$ $ $ $ $ bܐ?$b܁㿘> "ܢ` ""$bܐv0m> "؀ " Xג Xɐ  TĐ $> ޲"XA $ $ $ $ $ $ $ $ 3  P&8 ('@> ޚ"X` 2  x $$  *  x $ $ 2  x $ $  *  x $ $   >  t* $$$ $ $ $ $ $ $ bܐ?$b܁  ">5 >4 >4">5>4T" , >7  * .* 1* ,* /* -* 0>7>6\" " 㿐 X7  T2 7 7  h < `<  `$` ''S   ::+@`+@`+@` 2 < ` P&`8 1@*  *`(  *   6 WW+@`:`+@+@`:`+@`+@`* 2  * $ `: : , , , 㿘6`< h6` <?1> ?&# > ??  ```` 6 (6`. b(`'@.`'@'@ (&`@ . ( 6` 0'@@ . ( 6` 0'@@ ( . 6` 0'@ `?㿘> #` "#$c 0_> # " X X9  T4 $> ޲"5 $ $ $ $ $ $ )  P&8 (@> ޚ"``   $$ $  *   $ $ $    >  c* $$$ $ $ $ $ c?$c㿘> #` "#$c0m> # " X Xɐ  TĐ $> ޲"@ $ $ $ $ $ $ $ $ $ 1  P&8 (%@> ޚ"``   $$ $  *   $ $ $    $ $ $   >  * $$$ $ $ $ $ $ $ $ c?$c㿘> #` "#$c0|> # " X XK  TF $> ޲"L $ ,$ ($ $$ $ $ $ $ $ $ $ $ :  P#&8 (.@> ޚ"``   $$ $  *   $ $ $    $ $ $ *   $ $$ ($ , ڠ >  * $$$ ,$ ($ $$ $ $ $ $ $ $ $ c?$c㿈0: `< h ?** 2  2 *   (* '耊`'#'?#?  @* () (`@ 3`2+.  @0@1 0`6 @ ''' @2   (   \   $ < X  H@ $@櫐, , @&@椒 +`+` &6:` 谆?&@&`&`&` &`&`&`&`&` `$`"  谆?&@&`&``  6  .  &@ ` β@㿈 ˜0 X,  T' ` "?  `< h ?+ / ?  ? /   (/ `$`''#'?#?@@@ @ * ((`. 3`2+.`  @0@0`66` @ ''' &@ + +  &>I @ ? ? *@`*@`*@`  薂"""" """"" $" 薂"""   ? ? *@`*@`*@` 2  , >7  * .* 1* ,* /* -* 0>74" 㿐 X  Tz ? ?  h < `<  `$` ''?  𔂿# 2 . ` PP&  `(`8!@ ` `*  ` @*`*   @ 2* *# 2 `   * $$ 㿘 8  ( $  >ޖ# ,  * 㿘 (  $ 8 ? ( ?   , ,  &  ( 㿘H/` /> c쀤     $ ( 2 H 0> c耠> U  "c> ކ #  "@   `##> 쀠"  22 㿘H/` /> c쀤 -`  $@2#`  @2   (@2  @z 2 H 0   ׀H 0?㿘H`  9 `,  H 0-?  " ,"  `0"   H 0?  " 0   * 4 &@2`?H 0㿘H` Z &@ &H 0 ?㿘H` =  ? ?>h * 2 2`H 0 @@(> W(:`6 `62?"(+?&'?6"? "`0 `0   **` ? ?㿘@``!"  , *:' *`     `@+  2` @#  2`@  ޠ `   㿘@``!"  * (:% *`     `  `   `ߔ   `    @ 0`2** ( ("@ @"`("`("`("``0 "@ @"``㿘*@ * \ *@  * Ȗ 㿘`?c `&`@ 24 > c  V` 2+  2 %  ?# 2  2   E" 4 @" 4  ?倢  `@ &` 㿈` >   c    &`D 0@   @h &`H &a,0 @h &a,&`H &a@   6>߀ >">># >`D@@  > @ &a@>  8 8  `P@X)>ߒh X#`2#> <`Da `* J`@`# #? > ]``?0&a04 &a48 &a8@&a<# Ô$`0>`4h `> Hc`@  a@@g* &`Px&`ha> X 0"$``"`" ">; #L? `a OW> X> X \`d>'''P'R~ A@"$ 4_@"% <@@?0#F@ C@B@ E@ J@  "" 0" 8" ""? > H 8  &?`@8 ?@ > a@ a4 a0(@a0@?㿘> #`!< @ D@ے0(`Њ@@ Ъ@@0!Њ@@ ?Ъ@@0Ho o`!, `  ` ` *`!, ` *`H 0 㿘!D  L&'&!  @ !D `$!D !D"!D 㿘`?# @`&`@(  > #` 0j> H# 0@f?@8 8@ 㿈`  &`D  > p>f  x>g > c 2 0> <! " J  20 0 &a 40&a$8 &a(&a  $ @fm&a,# @fg @&a0 @Ҕ   #k$> H#`@a  * @fR &`P%&`ha> X $ $``$ `>$ $ `0 gJ`4` >>>= !`I?> X> X `>'''P'Q* 㿘#A@"* 4#_@ ", <#@@?04#F.@ cB@"!0 #E$@ #J@""?cC@"!0?&!& 0& 8& &&@q @ 0? 㿘!4  L&'&> G0> G, !@ !4`$!4 !4"!4 > H  8  &?`@8 ?@ > a$ a (@a @?H`!,(H 㼘@``!"  *`=    @*  `"  @*  `$  @*  `` m 2` f  `_  㼘@`!"@ ? `C 28`  ; 20`3 ",&   @ 2 "   @ 2 $  2  !0*` 0 !0 @0!0 @2d㿘`?# @`&`@A  >@; "   > H#  S& 48@  㿈`    &`D    6>߀  >' >" > #` >>ߒ`@TՐL     >ߒ`@TȐL >>ߠ >ߢ @ >ߠ e} > ]0 `?  @df`d<a<`&a8>?+> H7> X9>;> X) ` 2&0 > X!Ȕ  > X @`" p ɔ  +@  $  (0 ` 0t&a,4&a08 &d<&a4&d@@^a8 $* "  @  $ s$  $ $  #$c  `@ * @c &`P&`ha@$ $` $ `$ $ `0d`4 >?>?И"?a K> Xtal>''P''N֖ 㿘#A@"* 4#_@ ", <#@@?0<#F6@ cB@!< #E,@ #J@"*?%cC@!<#? &!& 0& 8& &&w   2 @ ? 㿘$L  L&'&> G0> G, !@ $L`$$L $L"$L > H  8  &?`@8 ?@ >  a0 a,(@a,@?㿐!8!< #\H`!8 `(!8(H 㿘!8  "    !< `*!8 !G  !8(㿘`?c `&`@V 2 > #`2  2  m ?"    @ `@ &` 㿈` >` c&`D> c   > <! " J  0 0  @b &`H0`&a 4&a$8 a,&a($ 2 *a0 @ $$ $?$   #$> H# `@ * @bz &`PM&`ha> X!$ $`>$ ` $ $ `0cs`4` >A>A!r?> X> X"b$''>'P'MS 㿘#A@"* 4#_@ ", <#@@?0?#F9@ cB@!0 #E/@ #J@"-?(cC@!0&?#&!& 0& 8& &&  $ 2 !, Q ? 㿘$0  L&'&> G0> G, !@ $0`$$0 $0"$0 > H  8  &?`@8 ?@ > a$ a (@a @?㿐!, #\!0! 㿘tXXl㿘`?c `&`@ " >@a 2' > ! #`2 2 +7> H#  ,@ao?@ ?"   ` `@ &` 㿈` 0 &`D0 &a,4 &a08 &a4@aL&a8   @aE&a<  *@a?&a@ @a9&aD @a3 &aH  `* >A!0*` €`D@@  >! >ߠ!> #`2>>ߠ!   >ߒa0@QM>b!80>ߒb !P> c  > <!@`D   " J # #? 8a<> ]``?a<>Cax&dL&dP: dL@[ @ג0`$ 2 *aL @ $#˒ > H#  `@ * @` &`P&`h`>C">C>D>D>Ec\ &a&a&a &a&a@$a> X"x$ $`>$ `!X$ $ `0a`4  >C>Cܘ! ?a HJ> X> X"b''>'P'Kq 㿘#A@"* 4#_@ ", <#@@?0<#F6@ cB@!L #E,@ #J@"*?%cC@!L#? &!& 0& 8& &&  C 2 @y ? 㿘$\  L&'&> G0> G, !@ $\`$$\ $\"$\ @?? H`"" "  <`@"8" " > H  8  &?`@8 ?@ >  a0 a,(@a,@?㿐!8 #\!L$ H!@`!@ H 㿘!@ `0 02 ?#ߒ @`"!8!L !ɘ  !D`?""`㿘 \!D` @ @ 4"@  4"@G $ $窐 $祐$ $ $ $ $ $  *`3$  ̔$ $! `$  d($  4 `@$  d?$  `$  d$  4 `@$  d?$     㿘 m!D`j @@f D  4"@  4"@ R H   C  > $9$ $ $ $ $ $  *`3$  ̔$ $! `$  d(@$  `?$   d`$ ?$  `@$  d$  `?$   d`$ ?$     㿘 `O!D @@K D  4"@@    ݐ $ؐ$ $ $ $ $ $  *`?$  $ ? $! `< h $! d($) `@$)  d $@@ $) `?$)    㿘 `!D  @@ 4"@J$`$`$`$`$`$` *`??$` $`>$a < h@$a @2  ( "  $i$i ?$i $i(m$ d@$i `$i  d$a?$i 4 ` ?$i(` ` 㿘  !D $E  A $$$$$$$ *`$ U$$ d($ `@$  d$@@ $  ` @@ $  !@h( "h㿘`?c `&`@  2 > #`2  2  " ?"  5  E `@ &` 㿈`    &`D @]r0> c  &`H> <! " J  0 0 ? @]\&a,0`&a 4&a$8a0&a( $* "  @  $ s$  $ $   #F$> H&`h# `@ * @]+ &`Pa> X#$ $`>$ `!x$ $ `0^%`4`>F" ?% > X> X#,c4''>'P'H 㿘 #E@"O?#F@ "I?#H#@@ ?0@@;#A@" 48? cC@""!0  #G@*cB@!0(? #J!@!&!& 0& 8& &  Ԓ 2 !,  ? 㿘$0  L&'&!  @ $0 `$$0 $0"$0 > H  8  &?`@8 ?@ > a$ a (@a @?㿘2㿘``@   > #`   㿈` ?` &`D>ߒa@LJ@ 2>>ߒa@Lv>];!> ]`@8`?4>ߐ![@4D>ߐ![ >ߓ:`]#"(8  @\0 <"0    &e0&e4&e8&e<&e@&eD&eH&e,< &a @&a$D`D &a( $# > H`8 > H`@D*  4> H`<&`8* &`<&`@> H# `@< * @[Д &`P`0>`4"0\`8@e<`a,  @ "@ ` @  &`ha> X##`$`#``#`#``8  ?>H>H H > X> X#c''>'P'F 㿘#A@"+ 4#_@ "1 <#@@?0I#FC@ cB@"$ 8 #E9@ #J@"7?2cC@"  80? ,&& 0& 8& 8 @? a & & 2 !,@   2 !,@ 2 @ ? 㿘%L   L&'& 8   > G!0> G ,!@ %L!  @ %L  $%L%L"%L > H  8 &?`@8 2?@ (?> a$ a (a ?㿘 8 2%,%, A*@0 q*> Hc @   P@=* %8@ɒ!> &>H"01  8 A%,*> ><> > \` %,  A  @   *㿘@``!"  + )% *`     `@ޡ  2` @ޙ  2`@ޑ  ߠ `   㿘@``!"  , *& *`     `c  ` \  `U   .`   *`%<a, "@ `㿘*`!/* !.* !-* !,*  㿘``@u   `?㿈` ?# @&`D!>>ߠ"Xb`@J/Z>ߒbh@J(J@ ">>Z"p>ߪZ"x> ]`00&a,4&a08!&a4`?!  @Yǐ&a8" !@Y&a<# @Y$`D&a@`  $# 2`0`8 2`0`0&`8:`4 &`<&`@`0%`?&aL8> H# 8 @  @Y`8`&aDaL0 # 8 @ @Yo &aH@`8  @g `8 2aHaD&`P3&`ha> Y "$``"`""`8  >J ? Z  a  # R a A `0>`4`Z@">ߒb@IsJ@ >Z5"Z3bx> Y> Y`< D>'''P'D A@"* 4_@"+ <@@" 8)?F"@ C@B@ E@ J@  " "" 0" 8" ""? 㿘 8 W'!L !<."`\!< " X!8 "`p!8?"T!8 "`X!L !D@ !L' !<."`\!< " X!8!"`p!8"T!8" X!L !D@ԧ !L% !<*"`\!< %"`X!8?"p!8#"`T!8" X!L !H @ > &>J"0.ߒ > H 8 8&6?`@8 /?@ ,`8> a0a,(aL8@  a0a,(aL 0@  ?㿘!P  L&'&!  @ !P `$!P !P"!P @ @ *`@*`@`"#`*`!@ !@ !@` `(!@㿘 8  `ڐ0L'<. \< X8 " p8? T8 " X@?"@@"!@  @ <@> ><> > \㿘`?# @&`>@3"`?㿈`  &`DH0&a,L &a0P &a4@W8&a<D  @W<&a8a<> ] @ &d@ < `?  "    "    "X# > H`@ # * H@W~ &`P&`hQ> Ya `"`$``"``>"`"``0 `4"Xs`8?3a >ߐ!@Gba@**.a@  aC? ***? @Ԕ! @  >L>Lመ"XR?> Y> Y Ē`''>'P'B3 㿘#A@"+ 4#_@ "- <#@@?0=#F7@ cB@ !@ #E-@ #J@"+?&cC@!@$?  &!& 0& 8& &&Ӓ   2 @m ? 㿘$D   L&'& 8   > G!0> G ,!@ $D!  @ $D  $$D$D"$D > H  8 &?`@8 2?@ (?> a0 a,(a,?㿘*` !@* !A!B* * @ a<*`ᄐ #d@ᄅ*#d@ *`#d@ !@"@a< !#d@!#d@"#d@ @(""`㿘Ho o<`"@8" ߔ !<"a8@sH 0㿘>@֤b   `?㿀` ? c &`D >ߐ#U  0?",4"08"4     @V  &a@V*&a`">W#80>ߒc0@F6>V#P> ]``D`?   >ߒcX@F   $#`8 0<> H#  `@  * @Uɔ `8` &`P ``@  * @U &a@`a `$@ `2  "*aԐ @ }&`ha> Y! $ $`$ `$ $ `D  >N"&d&dd@PJ  >N>N Ԑ?=Sa>#h2 #\3``00`4`8V~#`> Y> YaL!T''>'P'@h 㿘#A@"+ 4#_@ "1 <#@@?0U#FO@ cB@"$ 8 #EE@ #J@"C?>cC@"  8<? 8&& 0& 8& 8 @? a,& *& 2( ! "   2 !Ԑ, 2 D @  !Ȑ P ? 㿘??#"h""8`@2 ??І @? * * @  #@?`> &>N"0x++  8> >> > @0 !? " <"\H!̀`d*@ {@! H > H  8 &&$?`@8 ?@ `8> @ (( #a0 a,(@a,@?㿐!Ȑ #\!Ԕ֚ 㿘$䀢   L&'& 8   > G!0> G ,!@ $!  @ $  $$$"$ 㿘! `0 02 ?#ߒ @`"!Ȑ!Ԕ !k  !h( "h㿘`?# @&`>@y# >@s#   `?㿈` > c&`D@D2J@ ">T#> ]``?H>ߐ#SY   @S֖ &a8<$ @SД &a<T>P&a,X&a0\e@&e@&a4&eD@Nz  @z $#ƒ > H# `@T * @S &`P`0>`4#T&`h` `0# @ u> Ya!" $``" ``" " `0"# ?>P >P>Pa\"a ;J> Y> Y!Ԓa>'''P'>q 㿘#A@"* 4#_@ ", <#@@?0<#F6@ cB@!@ #E,@ #J@"*?%cC@!@#? &!& 0& 8& &&@p  @ 2 @ ? 㿘%P  L&'&> G0> G, !@ %P`$%P %P"%P > H  8 &?`@8 2?@ (?> a0 a,(a,?㿘*`!C* !B* !A* !@* @s 㿘@``!"  + )% *`     `@Δ  2` @Ɣ  2`@־  ߠ `   㿘@``!"  , *& *`     `֐  ` ։  `ւ   .`   *`!<a@ "@ ``"!8!8 0  㿘!8` " `  "` ؔ! !8  㿘"DD > Y "b0 0> Y"0`     ?"D D@ 1:> "@2 23f#"@0㿘 #%"D D@""D D@?2"D㿘?# %#"D D @"ڳ"D D@?2"D㿘!̐ `  `1  " >   > ' > # #`2 -"D " - #`2 -"D    -#`2  "D "  "D> "H 2  %D # %"`㿘> #`!"D``D `l@ "D?"LD "` "D p@"D D@ @" "5㿘> #`"D !  `` ``0 Z0A0>㿘> #`2>"D ->ߒ R%#"DD@ ">>R !̒``2>>R 0>R  0!̒``>>R @ >Q X0> `Q 㿘``@W " "`r 88ޒ@ 㿘 >`x @!> ``? @>`?`@ 4`? "> Q0>Q &a&bH0  @P &b@  7> aab07> aab0 4 ``@  2 `P 2   H&aL>&a&a$P`@@Ȕ %6a耤 㜀   a   a @~?* @ @* >Oِ &a&a6a&bD& @&bL '8>~#&b,b$8 8b$ &> "@Э   <@    ` > "@Е ` @$ f>">>c8>P>P#>Q>Qb&a&a>Q&a&a>Q>Q a&a&a&a&a&a&av   # v vے #0#㜀 bD   #v  % v   v v 0  % v v %+F>` &b0bD ">P# &b0&b4@Jo G㿘``@ 2 4 6  2  4 ? 0. ?  㿘 L 4(@u d4(@ Lh@?Ȅ2h@h@(2h@ Lh@2h@㿘 L d,Z , L ( ( L(㿐`P􀠠"r>S>>S>S>S>(!Ԓa 0>#@&a&a&a&aȒ  &a&a&`H0@O: `H> b`&`L!?= > \"">N!8 `H9W &`D>N!@#> Hc`H  @sÓ2 c`D  @ "`H>N!P&`@a̟`D> ]!p&a &a 2 >Nx!p> ]8 !h  @ ?&aca`D &ac`H" K&a>S>S>!ha<>0"@&a&a&a&aȒ  &a&`H&aЖ(H@N̐&`Lh@?4  @ * " `H@N &`@&`DhD?! 4hDa* 4@ * 4ga`D€`H`D`H$|# &a&a&a&a&aO!0V@ `>O!0Kp >V!@>Z>T?`"$$$48$OXV!>!X9a> YbL*@ Oz  `0>T"&`0&`4@I 8 4 8>T"&`0&`4`0 8  >a0@ο ` @"$ 㿘>aȐ M  `@$ 㿘!!` ` L(@""!(D>(D (F!O- (Da4(D! ` @ @  `P``@``@` > O" `@& ! `` ` 㿘"! @.`!,` @ ; > Y−`?& -# $ 2` ( @ 2 +    2 +` *`*2(2`2* 2 @ @* 2@  & 4  4  4  4 #∐@ @ F&" *!*2 3 !  F #@+`3 +` 4 @㿘# b {b6 6 *    >N"(  4   @& +& > "H >  "` > "p  > "N` `&  > NV"  ` & & !Ԁ  " "* @&! ` 2`@ ?"@& & & @ P㾀!.`!''2"" 2?*`  2` @E &`@@ &@ؖ   #& 䀢 !> # "m$#    |'''Hǒ $# PU3㿘 ?"̨`"Ȣ&+>*@`@b L| @~0  `2 * @2@@ &*`@  2@ߐ  &㿐 8`@% 8ؐd6 8 |`*  2*` *@ H/2* <# 2Г*` 2 $* @ "@ '  耤 I   $$$ ?$ = *  e    @  *  2  %(  >"M0,2  @*+ *` 3  2`2`@ ?"@$$%`h d|`*  2*` *@ G2* <# 2Г*` 2 $* @ "@ ' +  ( ( +  3`+  3`+  3@( F#+ + 3`@ 0+  F#@+`3 +` 0@  $4㿐H /f * ' !ܒ !̟€! !̟€! !̟€, @$@' ,  * *,@ F`$ , 2 , 4` @ D"@ ' `,` `* `*!@!€B d @ !  @W `H p@  H 0 㿘H /f * '  >L7#  P ;6 '  @f` @& >#L" ` @ >#0L `6 @G H p@ "x!`' 4 !!@>Wc3> ` @q* 3 330@   㿘<%6`6`6@ F&@ *!*2`@ 26`  23@@ 2`3@!   ``$@@>#P`@>#hK 0` ?>@ #`>@ #K 0># K㿐!# !!̟€`! 3@#< &>I !,!,&*@ `"Д&  !&, "      6  , "    ?   6 ,  @s*   F" *2 * 4` ,   *`@   2 , "       6  , "    ?   6 ,  @1*   F" *2 * 4` ,   *`   2 , "     b & bb& b & &    2` @ $' `* `* `*    F ! " !bĚ&b̘?&*b&*bȗ2&  3 F&"@ *`2 *`! 2㿘6@#6`<#! 6` *` !Ȑ"`** ** 2`@ 6` F &@ **2! 3 ` >@ 2 > JW ( 㿘!< F#$ *`!*`2  4`4"4 4 !ؖ ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  ' > 2 F> J X0J!$ *`*`2  4`44 4 !Ȑ!    > > I x0*)!   `k F! " * @*!2 6 3` ߖ ! `ؔ !Ā`@ 㿘  ʖ 㿘 H /f * '  a@" 8a @"  8C a2@>a1@ ; (!1 6 8 ` L P̒0,@ #$! 8 @ @2 8 8 ?6 8  @00@S PS P`4@   H 0㿘!  &   +"  4   @6  "   "6 a P~  *@ *`@    &  2 &!ԁ㿐b'     *@@@>+ @  2*` @A   8?b G?"`* @ Ȓ ؀"" |#!"0||"||@ &`є  @ @  @  @   @  @  @   "& & @ @  @  @   @      "  2 &q    6q 8"   @  @  @  @   @  @   "  2A&E ה?    "& &`2  @ @  @  @   @  @       &   @ &  /??6$?H /f * ' > "X> &@H 0@`(+>  2`H /f * ' > ߔ 2H p@ @ "@@" @$"@2`@" @"` @  ?0?ܐ0P&` &` &`> ߦ#̶' 9ܑH /f * ' bX>$ H 0` 6`H /f * '  4H p@ `&`&@&`6`` &` (.` H /f * ' > #H= &`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` (8&`  2 &` > #D @ 8&` ` &`&` ` $@&ȶ U   ` ,`  2 *` ` !"" `@@ȟ@& / @`ȟ@& `@@ȟ@& `2@ `2@$*` ?c 2@ $ T TTTTTTTTTTTTTTTTT ,8DP\htTTTTTTTTTTTTTTTTTTTTTTTTTTTTT(4@LTTTTTTTTTTTTTTTTTTTTXdp|TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT $0T<HTTTTTTTT̝㿘 <""> >D  c"l H 0"& 0 0 & 0㿘`> "#""(`?*   *  `>^`aX@t > Ep`+ `6"@`4`>E` `>`F `6 *2EU4``  64` F4` 3,` / ̢,`4`Ґ"$ (㿘``@ģ 2# 2   ɾ` ?  .` ` Ѐ` "@ ? $  `    x  0@D & &`X> < *` &`l>!(E&`p `h"??`x  @q#&`|&`x@#`x &`|&L ]  &`t>CY!0@ے&L`` =  `x+ `t "@ ( `x  `4 *`x @ *``x`s * $`x .a2&`.a3.a4.a7.a6.a5&`&` 0#\#`    @ `2`x>D!@0ѓ,` S,,`* `t* @` " >!>@ O!hD>D!pa5 ` .a5%a5a2`.a2 `, `t" a2`%a20> ! Dta5 ` .a5%za5a2,`.a2 , * `t* @"`a2 2#`%ga2#`#\    @" `2a5 ? `.a5%Qa5,`@*``t@*`a2  .a2 , `t " a2`%;a2 !>!Ȣ`@ ݐD"0G>d#&`0&`4`0 R >`@0גa  "@p 8 0 ?耦'?2 '`@2' @. 'a8 - ``'@p" @. >jc̐*>  **@ `    㿐`0@ > Y"`&`&`X  6`6`&` \&` * "`2%`ȑH /d4`Ɛ* %`ƀ  !>`ƒ ! "ǘ  `ƀ ``>"C``Ȑ 6`#\#`   @V   ! !5? `.!5$!5, @*` t@*`!2 .!2 +  t " !2``B$m!2`B`>CX"6`!>"0>CM"H`Ȑ#\#`   @  2!5  ? `.!5$E!5, @*` t@*`!2 .!2 +  t " !2``$.!2`!>"``Ȑ#\#`   @  ,  x  2!5  ? `.!5$ !5, @*` t@*`!2 .!2 +  t " !2``#!2`!>z" 6`6`6`.`.`Ր<#6`Ζ``  }2 2 ? `Ȑ#\#`   @  2!5  ? `.!5#ǐ!5, @*` t@*`!2 .!2 +  t " !2``#!2`!>5"`Ȓ #` #\ @d  2!5  ? `.!5#!5, @*` t@*`!2 .!2 +  t " !2``#|!2` !>"آ`@ Bb6`Ɛ`000.`ϐ  `>`И BN#``ɤ`Ԓɡ &`̒"`>`Օ: #\B:# `Ȑ#\#`   @  2!5  ? `.!5#2!5, @*` t@*`!2 .!2 +  t " !2``#!2`!>F#X`ή ``Ԡ`ՠ?XUQ`Ȓ #\#` @  2!5  ? `.!5"!5, @*` t@*`!2 .!2 +  t " !2``"֐!2` !>#@ yAO6`?#   2 " `̀@ ~`ԑ2  `Հ  ~  } ~>#AH 00)`_"  @,D  > @ ` @"$ @p:6`  "w`ƑH 0? 0 > Y Б2 * " ` `` ( ("` ( ("`` `"`㿘?2  > Y 6   Б* >#В`A(a 㿘? 2  @> Y 2@  Б,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * %  ű"H 0e  ť!_  & *`` &!  @pG M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @p& , ƀ ,` 4 ?`4# @ `*  *  >d ` @pJ$   @ $  !:  @1㿀?2  > Y 6  6M Б*@"G ƀ  Ȣ'  @l" ?'z@l"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>d>j  p  㿘>d>j  p  㿘?2  @> Y" 2 60?"Б*@    *@2   r " ?,` `?( &2` 2  d ?㿀 D? @2 > Y `@"2` "Б*@   T &   (@ <  u& 4ƀ  Ȣ'  @l#" ?'@lA"ƀ  "  < D  " < O& 4 O @oX $H c > ` .` 0t.` 0r 02 .`  o.`  `Ր?.``.` .`  `А?6`   `Ԑ?.` 0Y 02 .`  o.` .` .`  .`  .` "6` .` .`0B` .`  ``0   o` `  .` &6`   2 6` .` ` .`  (@.`  @ @.`  @ Դ6`  (@`  &` $@`*   = .`㿘` \ 02r !2 = @q  2g !2 1 `!2  ` 2!5!>!2 # 4 2Q !2 !2!5 (!2!>!5   " 2? !5 !5!2  `א ` ` ><  .!2 J@  ,`*  t* @@ 2$><  8("(& (?"D \ 2`  2 * D T`*    H @i< 2#<> =n H!2,`.!2 , *  t* @"`!2  i!2 &$($&(( "@%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   A+p`0@  㿘.` X*  t * `1P2!7k !* !7 @I !4.!7`  .!40=>0O>0 `@2Q #> `h %  @ @ C ;d p * X2 *` X2 * X2 *` X =*  X * !3  .!30>0 P>  `@2 #> `h   @ @   @ ;% 㿘!4 @ X B B  aĂ ?  B   `  ? @ ? ``?  @ 2!4- @!3 8!4" @P !4 !3 .`*  t* @`!2 "    "!2x x    x@<  x @@  *@ x =  `ː ` * | X*  X2`* X2`*  X2`* X*  X*`   X ? $  x X `  x @ "% X `!> @Ģ <  X *`  X ` "@ݐ ?  X ` 4 x>:b Ȑ *`  x 㿘!2` > ;ޒ  X *`  X ` "@ò ` X `` ? u   t` ``0` `2j !3?.!3"V!6&` x/   + 2`*`  +  t  `` 8`0`"`0G "2!5C  "`4`00("0`$`0*` " @`0`,<@hH t@`0`@ 0<)ђ"@ `0!2 `.!2 `*  t" !2`2 r!2 n!5 .!5` `@ &` ?  .!6!*@ !4 .!4   4@( `2 !4!2 "!4K!2!4!3!2 !5  ` >  ;.  >• >! ;% >;"!H㿘`)!4 % X ` #>!6!J@ @A !4.!6.!4۔ P "9saX !4  X `"!6㿘 X ` @ ` !> !h@: ? >!:֒>9F! `  *`     t  Đ @-  x @ !3?.!3 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @ 4`   @  @ ,`  ` a >"@,`  (@$`!6 ?  `.!6!*@!4.!4. J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $*` $`@$`@ ,`H@g`<`< `@ 0(" !2 `.!2 `*  t" !2`#!2g  @$ !5`.!5  @$ !5`.!5 4 5`4 㿘 > `!`  9  0  D> `!9`a@  @  @>  a>!>!`  ` ` 9@~9ĐaȀ !> @u!9 >  2>> 9">9"8㿘` ``?` ?`@&`!5 .!5`?&`!5?.!5? X` V `$ + ` `("  @ &`$&` &`(``   @ զ@@ Ԡ@@k'?- ` &`  `.2 *  `@.2  .6```̐ ?6 ` Ԡ" @͐. `@w . !6 0?. `  `` 7 `&`@2( ``4$ `&` .2`*`  .2  .&`!6 ? .!6 !* !4`.!4  0  H /d4 * % !4!3!!2 !5  H 0@ Zؒ #\> 8Ґ"@@Œ >8ː"`!87> ?)>  8" - ?>8"`)>  @8" @- @ޒ ? >8"8  %>  2  x,  @@ @2 t   3 #\0#`8  `40 !87> >! 8{ H /d * %    t `  @" ?` ?"`  t@ ` " ?4` > 8S" ? h H 0*^@ 㿈 ` {'>]!0*` €     Q Ұ  Α* R  ǰ     `ְ 6?`!?>] *` € ` @: `Հ   * @ %6   @ `Հ 2   0  @ `Հ y  2s   @dJ ``   @db0X `H /d * % `Ȑ #`_#\`,`0 *  t* @ `. t . !5? `,!5!5 !2 `,!2 `*  t"  !2`2r!2   uH 0 @d  >]X* >">#>#(>#H>#`>#x>#>#>#>#>#> > >| 0>y H>v h>s >p >m >j >g!>d! >a!@>^!X>[!h>X!>U!>R!>O!>L!>I!>F!>C">@" >="0>:"H>7"`>4"x>1">.">+">(">%">"#>#8>#h>#>#>#> >  >  @> P> x> 㿘\ `& & 0& & & & & $& (& & & & ,$P0<HT`PPlPPxPPPP ,8PPPDPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 㿘 <""> >3 c"W H 0"& 0 0 & 0㿘`> "#""(`?*   *  `>n`a@dq > 5[`+ `6"@`4`>5K `>`F `6 *25@4``  64` F4` 3,` / ,`4`֐"$ (㿘``@ 2 2    ? А@ib@ @  p  0@3 & &`X> < *` &`d>!4&`h&` ``"??  H@a #?ܒ H @  'ؒ  @au H H@aؐ H  @>! 4Ӓ`0@ƒ H&`t&`p  8  &`l>34!H@ `   +  `p `l@ " `p`4  * `p @  *@ `p  * `p@ ` *``p  @*`p@ `  *`ڑ+ `l&``p`h 0&`x&`| 0 #\#`   @ `| `2  `x " `x !>!X@ 4j>4g!`0n>4c!``">>4\!>4Y!" `X!>!`@ Ր4M0T ` >s>`4D!>4A!>4>"(0E#p&`0&`4`0o >`@ bP " @` 8''쀦'?2 '`@2' @ې '`  ``'@`Ē" @ǐ >xb>  *@ `    㿐`0@ޒ > Y#@`&`&`X  a&a6`6`&`&a&a* *  l * @&` \&` * "`$ H /d4`Ɛ* %`ƀ  !>`ƒ "X ٘ :`ƀ ``>"h3``Ƞ 6`#\#`   @   x "  x``>3"x76`"!>"8>3|"<#a\a^6`6`6`6`.`.`ِ  }2 2 ? &`̐ &``̀  `#` #\ @  2` x " ` x`2`̀` !>"`@3C6``>3="`0! .`  `>`Ԧ 3,#```ؒ &`ؒ"`>`ٕ: #\#3> + @`Ԁ``ـ" `̀@2  ـ PԀ@P ؀ P `2>1g#x  ݑ+  E,`2?><`Ș@#\#`  @>  x "  x`!>)#`Ҭ ``٠`ؠ? `Ȕ #\#`@   x"` x`` !>#@'2O6`?#   2 " `Ѐ@ ~`ؑ2  `ـ  ~  } ~>#2uH 00)aT@"  @%  > @’ ` @"$ @a6`  X`ƑH 0? 0 > Y ,2 * " ` `` ( ("` ( ("`` `"`㿘?2  > Y, 6   ,* > `2 a 㿘? 2  @> Y, 2@  ,,`@  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@t 0}| H /d4 * % !T"H 0e  !_  & *`` &!  @a( M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @a , ƀ ,` 4 ?`4# @ `*  *  >s a` @a+$   @ $  !:m @J㿀?2  > Y, 6  6M ,*@"G ƀ  Ȣ'  @]" ?'=@]ߒ"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>s>j!` p 㿘>s>j!` p ޖ 㿘?2  @> Y#, 2 60?#,*@    *@2   r " ?,` `?( 2` 2  d ?㿀 D? @2 > Y `@#,2` #,*@   T &   (@ <  K& 4ƀ  Ȣ'  @]" ?'@]""ƀ  "  < D  " < %& 4 % @`9 $ (   ` *  `"@> 0$ /| . \   $ $ $ $ $$ ($ $ ,$ $ $ $ V$ 0@G 㿘`܀>-ǐ HD T`*    H @[< 2<> /= `! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   Z`0 㿘 X  5P v " @0T>0&>0# `2g`1>   % @ `  Y` А @b@ >>-[  . -T @F 2  X#P"< >-F @* X2 *` X2 * X2 *@ X * "@0>0P> `2`1>    ՘ @ `   `@d-!㿘 @ ` lx 0 ` p 3`"h`"  & @ ` *`>@ @ &   ?, *@ l*`  !  p*  ,` "@ `  *" @@ ` *2    ` @| Ѡ` @㿘@ `4  XBa     ? @ '   ?  @ 2@ @@ ` 2@@@ `" X`@ 㿀 | є  | @ *  2`  *   `*` ߐ * | ` *` |   * |`   `@* | X *` X2 * X2 *` X2 * X*`  X ? $ | X ` $ | | `" X |!> ` @/!(- X b@ 2 |>,!@ *` |n 㿘` >!P-  X ْb@  ?      l` ``0` `2J4"E4&` p  *  2`  *` `` -`0`"`0-4"'`)4 "`4`00("0`$`0*` " @`0`,<@ZH`0` $"a l0@ 0<"@ `0&`:` ? @&`4`? 4@ 㿘`  \, @" "   `2    ,  P㿘 X `  >,!` ? [ >!x,>+W! ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @` 4 ` @` `@ , ` ` a >"@, `(2 `4 4 9 ` ` "+ ?`0`- ( ?)  `0 0 ($ 4$ 0`$*` $ @$ @`, H@Y <` $"a` < 0 @" $`   @$` A  @$`  - @`2V` 㿘 > `!`  ,  0  D> `!, `a`  `  `>  a>!>!` ``+@t+a !> @k!+ >  2>> +ڐ">+א!㿘`@``` ?`@&`` ?1&` R` P  `$ + ` `("  @ &`$&` &`(`` !T @- ٦@(@ ؠ@ѐ@]T?' ` &`  `. 2  `@. .6 ```А ?6` ؠ" @.`@ .0'`  ``` A ``&``@ `` `&` .2 `@ . .&`㿘 H /d * %     l `  @" ` ?"`  l@ ` " 4  > +"( ?  H 0>  *&@ 㿈  ' 6  0{&  v r  j  0d b  ^*  Z  T   @W_ `   @Wz0= H /d * % Ȑ #` #\ 2 x   . x . x"   x  H 0@W= [>m* >U"@>R"X>O"h>L">I">F">C">@">=">:#>7# >4#8>1#`>.#>+#>(#>%#>"#>#> > > 0> @> P>  `>  > > >  "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘``@# 2E > #`2@  ?2 &   24 >@ `Ȁ 2- > `2 & >@`Ѐ 2 > `2    ?2` >@`Ȁ 2    (?  㿘` `   2> Y> Y#P#L&e   (@(U ,> Y> Y> > >{>|>|cl#X #`T  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'>>|>|>}e"Lb&`&`&`&`>|>|"b,&`&`>}>}>~>}>}!#\c| D&`&`&`&`&`&`'} e &` &`e  ` &` &`&et!@&e e  &e>'a!`0  e" &et>{"&e&ex&e|  "    ex@"   ex   !@&e >(Đ! e>>!0@(`> Y#D`>!X(> Y#H `>@ @r6`>Đ!4 >@ > ?  `@2 @S >l  @J 㿘 Y#D`>(x!x@Zv& <㿘% %t  `` "> (^! >@ (W!` #  & ! # {  >(C!> YcD @Z<㿘> Y#D`%t>(1!%``2" t 4  4  4 4 4 4 4 %4 4  t $ $ $  $   $  t 㿘  >&r!% ? `  >'" 034%>"@&]   @  `>&N"X &  $ $ $ /@   &   @TS  $  > '"x&$ 㿘 ` 2 >&&" ">& "Ȁ " $`   @U $$ $` 㿘  '%t0#cP+> Yr d% `` cD> '"`$cD >#'v㿘@%t  4 %t? 0%t?`#2``#2``2`` 2`2`2` 2` 2`2` 2`㿘 `  %t>#8%> Y #D `&%>#X'0 ? @4   4 `    4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  "  >&#@X   d*@ t \ *@ `  * l d * t \ @* `  * t*@  4  #D` & >&Ԑ#㿘   %t>&Ɛ#0 ?& `?# @4``" `>&# ", `u&  o``%  & '> YD "> &4  >& @ `O& $ >$ X"@D& & > x&x :` 5> &l `` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   㿘 `  %t>#8$}> Y #D `&%>#X%     ?%   cD  > % <$ % $% `` d*  > %̒  t  @ \* `  * l d *@` K >!%  t \ *@ `  * t*@  %  cD` & >%#㿘   ` `%t>%#0 &   ?$  @ "  >%{! @ ", `;&  W)> Y#D  $@ > x%e4  >%_!@ `C& $ >#Ȑ X"& &  5 `   "> Y)c&> Y ?2 + 2+` > Y @ 2`+`Ԑ " > Y2`+ 2 +`ؒ` " > Y2 +ܒ`"c "c$ $  ` * \*@#D > x% 㿘`` @h >@b! >@\" >@V" >@P" ` `2  > H#  e& 48@  㿘4` >$ʐ"00>$Ɛ"P> Y&bd&bh&bl&bp &bt&bx&b|&b&b &b$&b(&b 2&b\80 @# &b\>&b` @bX ! А@b@6b8 *> <@%> @@ >>"h@ " >" @ޒ " >"p@ג "  >"@В 2> >@Ȑ! >@" 2`&b` @bha &`&`.` &`@B >b "$bd6b&bL6bbL 6b6b6b@&bP`? 0 &`c`  &`&`H /d * % `  &`&`H 0 ``&`a=2   "``?`Z&``&`H 0 0P  `ؐ` 0`   ̐a=2   `䪐`?`1&``&`H 0 0' >"h  @ ߅a=2   `䈐` @~ `?` &``&`H 0 㿐V">"\` ?` 7  x78    ` `7 7`  6@*` 6"* "\: * 6 2` "R ` "\2` "P ` "\ 0 㿘!t 2E   * Ò &!h@E  * 㹒 @;&"! 㰔  &!l> #"@O &!t> "! 㚔  &!p>  "@O &!x > ## 㿘!B`$* `!l ` d6> #  `  @O 2&`,f e` "?* `"`>#0!]  /  !l `2* @ 6> "ِ#X㜀` ` @P2`$ &`,< f "?* "`h   @`6   @6&$@&  ,`,@`$ `$` `$`,`,`,@,``$ &$& 6..  g. ...k @㿘`(>!H`$`(` " .2 "?@2"@>#x  > #` `$@O` 㿐!B >#\ 2 # ? > \> #b䀢 b \4  * * " > Zc* @㿐> >#\!> \"䀢 $"    6 : 6  * * > Z" c* `@㿘> Z (` > >c\    c\0c\ > Z *` * " *   㿘> Z ( > >c\ "l  c\lc\ 2  3  * * > Z" c* ` @  㿘  b@1> Z (     2)& (&  ( > >c\ "l  c\lc\ 2  0 * * > Z" c* `@@㿘> Z (` > >c\  c\  2 c\ c\ P'㿘> Z (` > >c\     c\0c\> Z *` * " * `$@ @ `(  €㿘> >#\` ``@㿘!> >#\   € #\  €㿘> >#\ !> Z ,?$ , ,  €  , $ ,㿘> >#\        (<d,`XdpX `!,: ``> > l*` €> #:`2> Z># P> Z  p' Z(`` % > > ! 4> `0  4> P' ? ;N&`> p X >Ȑ  @B'> Z> Z P`p,``@2`>2` ??̀ > '@- " `  >0>0 ?*  '  `'   ` ``@Ǒ,`&`㿈@>6`  J6``86`  ` ?`< @ & 4& > , €, @,@  ,@ * - %@  %` @@א @ ,@ @ ,@ 0`& 0@i @ ,@ݔ@\ @Ք ,@Д@vO @Ȕ ,@Ö@   @ ,@@    `  p. %`W "S%``O  @@ ,@`6` 6` 6`  @ @i ` >  @ > Z 0J p. @ %` *`@%`- `%@ * ` %@ * %@ *`%@  㿘  ,@,``2   @@] ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @l``9$`?  @    @  b #   `?$`$@  @>` `"  $`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@n   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @x&  㿘?.@6`2 `*  ?  & & & & @a&  `2  2&  & & &  ?& & & & &  㿘?.@*626`@.g<  & & & & @0&  g 2&  & & &  ?|& & & & &  㿘?#@#6*@6/ 6`..7 @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` >0 >0=Ks   2 &@` 2&@  &`& ?&@㿘````) `+` (`1 36`@20```0+"`"` "  ` `'`  '``2'` @ @@'`'`'`'` '`'`'`'`  0    `?㿘@ ` "`` 4` r"@@ؐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2>D 8 @`@"` ` & u "11 #`,`1?*@㿘@`* @X >M'@2`&J  ="@@C  `@2 @ 5&  @& ! @( <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ 㿘 >>& &&x&4 㿘   ,@ ,    2 @   " 2  $          `   *`2` (`) 30` @ 1 @@A*`   *`2` (`) 30` @ 1 @@A*`    *`2` (`) 30` @ 1 @@A*` *`2` (`) 30` @ 1 @@A(*`#*`2` (`) 30` @ 1 `$ $ $ $ $ $ $ 㿘 `   `@Q       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! 㿘`  & >  `r     >!! ! ! ! ! 1 `_  @   `?@   `$`  ` "2@+(@*@0@(0  3! ! ! ! ! 㿘`      8"  @ 0`  6` (@+32*@@(` .   132+*@)"@"""""?   LL     WhWhW$WWhWh㿘> #` >`@ `?! `>~!H    9F (fɀ  ( 4("@`> c ) !> \"@K!> Z > ("b$ H,$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`>А!"@>@&!x!> $ H@  \ d@$ `@J^9 v >@Đ!P  !>@;@v!` 2>!p@U!` 2>v!  >p!$?>k" )>'>#?P,  p҂@` ` HY@`? @ ,  p҂@` ` `>E"@?p ?p ">@r"ؔ  @@$"蔒 2>."@"耢 2>&# > [?* > ["#D"cP  > b ,=@?P` ?P*㿘!> \#@!> "` `@ @@ " @ L -~#> V ` @cL /<c'> ] L @`  L` @ / 2*@*@L @? ے`L , : Ӓ`L :  L?$` $`  $L /ˠ c@,@" @ ` .L - #>  L c"bx d a"bx4bx  L sbx  $bx $bx$$bx@I L $bx㿀> #`>#P0N`' (''p`J@ ,#`hJ@ ,#``# N@ x>@N` d2>>#`> ]&#`#h> ]&#h  . ?& & & `" N`>cp@D?& & &  $N@>N` cxϐ@2& & & .  i l&`sN` e"`s>##> ]&# ?. a& & &  $aN`>N@ cx@a& & `& $aN` d t r> ">  >U 7 2P>>#h> ]&#h ?. >& & & #`" 6#>#> ]&# ?. >& & & #`" 6#  . &  & & "! >#> ]&# ?. !>& & & ##! && & & #!   >t#> Z `LJ 1 :  : N`>N@cx@& & & |  f@N` d`l>#> ]6# . ! & & & e#!`l#`sN` e`s>#> ]&# ?. >& & & cؐ " 6c `. & `& & A"?N` d t r7>#> ]&# ?. !>& & & ##! && & & #!N` r  >c N@>cx@& &  & $㿘>c#N`>%>#>!> 2  T `O ``aI  N 2 >A > ߀  㿘> #`,> "`'> \b@a ">@O  >  `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘#> Z` !> > P  $` . @㿘#> Z` !> > ` $ $` $. @@ > ]>" > "xd> #V> #+> ߀`)>->/> [1> > !$` `=> >"!<`/`$` *> @$ @`$``$R > > <!(`H*: * @*` " R    2`2 > p' > Hc' '> [ "c> 㜀  @>@`>@ƒ`Ѐ > ̒ b@zb#p x"@'\' 2>!  㜀  H o@@A@a%TH/ / X@(0@8H 0㿘>! 㿘#@> > Ha8#@4@7#耢  #@(' .,㿘`> !@ 4  0>逢`!P>!`>!hސ  㿘> ߰ x 2 & x@- 2& x>@!p㿘 " !>!@@' @ ! 㾘@!>a@!?> @e  @Ӑ>@a " @ݒ  >>! ]  >>!} & &@$ &  ,K>b @t ? &   >>"^ <  & (>bH@[ @?"  >>"PG <  &!0>>  , # 2? " ? @ bx- 㿘`@`?P> #` > !> ]>cB! >>@Ea!> ]@!>#!㜀 8 @!D!>> Ц'  @!D> \>#c'''ܖ >Q#>" "''ʖ  2'0>>#"㜀 )@ 9> \-> 1>77> \> Р)>'> @@  @!D'''' @   9> \-> 1>7> \@!D> >''''} ` `LJ`>> ]" c@ > ]"`@# &>ڐ #'L &)>'>  TŐ'  > 2L `Q'>㜀 >> @  @a>@`Ѐ 8>a@W @~ 2 &Z >`8@n>`@@j > Z` "``  H 0+' @F 㜁㿈> #`$ "<  "<@ >"8> ''' H=> H# ' 'B耢 26#? )>@#` >c > h@ #>`@?>@ϒ`@ >   b@є 8> #`>0 > Z $> Z $$ o r > "  " & 4%>ꀦ !`0$" > Ő M O> $$  @ > =`>!7 Ȳ Z@>fc( >!(>0>!P>!  )`@@’   >  $$   >r!`!㿘> #`>! > "` €> 0!Вؘ 㿘> "`€㿘> ߠ Xʖ ?" ,㿈  㿘> "`€㿘> "@€㿘 >!>!`ː@  ݐ >>!!'>%>@ #> @; @֒ᨀ  @ϒ ƒ 2 ے 㿘!> "` >N" `@ "@ 㿘> "`€8@ 㿘> "  8 |@R |€0@0> "` `  @ >bH; >b3&@&  @  㿘> c? >  x"@ t@㿘> c? >  x"@`d€>J"Н㿘> "`l€㿘> n % > Z> H!c *`" * `@?" ` `@$`$ ` : * $  ?2 @ ~㿘> Z  Ĥ @@Đ@ ``?> ZĆ     㿘@%  >p#> b >5>3>  (b  2 c8[   2>T 㿘`A   ,`: ?.2&> " -?#3>  @  2   c@*   `*` @*@ & 2  @{  Ԑ?  2,㿘  w  2> s#P@ $ $ > ]`` $" $ "`> ]!?'p> \*#@   > n % ? 2  @2!>#px2` `D   > 4#x 'p1> n)> n?> n `> x "xx ">#>>ꀢ`#  a  >#x@  @@ t?L *  ,  t    > 1> n G)> n#> p @ :?8'pPc >`#  bDBc@’ ߒݐ`>!x*` €?'pt? @2  `@?`v# @* ` * 'ptp%&  >% 21p "? ,`# ** ? 2`   2 *+  > n'p%" > n?'p "`p> n"   O> ]>#Д`a ےH> ]  >>"H> >%M"bd? 2  >c2 >% #Д`a2 ? #05@02 > ]2 2? 2`  2 @2 % "? ` & `  2ओ2` `  @ 㿘 '>Q "+  @   #@ @"   #  @ @ U, > ? L0Ҥ H0>뀤 >> ? 0Ő  ;,x> ">a8 Z@T@Q >  ( @@```@w 2`㿐㿘> #<x> ]"!,@>   > ] "a( Т@ Њ@@ Ъ@@ >"> ސ P㿘> > Hc?* > ]> ]"a,"( Ԃ Ң  Ң Ң> >" P "㿘!> @8 Ģ @4 ܖ*> H#* > ]"!,> ]"( ւ   Ң  Ԣ   Ң  Ԣ Ң>T "`"  pК@ `к@>  ""> s P㿘>   @> H#?*@ > ]> ]> b"!,"("`!#> @   ֢A@ ֢AЂA   @U :>! `!$ >` "`>  `   9`P㿘!> @ Ģ @ ܖ*> H#* > ]"!,> ]"( ԂԢ>`Ā` > @ 6>ТA@ @ > ܀  @   آA@ آAЂA    >"` P㿘> > H#> ]*@ > ]"!,"( ւ  > @6 آA@ آAЂA    ֢ >"` ɐP㿘%>@F@B*> H#* > ]"!,> ]"( Ԃ̘ !> @ 6>ТA@ @> ܄  @   ֢A@ ֢AЂA    Ģ&҂@@" >   >"` | P> ]0 >ਆ  > Hcࠅ: c Т0 ࠅ8 ଐ Т> ]a0`> 㜄"`* * 8>8  Ģ@@ > ]0> 㜄"* *`* 8*`>਀> Hcࠅ: c Т0 ࠅ8 ଐ Т> ]0>ਆ 0` Ģ0 > H఑:? ଆ Ƣ?㿘#>a ='> H> ]0 `2 @_"@`  . #㘒 Ң0`" .@ ` Ң0c  2 `6 6 z `?07> ]>!0ఖ  ࠄଓ:@  "  Ģ` > ]a0`> 㜄"`* * 8>8  ĢB@@ > ]0> 㜄"* *`* 8*`>8  ĢB @ > H> ]>`0:`? "0 Ģ? 㿘㿘> Hc  > ] !0  #>`c2@# @`.$.@ "` ԢB@0c  2 `?6 6  `?0c  2 `u6 0^  Ơ  Ơ Р㿘M>>ࠇ8   > 2>83 o ??  Ģ> `2`  ? @0 `( > `2`  ? @0 ` `?> `*  > `2`6?|> `(? @ `2 ?@ (@* @?> Z܇2`?0 @ `2 ?@  (@* @> ` *"?{*?㿘@2  ?`" ` @&&` <* & 2` 㿀`J   2` 2`> ` ?c  @` T 2  ' 4`H*   '* ?@ #  2` *`: '2`  ` '쀢 4`H*   '* ?@    4   '>! >G ȀW!0`2 !0 * ='* 8$  2  ' 4`H*   '* ?@  `` 2    $  4`H*   $ * ?@   m`  a`  W"7 *  6 7?7y E`2 !0 | "2    * !0"@~!0002   * *  " `H  U ` 2    * *   " `H  :  㿈 *  2 2  2| <2   ' 4`H*   '* ?@  ` 2` *`: '2` `  '쀢 4`H*   '* ?@   `7 2  ?`; *> H€( % U  2   * *  " `H   `  㿘    `? @ &@6   . ??'  $(,048< ?ݶ@        6 .  `2j ?6 . ?6 8&㿘 > >  Ϛa0> > H"  > `   "`>2!@H > ""㿘> ]aD 9 L!D /!DH > bD"bDH 0 ,!D @Y@m)9Y!Dw!DJ` S*` 㿐!>!8''€ 2  H>>  L!Xd3  H  ?p>>!Z>ʐ" 㿈">"(*>"P &`H > `:  >"x  > > #`6> cȑ. 㜐!`>"!\>"!" : ?.) 2   @2  (R@"> ` ?) .   >(R#\#`#d"f> `. #@@  2 "&` H 0 x> cȑ. !6` cH > `:  >> `#.  >"2> #`2>">"!\!" : # )@ 2   @2  (R"  ?) .   >(R#\#`#d#   q8  '''  N@+   `H 0㿘H /: @  H 0.  㿘!  `2 >ʐ#X> ⨐ * > ߒb+ "⨐ & & " "@㿘! > ⨛2 8 2 >#h> b"  +` "&   * ( ⨁㿀 ?H@ٖ > c ?H?L >  X> >"c@#> H> ]!Lc >* #@֐ > :p@ *@   >T#@ǐ""> a>K# > :*p > ߖ * #` #\cȖ ?e? ">3#> a'` @~?@@ :@   > a"`> a  @~,@ג'쀤3> ].5> ]`ȑ,㘀@    )> b'>#\     V 2 4   ,㘠@ *> :`p#\ 뮚 > > `"c??&aH?0 &P> b  > a`" > P PaHH" aH@P> p> #\   > ] "aT> > )*@ > a!>}  p㿘>  > * "@44>  "!*` > "!Б**  > > "aȑ* >    > " O > aX ?aX`> ` "!` > "!*+` > +  "!*@  > a*`"@ > "!*`   > a > ](L@}Q d$> a`   &  &    &   ̓*`#3@( $3&  > Hc* @}0@@}*$ > * &. . "b㿘!( !," !(`@ې " ?   ? !4   $`!4 ?&!4!0  `#>a|$aŝ *&!0@~b P$a$= #$H$$$$,&㿘`     -03> a`ܽ` `   > <fb0> #А> "$,  `H @` *@   $  'H'L> j?Pat   'P'L'T'X'\'`` 'd`*'h@'l`'p`0't @   0'L'Dx6D?@+Z H ?8   , *@$$``$`H$`$`㿘@+5  @`23  犔 ", ` ` !,$ `< @ * #` # `# `# `# 0`# H@  $a  a ?"a `?" @&!?㿘>  T`' Qx> ""x> a > b > ""bW"(>!h!H/` /!> &@e> &"0 ` " >>O!8+@{J>H!X>E!xO>@!  > ߒ s*`  @ d*@  -**@ *B㿘> n "2 > Z* "@*` `@ @'> Hc> ]L *@  * $ $> a> a"`$" >   㿘> c@> n`?> a `%> a$ > n ? 2 2 > ` ِ!> n`> Z2  *"@ *`` >Ȑ!Ȁ?> n>!0ਔ`2` `*`" * $>!@&ː@&> Hc`>* > ]b> a? H#$`F`` > H#< >!? /#-> 7>5> b"@ 8> H㘐  z4@ @C> n਒@@@`2 4  ڨ `>#<-` €>P"0>L"0>H"00 >D"@0 >@"P0>"`;㿈>1"p>."`'> H%> 0 <  $ ( ,#\ 4#` 8#d 8#h 8  4@ 4 @ " 0㿘>  > H?x" c`8 `>n" @ ? ">c#  > @ @  *@ . 3> b`,` &㿘@ZW  㿈> "`">>`4#!> H#(!> H# > #8 #>   #\>#x > *@ #  * @> 0c <  $ ( ,#\ 4#` 8#d 8#h 8 2>#㿘N@  t>0``>0>#>m 0 j 0 0d 0㿘> #`>Z H H/` /> b`2a(>  X` $` H p@` * ( 22$  *@ `   `" *`0*@2@  `  *@㿘!,Ӕ P 㿘!0> a T ǔ! 㿘!,!<@ P*@<!, " `  !, !,`  㿘!0`!  @ <`? 0        㿘? @2  `@- > `  #>  `$ !` ޶   !> ]!X `$> :`p> H|$!X!X 2`>  ` `   ?` ?&@ &`>Ґ @2 ` > ȓ*` €` @/ > H> b`,#> ]` aX> ]  h @` 㘖 `"@ @ 8 aXӷ aX㘐@@ g`` ?G#@> H#?H@ @   8 %> a"@ `> a#@  2   "@ @8  @ 8  @? ㋒ E (` > &`; > #`" ` #> ]a\  '> H㘒 C @y$a\ 㘀@8a\O `  "Q@? @2  !>   ߽ $ ? ->    㿘> " `"  @ " @  㿘#   &, ?㿐#@2> \" &`> `@ > \"耤@ > ߓHo ouH p@  $> "0`''@   #@N@ܰ 0c@c@m 0Ҁ` Ho o€H 0 @` &  n 'Ho o H p@Um`o^  W xHo o H 0 @2_ ^A`C2 2SHo o€H 0@~ǐ @ $&  2"< Ho o€H 0> ߀`% ! Ho o€H 0> " & "   TT4@ (㿘> !\@㿘> :`p> Ip!> H#坖  #>!`@#ސ#` @ 2 㿘> :> H`p㿘 `#҂@   ?.  %$Ң` ` `? 1?` `?1?** ` `>?.   V  2( $(@2  ?(:  㿘> b 0 Ҧ`z> bؖ  >+              " "  " "   㿘 @*`   `  6"@ @:"@  *$ @$> ]l> ]""@㿘!> a> ]""#$  ߐ> ]"ʦ #$  >̐!> ]@ "L> H#     ,` ` 2 @  Lⴢ @> a> H#c$* @  2@2  ⴢ`@ > ]@ 7 > H> :2@ d > J`08*`@* 0@ " "`080?> J  *`d (  #㿘> #  >J!0> a%?> a/?"b"#2 > a%?> a/?"b"#K> b 1> ]4*` $* c`⌀`@Д`> a`P @&> \?  +> ])> "a? 4"a@2 4  ,  2!` @ *`!`? > H#Є Ф? *4&'㿘 !Ђ* >`<  `T   Т@Ђ ```>0 >0> p>"@!`>!@>!`< `T  㿘?. # , `$* @҆ ` (  .  )>? @ ` `*@*    * ` `+` {?  ?*  @   p" Ǒ, 㿘?.  #>@,  ҆ `   "  ? @ ` `*   `+  z?  @    ;b0 ?$@㿘?.  >>ֆ     + `@`.`z `b  ? 㿈> ]!! 8'P` "`" "@$ $  "@& $ ` $ `"&`> ]",> a#",0 "04 "4.`$* P*  @ 2`P$ )4 > ]" ">ΐ" 2> b>ǐ" 2>#` "`" "@$ $  "@> a# & > ]" 4 0`" 0" 4 * @$*` `2 ># * @'@`1 >#P@ ) >}B> c 2"Ң>Ю@>!P € >  2   *`* #@ * : *` > }> c   "Ң> Ю@>    Ҫ`  Ҳ` > ]c??!`c> JP .*` ''/> H+> ]Ɔ#  7`> : ` > J 2`@: * *2`@`# #@  2`@: `2`??*  *` 8 @" $@㘔  >     * : *` aԪ`aa  *`* @  * : *` Բ`a 2  ` "` $  "@ 誀@$ `$ `"@&``$@*  @ 2`P$ 4 4 㿐> a.`"* @ *  $* `> #`2  ** @*: *` > #`  Ҫ`  Ҳ` > ]!`> Jc %> H#> ]-> ]ހ@#  7> : ` > J `2`@: *@@ *2`@#@   2`@: `2`??*  *` ; @"  ‚@ ` "` &   "@@2> ]>'#x!  *`> b  2``"  "`> a"#  "@b0?"0`"  "`> ]"" "@b4?"4# ## "@"b`, "`,㿘 0 6`+   $* 6` `?*> `> ]!  `6 І@ "1?0/?@H /f * ' > ] " > #`Ԯ@`> ]Զ@`> ]> H#a`Ц@`@ H 0 㿘> #`   0 4H /f>* '>x`  t @#@"x+: |@\@"|??""|`> ""|>`|`t,` "a  @ `   `0&`44#@& F&  @>!X@> #  $  >  # ?> ]`   Ъ`  в``? 2 > ,,: $*` *  ӰH 00 !>!`@ ,,` p:   z"@>!X@ "Ԣ@`H 0㿘#> >ې#c &"#>a` "aXz"aX "Ң` Ԣ/>% @>! `  "!Xzpc ">@>!X@  Ԫ@>>z[c   "Ң>Ь@>`x$"`x㿘zHH /f4 * '    H 00 @  ->  2>g#4`*` $* 4`  `?>Z#ȗ*` > ]!`@  2>L#耢 2<` <`  | *d$ % > I  x@ * |@ S2 ?#@?#@(H Ҫ@@>!L@  @ > `Э`c`е`c> H`#<`  <` ?* @  <  @& *@  2<` <`  | "@    $ " ?$ 2n @@H 0㿘yH /f4* '   H 0b  @ S> H??#c  4`*` $* 4` `?> *  > ]a"3 Э@@@@>!L@@@> c  Ԭ`Դ`㜀 <`  <` ?* @ 6<   @2%  @@H 0㿘  >L (- *> ]b   "> ]& ! &   & &    & *  "&  " &  ?@& !> ]> ]"`  "` > 8 2  2 "˒      > ]!,    2 "`"`  & V㿘 ` ` > ]b` "` & & D& A& > ] b` "` #> ]"  ! #" `& # a> ]a, "a "!a봒 2> H""" " " &㿘xCH /f4 * '    H 00[" O??#c``>a h   > I  x ` |*/@`((@"Ԣ>aL€ 0Ң`  " > 4: ` & *|``  $` "@` ?$` @`2`"@H 0㿘wϬH /f4* '   H 0B " 3 3> 2t` " Т@ pꢀ`  2 `<    @>!L@ p` ?|2% "@H 0㿘  > (- *> ]b   "> ]& ! &   & &    Y& *  "&  " &  ?@& !> ]> ]"`  "` >v 8 2  2 "0      > ]!,    2 "`"`  &  㿘 ` ` > ]b` "` & & D& A& > ]!E 2> ]>% " `"  ` 2" `  #" `&   > ]a, "" 2 $$ $  $ $ &㿘vH /f4 * ' * > c  "" @"' %>  c ХLЬ@L@  2 c  "0@H 0㿘> #!> H$#\#>  c: > ]"a`@ʞ@㿈> #'D'H`'L`2 L> ] "!> `> ] "aL> a"`P>Òa|5> a&!>Ġ > ]"a#>`> b"`,%>> ]"b'>> ]"a)>"> a"c+>Ūa> ]"b->> ]"a/>@> a"b1> H> ]L"ad> b>>>>>> b"`#b̆x7> a9> ];> ]> ] > b> ]?&'"'ah ap! 0" " 'L " "> _> ]D`"`kHL*+> ]-> ]/> a3> ]"$ ,` ,`@* @ # ?2 ,` >  P> b aȦL> a*" * "c@m{!>$ t> b"a" %a" %" %> Hc  *  '> H&axax"`f> ]"al> ]?> b"!% \  @  $ x  % \`@ & > "%>?"> #"|ca ? @ '@ 2`<  < ? > b> ]a` $> a c'>   `? D4   D @  `'D`@$ $ "@& $`$ `"@&`> ]`0> b "`0$44``? ?%@4* @ 2` > ]!` *  ` - > Hc > ]!`* L   > H#"  Ҥ@ >> ]> ]!b4$$"@",L ", > \ @ 60 > ]! + @@ > ]> a #` <   '8   ?Ь` д`  怠 @  Ԫ@>4> `4#+  c> H# Є Ф 㿐> b >Ēc>3> a&c!1> a&">a47> ]>&h9> ] '!p>;> bb>'`0> ] )> a!> ]+>"ab> a->""> ]>>!>#>%>'>"ad> ] ጠ" > b> ]> ]> acĤT`5> ]> b& #"! , #c"  " > b`8/> _ "$","( `@l!> ]"@l> b8  ;> b)> ]9> ]5> b* * * @#%a ?"?*>  P> b aȮ#>`\$`t* '`%@kِ> H#$ `\* > ]` "a , @s|x($`pu <%"@k%'!t@k%&4 @k% *  '"> a" $(: $,``pz(  $`!t-@-*``$k`(-@ 2 @ cz@% @ 2 ->!8> ]- @$@-  , - 4c 2 ,@  z@$@?a!t`> Hc> ]"xx"`]> ]"al?> ]"!>&\  "x  &\ & &>?#>"`@>"`|> b>4 `44`* `$@*` 4` ! >`*@2 ` > ]a@ > ab@ > > #Ȁ@ @ > > #`<`  |<` z> H@@ ˑ4`#>a  > ]!> ab> ]!" @.㿘 "Ң!,   $Ң` p2  ?!Т@ $Ԣ`㿘> #`  > b >`$+ t+ 2   #  t! 2   @ t! 2  ,"@  & & p㿐> : `  > J  "@  > H# > :+ p@ *@ ذ   >!P > J "" *  > ]>!  ax#\  > # > a" L!> a (> > a$$  #\> >#\!a!! ۘ 㿘> #`> ]! Ԃ@`>!`  > a"> H"@ 2@ @Ք 㿘> H@ ##> b`,@@ 㿘  " @@j @@㿘  "++s& > # & & $&  & & > ߒ 劐 & ( ( & ,   z@`> c @z` & 4㿘   ? & @ "㿘H /f * ' > c    ">+!    >"!?H 0 "cϒ "c   >   >!">  (Ɛ & ,& (  " 㿘 V> b > a"q> ]!d> c  "0 @H /f@* '@' #6` ?`6` * ** :`* @ **  $* @ ` @@ #H 0#  "0@㿐. $* @@ / ` ` ' Ԫ@> H c`&2  >!P €@>a  @ @[> J#`@ cO@F 2> :>!L@> :  ` > J 2`@: * *2``# #@  2`@: `2`??*  *`  <  @"  ʔ Ц@c@ @ `(,> #`../ @: /  > \ > #> ]a Ԫ@@Ю@`ж@`D ?- 㿐. $* @@ / `   "Ԣ> H c`&2  >a   aP€@a  @ @e> J  >`  ?* `cT@<?Ep>!L@> : ?6 `p> J 2`@: * *2``# #@  2`@: `2`??*  *`  > @"  ` ?* zc@ @ >` ,㿐. $*  ` Q /`>F! `E > ]>:"a2f> #`2>` >`  | @I> J#` ;5> : ` > J 2`@: * *2``# #@  2`@: `2`??*  *` $> Hc@@ `- "% ` ? -` @ "%@ > H#&2@   ֪@` >!P €>a  @   Ԫ@> c  `> `> > H` >`  >` ?* d ]> HJ  2> :>!L@> : # ` > J 2`@: * *2``# #@  2`@: `2`??> J * *`  <  @"   Ф> #`2< <  | "> Hc@@ `9-> #`./`.: /`   > 㜀 > ]> ]aЮ@`ж@`Ӓ "%j ` ? -` @ǒ "%@> c   0@"& 0 4"& 4㿐'P.$*  ɺ / >! ` `2>ݐ" "Т@> > H#'@2@ ` PP€@  @f` >`  ?* @  V/> H<G  >!L@> : 4  `/> H> J 2`@: * *2``# #@  2`@: `2`??> J * *`  <  @"   p` ?* z㘲@@ >` `4.> #`/ /  P* ! Ң`/   z> ߠ & ? ,  " Ң`P(*@z@ "$㿈> H# > : 42 ` > J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  `m` Z0H /f4'* ''   H 0쁊 0Ԋ@' 7>  ? '4- $*  4  `?>趐"*`@ ``2>謐"8,`> ]`@2` 㜀 @< O |L< @R "&@ ? - I "$    Ԫ@>aL€0@㜀 > `Я@`> H`з@`> Hc` <  < ?* ֆ> "Xa: @`'@`W㜀 2> >  | @M"> b 2> \ `> #> ]a Ԫ@@Ь`д` ?,-  㜀 > ]> ]Ю`@aж`@֒ "`m$@ ? - ʒ "%㜀   0@"$ 0 4"$ 4> ]! 2  ' ' 'Ъ@@H 0쁊 㿐 0l Ҋ@'H /f@* '@ 9> H+>  -/6`+ @  $*`c6`  ?`+ + `:`* @ >窐"8 "o+` ` 2`f> ]a c  >`  |>` @U> H "㘲@ @J@ "  Ҫ@@A@> ]"'%@`$ @ $`$`(>aL $`(€Ц@#@@퀦@0%@c`+`2 Э`> H2 е`> Hc >`  >` ?@ * > H#Ђ@ Т@@ @@ @ t6`H 0 Ҫ@㿘k> H# > b` .@  !!`  @6` ?6`H /f * ' +   $*  `2 >"> ]>" 0x +` " > ]a   > #` >`  |>` @ @Q*@F&@@@   Ъ@@@ @=⸐ 2+>!L@%Ъ@@> c    Ҫ`  Ҳ`` >`  >` ?* @ @⸐.@ @H 00  `" H 㿈> Hc> : 42` > J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * `j`  0H /f4'* ''` "H 0 0҂'쀦v  6 -``$*  6 ` ?>#,`  2?># , @` "`Ԣ>aL€0`>    ":>#@ @@ z@ 1> b @,@ -`,` !`,` z> ߠaߎ % ? , @ "`("``(-`@z@n "%v> ]!o 2` ?& &&"Т@H 0 㿘> b0 > b`ؐ` `j?@"H /f@* '@e > Hc> 6`c+   $* 6`@ ?+ + :`* @>V"8 ` *@ `28 " Ң`&: > ]b"`$@*+> H> ]" >`  ?@*  @ c( $(` <2p>!L@p` ?@*  zc@@ޑ>` @ > H 0"㿘i.> H#> b`> b ؀ .@  > ]` "`H /f * ' 钒 " Ң<  2p>!L@p Ң`"⢀  ?` "`|H 0㿐> ]!`>`  > at > a`L*   >; > Hc> :  6  `%> b > J 2`@: * * 2`@` #  #@2`@: `2`?> J `*`@ *  #> H%> b c ?6 *@   @   @@ʚ  >9#`@㿐6`,` $6`*  `?6,@ H /f * ' > ] ! ^@6[ #@  H 0۔0I > : ?. 􀢠 > J 2: * * 2` #  #@2: 2?> J  `*`@ *  v   Ԫ@>aL€  ,  @ Ӕ@a  (> aꔐ# >4  >  - \ c?Ԫ@` Ю@`ж@`> H#?> ]!`@  Ң @H 0 㿐h666`+   $* 6` `?H /f * ' > c   0 4" 2  :  & & 4    & 0 2" "A  "i/> ]%-  ?4, @@> ]!` "*%   i|$@ , /> ] - > ]!   c 2>` >`  | &    Ҫ@@>a  @   Ъ@@c2 ֪`> Hֲ`> Hc`#>`  >` ?* 6a #@  H 0 < ?& <L > : ?, 􀢠 > J 2: * * 2` #  #@2: 2?> J  `*`@ *  :` >!L@  , < & < @ @ᤀ!c   Ҫ@0  Ъ@@c2 ֪`> Hֲ`> Hc`#>`  >` ?* @c 2>` >`  | $H 0 㿘> b ~ 㿘> H 6@ `  #> b# 1`#㿐@?x*  `@`<@?> a L`:> Hc> :  6  `%> b. > b > J 2`@: * * 2` #  2`@: `2`?> J `*`@ *  '> H%> b. > b ` 6* @؀  @"@@  @#@`  >ᤐ#    $ "  $ "㿐=6#@>#ቒ6`* @ $*` 6` !H /f * ' >`  ?*  `2W  <H 0X0_Fp> : 2 ` > J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  j  "Ԣ>aL€ p ,   7`Ȗ /@ Ц` ?*`@z@H 0 㿐e6`,  $6* 6` `?H /f4* '  " "ڔ  /g3"$, $ 2> ߐ! , $   ? z@`8  (2   z@- @#@> ߐ!ɒ 2$@  , -  , >`    ? z@` 2   z@n >` ?*` `] ?<H 0w < ?k& <K > : 2` > J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  탔  >!L@  , < & <  7` ܔ/@ " Ңp Т` `?*`@z@H 0 㿐`x* `  ``> H#> :6@  .`@ 􀢠 > J 2: *@ * 2@  &@  #2: 2?> J  `*`@ * "> b , "@㿘> b Ô@> ]  㿘 p6`*`  $* 6`g `?*` > ]! @ B# @@  dJ> #`2  "Ң0Ь@@؆@' 1> d9#   "Ң#Ь@@#   Ҫ`# Ҳ`#> H`#>`  >` ?* ؂ @  > #`2>` >`  |   > H# ? + + @ @ &     $ 3 ((  3 ;  > H > #2( ?+ /" 㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  "  ?$  㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * 2      㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  " 遐 ?$  㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * 2    =  㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  " 깐 ?$  㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * 2    u  㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  " 6 ?$  㿐> Hc> : 4 `2> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * 2      㿐> a L#> H 4`91> ]c> : `4 ` > J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ *  cc`?4* < !xԤ> H#c Ф㿐> H# > : 4 4@ `4 `'> ]> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * >! `# # ?6@ 4@ *@ (  > J 3 : *@ * 3 @  #@  $?3 :  3 ?> J  `*`@ *  #>! `#@ #`?6@* <x  xԤ@> H#bo>!L@ Ф Ҥ@㿐>   4` #> > ]!x> b  $`$> a L`=1> H#> : `4 ` > J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * >! `#Ր #`>4* `  ` 0Ԣ`z@!>  b#  0Ԣ`> ` z㿐>   4'> `4`+> )> !> ]!x#> b`$ภ!x; % 5% %`> H# > :6   `> J 2`@: * * 2`` #  #@2`@: `2`?> J  `*`@ * >! `c[ c` 4`6*  > J `2: *@ * 2  #  $2: 2?> J  `*`@ * >! `c c`>4* `  ด 0Ԣ`z@ 0Ԣ``z@>  !> caB >!L@   0Ԣ`> ` z> ` 0Ԣ`> ` z㿐> #`2j" Ң `> J > b q@  "> :>ں# 4  `0'> H> J 2`@: * *2``# #@  2`@: `2`??*  @*`      " ?  Ф`|@<2>!L@㘀`"0^ ]> J#`# &> :>Z    `'> H> J 2`@: * *2``# #@  2`@: `2`??*  *`    䑔 ,2>!L@㘀`㿘> #`2>  > > HІ   HЦc> b2$$  ` *` (`"8> ]@:88> ](" "@㿘> #  >u 0 >Ң㿘 H /f * ' > " ^S >0!`@> #` "Ң0 Ҫ@H 0㿘> ]"> c * > ]a> ]`bM * > H#  > 㽀> #`  "Ң"  Ҫ@"#ʠ'> Hc`> ]* > c?$ ⴴ ' # # > ]!`  * # # > ]"#'> n$  ਒" ``4  ?'> n' @$  `਒" `4@  ?2' (> > a#$/> n   ?? @$  `਒" Y`4@ > c A> ]! 1> c  `> ]`> ]!`7> nЄ' @$  `਒" &`4@> Hc? a> > c a Ҫ` Ҳ`> n`"㿘H /f * ' > H#>. H > c  " @㜀  "Ң Ҫ@㜀 > b    H 00/ 0Ң`{. 0Ң`{㜀 8>ք H 00Ф.֤>!H €㜀  "0@H 0 㿐> Hc``@ 3"`  aq @  퀦  ag 2 >  T`"`&&>>#ce > a!\.  > `> " 2 > " $!, !(#  "t' e 0; q  05 "' ؀ 倦 0+ $ * 0% (> >   0   0 0  0(??"q` 8 4> a#`>>#c'   4>! ' ږ @2 #> b1> ߐÒ Ԑ'  Ȗ   Ö !0  > \ * 8!> a`T]!$!0> \ `2 '    q#>a ^!0^ِ$a &@ ϒ #> b >` > 0H` [ @  ` "$`> @[@  H` [ @  `X``[ @  ` ?>Ӑ Pk$`!4  "Q'  C #>a>ֻ `^O!0$a!0N#> b  / >Đ '  & '     `'&&  [Qר >ף  `'&&  #> b!4 $!4`&&׌  `'&&  Ҙ#> b1> 3>  쀢`  ,(!@ ̐  ! ,! ``   ,@ $`*@ $ ,А # " ,  d 쀢`  ,(!@   ,  >  `_"ϐ ! .b >!@*&㿘!(` ` 2 x  xZ @ 2??  @$` 㿘Z!(" 㿐> H#> "` "> "  д> ]!`>  o @ @   @.1 2!(H/` />> В>>ծ!0 ">  >( @L>  T`2I!(=# > :`pw :!($!,  @   ޛ &)`P`]  Ԁ   > " ȑ2 8&  "   `t ,`` !(   ``H/` />>!@Ҙ >B!0'`n'`@'    `a1> b#> %> ] 쀢`  ,(!@   ! ,!  `   ,@ & *@ $ ,АÔ c " ,Ð  / 쀢`  ,(!@ i  ,  >  `]ː"ښ ! ,@ >!@*'@㿐> H# > ` " > " Ѐ + `` `>!t @ @`  `@  ` `  y @ #> b`p @"`$Ђ`  i`#Ђ` `@.  @`  @`2Z!(`3 2!(H/` />>!h>c!0 ">  >( @8>  T`25!(=# > :`p, &!($!,    Ԁ   #> " ȑ2 8&  "  (``"'!(   ``H/` />>!Ȓ՛!> !0&j&  l`a#> b%> '> * 쀢`  ,(!@ d  ! ,! ``   ,@ $`*@ $ ,Аِ  " ,   쀢`  ,(!@ 6  ,  >  `\"g ! , >!@*&p> Hc`> ߐ "`@ @>ӏ!> #!( ">ӆ!#@" >~"$!,, `0 Ъ 3   0`0`4  > #!Ԁ  `8  .  `* )T2`؀$`H>N" "-`@  \W*    @`2O TH *Y   @`2`4T`4'' ,@GШ??, 2 Ѐ&`0 &`4  `    @*@`&@&`  `- @`@@&@&`&`0&`#> b%> '>  쀢`  ,(!@ H  ! ,! ``   ,@ $`*@ $ ,Аt  " ,t   쀢`  ,(!@   ,  >  `[|"K ! , ` 2@В1@>!@*&@㿘!, !> b#> '>  쀢`  ,(!@ א ! .!  `   ,@ $ *@ & ,А c " ,  o 쀢`  ,(!@   ,  >  `[  Ԕې! , `   ,   B  㿐+> ])> ]!> H%> b'>#> bap #P"€`, #@㿘> :`p@G 㿘> H#` . Ւ  > [# `2&@`4  &@> :`p @& "v  㿘> H#`@ .@ @> [# ``6@ Д [ 㿀> b `)> H##`#  @ @8    :@ @ Ho o `> ]?!T@ #\ #`#`#d ?0> ]!T? @#\ #`#`#d H 0`; ??-'> ]%> ]9> H7>5> bp #<` > 㜔* `'  h @ ?#? 'ܲ@ >a 2aH€㿘> H#.  > # . 0> b H/` /> ]aTЖ >{"H 0>a aH€㿈 0@2 ,>Ր"> H`  H& L#8 @ "@ %> :p  x p Hc''#`#\  ߚ >`&& H)> ]1> ]'> H%>#> b!p >М!` '`!h @   @ '㿘 0@2> H>|"#> : H8 " @  `p  L>& H& L   @ <H"@ 㿘> "!( a(UH $`> "" >N"" V!0>!  *W֐  * :!&a0!0V!%&a0% @ &a,V P& H $  & & 4& 0P$  " >( 8 $ $ $$ 㿘!0  #>a2W$a *T͐"!G 8 !\&66&(!, PVQ!(!0`'>! 2!0Wx !0V@!@L]!"(H ''   '#\#`#d#h#l oΔ !\ #\ #`#d#l#ho   &㿘  ?`>#@Uv   >#@Uo  0> #`$```N` s# 4@#  # 2 4N` s24 4*,   "$`㿘< 2 #&< 6   " "    #" @&& W&@(' D' T' @( ' 0' <@B 2 HU" ' 0?T >1>7#!@2 ^Q ", 6"@2@@В! !W@@ 1>#0U]! ^- @Kt"1>#H 㿘`8 "; `( !25 @, !W@2- ` 2)  "  `* @ .*  @   2  @   W" ?U! 㿘@ @\( HU"$ D$ T$ @($ <$ 0@B=>㿘D <*  a@c`8 *: `( W_4 T @`2 0@22 $$44 WIWD`< $@,`  $4$<`(  W22` T`8@R$@0?($0㿘"  @`@ *  1>#X!W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!V!&`8V!&`<!6`B! &`D!> b6`H!6`J6`&`&`!`V$ @ $ ,  , $  $ , 4 ` a " "*   gG#ꀢ@216`   @  @`@  2#6`> b   a?V$  $,  @ `, $  $ , 4   6`\6` 㿘 ("2  , "  0 x  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`V^6aa `@RG O@Q$@$`6"6a    `     `@ @ "4(&`gG#&`! ` @R @Qn$@$` ```Ȗ @ b@`@ &` b``  " "  &` @ 6a@`@ 6a 㿘 @- @"+ >?  @29?@Is &  66  F6  26  .6   J6   B6  H6 F6 6@IV   8 . ` @Q " 8 "@P&& **`@ @   }4??(@  ?`   * 㿘`=>4#`4 :N .   㿘> b!` > "x`@> @?㿘? #> > &"܀` 3 > a!\* >ؐ > ` #> >] #> `` PR`H`P `R!> b! `$!d  !`H$!R `R P 㿘> "`l€㿘> b!㿐N `?#>   @ <=#: 86> +> <  "'a #> %>)>.``a`.` :!   <=# 8є`]]^ ^,___@__aDaDaDaDaDaDaD`X`h`t`````aDaDaDaDaDaDaD`aDaDaDaaDaDaaDa0aDaDaDaDaDaDaDaDaDaD^^8aDaDaD^T^paD^^^_$_@_`0__^㿘> b#  @ > d ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`>. >̰ `L .L@ ,2&`!/->+)>'>L a p "̓ ̍ ̉*LL@ ؀ ,>| L` Б* : `Eݓ*`>֐" €> b4 "> b "*> b4 ">4 > >4  U `¤>?!N, >!H '?4 , >@ >!??,* > , > >%!>4 !>4 !  `> b * 4 | > !0L`72x>4 !@ `q> b4  |>?!H, L`82c>!X^>!`Y4  `>  !hP> b4 #- > b4 # | >Ԑ!pA> b4 "> b4 >!xǓ, 4>! .>!˻ ?(> b4 "> b4 # | >˭ >˨!>ˣ!>˞! >˙!>˔!L >ˍ!L  >!˅㿘a   㿐N > @Q $Nq  > h H&a4&   /bbbccccc c(c(c(c(c(c(cmktktktkkn`n`l0ll >؄`*            ? ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S "(`lR 2T J  (< 2 0A  $ 0`@ j 2/ 0V     $ 0    0  B@ B  B 2?@ (?  0'd 0 ,?`$ 0! 0㿀@Pq '`" '>@@O  `>@@O `@''\; / @2+ !  `2%  , 2! k  2`0  &`0V` `2 `0` `a `0`,?`&`0ː`0 㿘㿀@P '@>@OK `&@'''[㿘㿀``  8`  @ @ '?'_ʒ㿈@O '@>@O `@''`㿀` ``: @'?''fF㿀```@'?''f7㿀` ``: @'?''fr㿀```@'?''fc@`' ` '>ؐ"*` €`''`'k  & 'kw4 4` `@'44'''4kf` 1@OG'00@OF `K  |PK  r @?'k@谒 hKՔ  b`0 @O',,@O `'K $ LK  Bk谒 <쀢 9K  3` $K*`   N0"`@'|'xxj | &P`K $  8@ N㿐  `b{&& bbb 0:" 5 b~1b| .  @ '*@ @ ?"*@ K>  2 "| "{  K,  㿘` i@ "Q   ?K # @b ,>"#><#>/ ! * 0" ">!> 2 >  " "("l    `@ 0 ,?`$ 0Ð 0rrrs rrs(sssD{{{{{{{{{{ "`"` "`  "@ "` 2` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 $&`8 (&`< ,&`@㿘Β ,&` 06` 4&`  8&`$ <&`( @&`,@M ` 'L``` 'r'>ܐ! *` €` `"b'``]`XU'` "O'` "H'` "A' ' @@ML"@֒耢 9P@ @J& 20`J! T& ''L@Mc @"`J  T 2PJ @ 2 矒 㿈` `'`''㿈` `'`''邒㿘@ 0  0 W 㿘 &`, &`0 &`4 $&`8 (&`< ,&`@ 0&`D 4&`H 8&`L <&`P @&`T D&`X H&`\ L6`` N6`b㿘 ,&` 0&` 4&`  8&`$ <&`( @&`, D&`0 H&`4 L&`8 P&`< T&`@ X&`D \&`H `6`L b6`N㿈``'`'` ''㿀``'`'` '`''㿐``''V㾰@L `'`'' \@L`` *'C` ` 2@  '➒耢 7I& \ 2/xe` I! p%`  x' p`  px'I  2nI \ 2 i 㿘@ 0 o z 㿘+ 6`4&`, &`8 &`< 4&`0V $&`D&`@ (&`L&`H ,&`T&`P 0&`\&`X㿘 ,&` 8&` <&`  0&`4 B6`$ H&`( P&`, X&`0㿈` `'`''T㿐`'$㿈` `'`''@K `'<` &' 8@KÐ<`` '`` 4`` &`@` Ha p 2RH\ 8 "`E'`?` >>ܐ!4*` € 'ꉒ耢 0` * H2 8 #@[` H- p '쀢" ' "'  2  '[ 㿘@ N0   N0Y b gp㿈 "``h耢 //77GӔ  8DTdt        h$<|㿀@'` '@J '@J ''?'x G 㿀@J '@>@J `@'''s㿀@J @'>@I `'`@''s㿐@` GO &㽈` ` ?@ @`''7@>e"@G3  @ `@"$`$@㽀` ` ?@ @`  ??7@>@"@G  @ `@"$`$@㿈 `@ >`` '' @L`0?"`0`,  א`0 ` " &㿈 `@ >`` ''㨒 @L֘`0?"`0`,  `0 ` " &x`2) `2`#  `  `: ( @> H?'''''`@*@ `@*'ؐԒذx`?2' ``2` ! > H  `( `@'#'''?'`@*@ *'̨ؐذ㿐 !: O @@`  : (`c`<`   @c @d   0" 0`, `00F` "$` F$`  0" 0`,  `0 x @IT'L'>LܔL@H < @ L'''Wi0''Wے㿘`?* `@֒㿘` 2`# @ `+  * ``Ò @!<>߄ ( 6"> 2"> ."„*"> H&" #" < " "> \"> 4"> P""  "> H"> H"  㿐@   2@ &@@ 2` &@`@''@Q<㿐@   2@ &@@ 2` &@`@''@QB㿈> H c`@   Є*   >` '$@( 7  `* `  * `'##`#\ ?? >"80``@ đ: @$  ``@  ē:@ " $ İ (@HE '@HD H'' [D H T#> 'I"``@;I@@;F'I``@;=@@;:?''{ 2D H ,H``@;"@@;'H``@;@@;'SH``@;@@;&@D x@    0D7 = 0?   . aF . 6`  &3 @G 'ܒ @G`*   :? ?Dc  2 ''   `&   $`А &  `&㿘 > #쀦 "   4  2 4 㿈@`B>ߐ!*` €'' "&! 3` "!  "* !    `4#& ` " !  2!  ! `  &``'' 㿀` "`   N0!2  NА"@&  ` v`@'''C  N㿘@ 0   0 Nx@;v  'x 'N 1 4`'!<  ''``>` ''|2 > h>`> h`* @'     *` `'  '|Cg 㿘@ " !   " T ? ` &`&` T ^ `" L 1 4  !  @ 2N LL 1 + 1` '&!8` 2g` 2c  X " ` H ` $ `@ 8 & `4!8 !< H t0H*`:  2 L , 2 L(` ` " L`2& $ ,&!8*``X`+ 2`2` # @2&>X!   " Tt$ X ǐ  ` 1  㿘  D&@ &` `$&`  &`  &` &` &` &` Dm&` &`4  &`4  `4 &`4&`8`<D[ `\@:w @㿘  D&@ &` `<  >`    >`  :>`   >`   >`(   >`0 D2&`8&`L  &`L  `L &`L&`P`TD  `t@:< @@@E '!@E@> @D֐@''O HB8!  r`B4 @@Ew '!@Ev@''P  HB!  O`B (@ET '!@ES@''O HA!  [`A p@E1 'Ԓ @E/@E+ @''''AՔ  2'ܐ'' A     ' &㿐@   [@A 㿘"` N 0  0`A  㿘 㿈`'`@''f㿈@'''1 2 є  㿘㿘 0  v 㿈\ ?^  2`  ?倢` >#*` €                   7 -d 0 q찒  b"e0! 2` 2 > h ""`(@#&\, ?",`0?"`0`,  ΐ`0 㿘 (@I  1㿘  R` "`(0 > h "` 1 ~  ?`" "" $ 㿘@8 > h !  ?: *` + +@   `+@@ &@ ?㿘@8f > h   ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P @C `` '@C  @C  آ? 25ȐD? "@( @> ha * @''' 2 Ȑ? ؐW?  h@B `@ '̐@B  `@B ?a 2/ؐe?\ "'" 'А'֒Ѐ 2ؐ?@ W?;  H@Bz @  '! ?& > h,!  b"Q  h`a"` NVdFv N@"i!q N   *@';' @BC@B? `'А'''@6ƒ 'ؐ> 2N ̔ ?&D >Δ = а 9&*@'' *@ '')@B  ''''@6 '> 2      *@* '㿀`  a`>  :` 4 >u  .˒H/` /@`"a``  ?ab  $a*@$a?" @$aH o@㿀@   0'` 2!"   '`@6    : * +@& `> x@ >  dܐ'w㿐``> h! *` @''  &@   N $a ! @ǒ`=ݔ!x`=є!x "@㿐!'4㿘`(> h   > ߒ""""` ""> " " > 2 | t2 | x2  |   "& &   2 㿘`(> h  > ߒ""""` """2| 2||`"`"|"@ |x 02㿐> h   > ߒ""""` "  z $ x$ t$$   h< |P 0 ` , , > ""`$ | |"` |"$ "⌰ 㿘`?`>!4*` € &`  &`  &` &` &`  2 2 2  2 @2 @2 2!2" 2(H 0 a G&!W  0P0!J > "8'  2``2 ' < 2*ؒ @4@ W7Ȑ <<  2 @  <DLT\dlt|㿘@4L ?  2`  ?**&@ <&` 0   &` ?&` ?&` >&`  b  2  * *`@ &`$ 4&`0 &`8 &`< &`@ $&`D (&`H ,&`L @&`P <&`Tb&`X&`\㿘@4 ?  2`  ?**&@ < >` 0 @  &` ?&` ?&`  >&`$   2  * * &`( 0>`8 &`@ &`D &`H $&`L (&`P ,&`T @&`X 8>``b>`h㿈` @'''@㿈` @'''@M㿈` @'''@|㾠@? ' `@?`>' ` @>8`'Of 2" ; ` '< 0 2``1`;  㾠@> ' `@>ǐ`>' ` @=`'OO 2" ;_ ` < 0 2```;N  㾠@> `''@> `' \ܒ  ;, ` 2`;'  㾐@>f @''@>c `'NВ 2"; ` ؒ< 0 2`@`:  㾐@>3 @''@>0 `'N’ 2":Ҕ ` < 0 2`@h`:  㾐@> @''@= `'\O : ` 2s`:  㿀@2k `:   㺐%@2\>b!@1> a/@1!>b!/@1>J#/#>   +  N0n"!> <4> <>"<  ! "> !"! \ N">E" N0T> 9!7"5#3">0">-"+ h> <("&"!: 29` '#\   -!: 2'` '#\  Ж @7Ԑ `& ( ``; 6` 9㿐` N@' `@'' Np@< 'Ԓ @<Ґ'>@@< `@`'ؐ 9o  ''''9h  "0'ܐOƒ؁㿐@< '@> @;ڔO? >D(             ?㿐@ @;`?&` & & M㿘`?&` & & ZŔpˆ ¸d˸˸˸˸˸˸ʀʜPX˸˸˸˸d˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸˸ˀ˜ @;< '@6 @;7' `@;3'7 $K 2 7͔ ` 2 <  2 2  'J耢    `2`2`" ` ` 2  (*  2 㿘` @@/t .`. `6 `& 㿘` i@@/c j` `. @* *``2@".㿘  (&@R@ "      &`   &` &`&` &`&`&`h  0   7= 2(˒Ȁ   N '؀ 'ܐ  '' @''' ' '''7'㿈 7 㾈A "8   6 2.  ( ''J쀢 " &  '   N  ( ''x'|'t6  h ,0   6 , 2)L耢    N ''̀'Ȑ '' 'В @''''' '''6 ,㿈   6  2'Z㿘?"@` &> t*` €"ՔZI  hȐ@.+ ,,8(  6B "  2   ?  ?'' ,''''&'''''6) ,  W   x 6 2Ux "O   J N耢 1 d0x ( jkOz !z 20'@92'dd@915  'h'l'ph ` `2 @-!  '|'  'x5Đ  㿘``  `` T ѐ [ 'p@   N'Pؐ j'Ph@8`T'TP@8ΐ@8ʒ P5z  2h`"'X`" 'X\ N`W`T N0S'\'`X  PI'\'`MX 5G 2;L5@  4LP@-  52 &@    NhsL 'huhL 'p5L  5  㿐 `b'    &&4 `( 2 % ?  4ޔ $ 2 ''̒S 2 'Vc 2?& & 㿈''F㿐'G㿈 4  2%?c @ @    0 Ք 4 㿀? `]&> *` €fQJ ' 'S䀢 2?` @ ?'@ ` ''S 2)`  `4''S  &Ag j 㽸`R@ 2`0  $`0`  4 2}`0`?'` 3 2p`00?'0 ܀b 3 2]`0  V N܀ 2S`0ȒA ܀ E&    2 jX; j@7 `'@7 3 2*`0؀ %   N!`0@'L'H'PH`   '0'4'$@'(',' '8'@(+&`0`,?`$`0|`0㽨@+\!@RT 2 0u  % 0`  3j 2c 0`?''` 3\ 2U 00?'' I ?Ȁ?C N@  =  j@6 ' @6@6 '32  2% 0``"@4 ``  @ R @D   ? '''''$`''' 2 02 2 0     '''''@  2 N'0 ('2 (?'''$`   ?'''''$`@''ؐ'ܒ8 2 0$`2 2 0   ( ''''''@  2 N' '=6@" '''''Ȑ (?''̒`'_$` $ #! $'!!'2y 2r 0@  k NАДȐ ''''@''''6 2O 02O 2H 0 '@  2? N' '0 N''$`)$`` "`2* 2 0`2# 2 0``2 2  0` `2  2 0& 0 ,?`% 0 0ք֌ִּ֤֔֜֬,8DLLLLLLLLL,8D!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (>8(# ! 2 K n   !,"X$' )` "#%" !㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&` В `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` ~&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $X`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $   ` " ` ` `gx`,Ȑ`hx `@ @%9 $  -N {-I $v  `@ 2m` %``` -& $ 2X -  2Na C Ȓ?#`> x*` €      @&`h@ , ,ޔ  2 `g@9llllllxlDlllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllllLllllll *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&>!*` €`w@ 2ð+  2+  2 `vu`c`@ l ؐ+  2     {`@ vȐ[B +  2f> `X`t@ Sh +s  2CK `u5@ 1 +_* +R  ~ " 8  }    }   ~@ @HP||l`|||0<PP㿘!,`(`+,'Lh {( @"!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$P$ &@㿐 $`(!*`$ z @ 9!,   >"@ `(< @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ ꐒ@  `ڒ?" @&!?> h*` "@"` "`"`@"`>*5 "` . "`  0%   0 "`"`>x(   "` "`    "`"`㽐> "`$a,a aH @  a*@ aa#a  = ?xx! ?''*'lQ ?)"  ?+/ "a$z a$`$H$$$㿈> h` H@a,5 ?``81 >#*` €>=#" >8#  $ 0>0#0 ui$ 0*`" *  * $ 4u]$ 0$ 4  `$ $ 㿘@>#@ 㿘㿘` `   `!" ! ! 0  : ; ; > j!t&a4 p                @  " $ "@  2 "` 0"! @0 0@0 "#@2$2(  @ > l"`0("`$"`( (!   2 @2 2 2 @2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &` > k (ɒc & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` ).`㿘&@  &` `&`  &`  ) .` F@ 20Ȱ  $0`2 )  `!" -!!"C`f`a "` a^j R`$`d"` !L w "<`k  /d% %"Ԡ# %  "8  !0FMe"`!uB<` `!&03!0!'p.!,' -!" !!!)!( `  ` !2!1  -0 !%0"   -@"_8Ґܒi֒/ -Ðǒ0 !0!! &`L`&5  20L "'LL  @H&  D'D&   '@ `b@@`h@ 20`&  20g77@u`h@࢒ 2m0'`'% bvZ&`<`w@ `T(`"R0`< 2N0` `"H G0`%Ɣ @9&`<  `@ 2309` @2 `h<`% % $h`%  208 `@ 20)`` @`%l $ 20``  @ݢ`%W  20 f4`%M  20`_@0`%= 20@ 20`%4 x`%' 20@ 20`% X`% 20!@`% 20~@ 2{0`$ t`$ 2m0#@ 2e0`$ ^`$ה 2W0!@O`$ɔ 2I0@ 2A0`$ :`$ 240!@,`$ 2%0@ 20`$ x`$ 20!@`$  20@ 20`$x a@袒 20 '`'d'h'l'p't'| '''' '$'(','0''P'4'<''@D'H''``T'x'//'''''''$. `P$" 20P?T'X'\'`'d'h'l'p't'x'|'''' ''''\''L' '$'('P','0'4'T`'8'<'@'D `/2   /` `/@2   /@0"a؟@ 2>0K"a@ 4` '00# ,`` ',``"', 2 ', `@,   '( - b}@(0,?`$0q0R "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O>"*` €> l p` 0 @ ?*@ @9&`@&k'`@''@&f `'Ȓ#  :А#   0Bc *Ā '"  !}`"  -BI``> l p 0  ?.  d p 㿘@ ?"@SĐ㿀@& '@>@%@ `&@'''1ߒ㿐@% '@> @%(6㿐@% '@> @%@)M㿐@% '@> @%@)]㿀@% @'>@$ `'`@''N㿀@% '@>@$ښ `@'''N㿐@''/`@% '4    ` @@&`@ !ɖ 2~>cА@#I  >4@%_  &@>#"   "egc@#3  \` ! 8 2Y!  2Q8 # 4/8 X@%2&`  'H @%,  > l`  ?P'L'X'\'``p'd d 'd'hd`'l@'d'pĐ't'xL'!  2` H! X 2,㿐 ''m㿐!   @!'㾈`` ?@ @ '7`'7@!@!s  @ `@"$`$@㿈 ; @ %( <`  `>`' ' @'\ 0" 0`,  6`0 ` " &x`?2* ` ` $ @*@'䀊`'؀  > Hc В@*@ *'`` `:'`?''Yذ㿘`  <㿐 @ޠ I`2` 8   "$ (`) 2 ``> l! *` &``  `   `   ` "`Ӑ $ `(`` 0" 0`, ~`0㿐 !: g @@:Y : (`=N`<`   @=Ӓ @?7   0" 0`, ~i`00 e` "$`  $`  0" 0`,  ~T`0  0@3 e>"" > !"  >/"" >#! > <"! @ 9 e㿘`  @ 4eԐ0e㿐@#g '>@@" `    K`2`2` 2`&`/0 2. 2+!  `2% , 2!>  2`0  &`0V` `2 `0` `a `0`,?`&`0}Ð`0 N㿀@ `”    㿘!   ` ` `|`x  mQ ̟   " & =y   "&  &  X @@k $ ' ' ' ' '  @' ''Вz'H@" '@> @!@ @''''':  X  D    <>*@$ D`㿐 9@ !`( X  D``0?"`0`,  }`0  > <*@$ D` 㿐@"c '>@@! `< @@ 0{00@>("> " <" ">  " "„"  㿘@   "@@*㿘@   "@@*㿈@> l!t 6 > l!4* " ` '`'`''| 㿘 !:e > lax @  ax@@"```@ @ܐ 㿈@`> $` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$ L 2` = " ?!   $ i 㿐 @e'!: @''~@g& % * @,`@@{,`@*` ,  ', @p '`H* , `H`@c, '`* , ` @X, @' 㿘!?΀@.`  && "@*`" * *   " 2 @"@W ,`h H( h(  * H 㿘> l!`" @  @ h> bu '" > l, !` @@ 2`@`@ 2`@` >>"O0b(@s`'Ȓ`'̀  >%>,7> 9>;> L  -`*` :`*  L?Ѐ  (0`%H&``&`0`4 &`4 ` &`t` &`x`  &`|`6J`4 @ K ~`$+  + 4 &@ @ $ @   `@$ @ *@@    @  `@  *"@ *`" *  *  &!: !@^#,` " ``4 2` * $ ``$`4 `8`+   "`4  #  al&`&`?R> b&`&`̐ J 㿘0    4 g@ ` `d `t %3 *` *  4 `??P `? b?*`?"@" 2  8"*` *  4@ @  b? ? `$ `  `* `b* " 2 ?"  " `  "$  `*@ `! | 2`*` *  4 `m    "" "  `*@  x `(2`* *  4`  c *@  "`b"  ] *   T"* *  4@ 8@   c*  *    ?#     c*  *  ` ?#  ,` 4 , c (   # ,`# (`*`* ,` $ ( , "  "     *   ? #  `*@  > #`  0 㿘  u 0q > ' ,*  4 `p _  $@)> ' )>     @    $ @   "P `h*`@ €  $@ݖ Ho o ?$ H 0   `h*`@ €   >bh Ŕ  `H (`Pג" `p `h $`p* @ 0,$ 0 4  "0Ho o ?$ H 0  "0x 0 P >     `? 㿘&    +>5>>!В`$ $ $`$ X   &$`$$``  ?@"   ,- * 4 4 &@ `@" 2$` &`0b> >" |㿘> m  `2`  `* @` `0, *  4@` p b$ l"$ p #  c$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @ߒ   @ܒ  *@@D  * ` `2 p`  p &$ p ?#$ p$`I H /e `H 0 p =8$ p* & ``   p " #>$ p !b$   p "H 0 h> ' x*` €㿘> m!  *`6  . *  4@ > ' h x*`  €H /e * &  @ p  @: H 0 㿘  > m!6 . *@ *`@`<> ' hx*` 㿘  > m!6 . *@ *`@`<> ' hx*`   > m 2 * *` (<㿘> m!  *`6  . *  4 > ' `h x*`  @ iF a ]@ P `y@3`x@0P `z@!`{@" G  k@ "+  j@*\@"0 8 l@m@"/    $ 4 0%    @ 0@ 0@ 0 @~ &  &!:_ "  $ l> m* 0(@(4H4p(p 2 "p " H 㿘 l> m `! `*2` *` *  4H /e4 p* & p V  H   & pvi H\  H   Ր H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l> m a *2 @ * *``4`(       2 `$   耢  H /e * & `(    S`(`  v r* * `$   | x* * @<   @9 `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @   @ N *@ *`@@2  "`` *@ * ! * H 0 >    `? 㿘 &   !>`l`T `4->+>  4$ ${zc8   P P` P>&`0 "> >" В㿘> m  6  ` * @ "[  06W * *  4H /e4 * &    H 0<  & H p@$& @:?& @7  '& H /e * &  h*@@?    @;  * H 0 &   > m 2 * *` ( < 㿘@c㿘@]㿘> m " *`6  . * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0  㿘> m " *`6  . * ` 4@   @ 8   SH  `$ $ y   S5> @@` 2  g; PK  G  $$`H /e * &   8 y$ ! q H 0 "` 2 `% ` @8` f   2`H /e4 * &   y   ?$   y 8  ?$ H 0`  %` &`T` 㿘  s8& 㿘  s0& 㿘& & H /e * & 3> h*@ r * @ǒ   @Ĕ   * bȐ! q  h*@ *@   @ @   @ H 0 &㿐& & H /e * & 13> h*@a"  | x* `  * *@ @d   @a H@Z   @W   * bؐ! p  h*@ *@>   @; H 0 &㿘  . "* > @ * 㿘  1>  @ ؒ#耢  @ Ӑ#㿘@   `@  ( 㿘``@ >@#   㿐4`>#0􀢠>#8 080  &`>&`t c`L &`l>`tchF &`p 2%&%"%&`p`  &`|&`x k &`*@`@(``L``<`\`0 h@  hk  *p` *hq` *(a` *hb`*(c`*h@`*(A`*hB`*(C|`p`l `#\>#p>a z > cXz >c&`L&`PS?>#&`<&`@K?> &`\ &``C wV> `?㿘&  )>>>#Xb$ $ &@$`$`$ P  $` $$` x,* *  4@,`0  $* &`0#>#>#Ȑ L㿘> mp  2`  `> mbD  6 p*bD @ 0+   *  *  4 p W$ l"$ pҐ#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * &  ` *d@( `  *d@ P*`$`2 p`(  p %$ p ?"$ p$`H H /e `H 0 p =7$ p* & `   p " #>$ p !c   p "H 0 h> ' x*` €㿘  , > mbp* 6 . *  4@@ h> ' x*`  `€H /e * &  @  p   @ *hd*(H 0 㿘  * > mbp* 6  . *  4@@ `h> ' x*`   @ mL e ]@ T `y@7`x@4T `z@!`{@" ,K  k@ "+  j@*\@"4 < l@m@"$3   , $ , *(d  *0%  @  0@ 0 @ &@ 0 $ &!:X "  $ $ H( (d"5``0O?LK 0  (2a@2`@ 2` 29`07  + 0 ( `+ 0  (`#("`+ 0 (`@ (` + 0 (`(((H  㿐 l> m ` `* p* 2` *` *  4`(    p@ 2 `$   p@  H /e * & `(    X   *hd`@ @ @ @ "`$2 #!"  "  ""  B*( @(`@@  "  D*( @(  *h  H@(  *(   *h   *(   G*h   @* *( *h *(`(` *h9 *:`$ "   *h1 *2  @( h( @$ (H p@ 㿘  *@ > m"p*`6 @ . *``4 > ' hx*` 㿘  *@ > m"p*`6 @ . *``4 > ' hx*`   *`> m p(2 *  (4l> m* bp(0((4H4p(p 2 ,"p , " ,H 㿘 l> m ` `* p* 2` *` *  4 H /e4 p* & p" V  H   & pn H  H  p H$  P$  p & p *(d  *H 0 A0(( ( z4* x*" 2   ",", `( "@" ` A0(((`46`*`zx*" 2  ",",` ( "@"   (A0(( (4, .  *({  *({, ",,  ({ ({,",? `" " ({ ({ $ " , "     (*(,߆",#@  ( A0(( (4 @ , " ,"@ ((㿐'   ,w ```P@2?@?<   lv  2?o@?   lu  2?@?<   > #` 7 0 㿘`   0 > ' ,* *  4`p` n  @!> '     @ $  $  @  `h *` €  @ Ho o , $ ,H 0  H /e * & `*(d` (H 0  `@$ ( `h* € >cؖ   `H `P" `p `h $`p*@ @  0,㿘.`@ . 2 2?#@2..  >X `?㿘 | @& >&`0` >#>#    㿘@ 㿘@   㿘a"  ``>Ԑ#. 㿘>@ 2``?㿘8 0 &`@@ `@< @ @ (@>0 > (0> 80 @@2㿐 @'  u  @`@'   > P !` @ "[ @@ ?"@ @ ( @ *`㿘?> mȑ2 `   ȑ* @ 2N <  2  $& 4 . <& 0 㿘?2 > m ȱ. @ 0 @Ɛ d  d 4ΰ , <㿘 0 "B   @ `  ` #   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @ڐ#  $ @ @ ` "  `` *`2 0? & 0㿘?2 > m ȱ. @ H ^\$ 8$ 0 ` 0@&` $ 0`$8$ 2 4  㿘>@  2 p@ P>`xܐ>>`xԐ>@ ` 0> 0   &`P<  } &`TH  w &`XT  q &`\`  k &``l  e &`dx  _ &`h  Y &`l  S &`p  M &`t  G &`x  A &`|  ; &`a4 " '>@` 2'8 '>?`xy@`P* `&`@&`< "`<@`P`8*  " d@`0o>  !D8 `'` ''>r 㿘>  @x+ Ik  & L>  05 @ & H L @w H (`< * *    L`8  @2 `   " `8 L@ ` "   H&`<㿘`> ! 㿘>@"``?㿘4`>"h0n >"0e8  0&`0>&`D"`0.`y  `4`#`    * >`0  >#&`4 &`8?>bu,`P &`P@3`T``L `>X"`L>"Ȁ > m#%>#>"6, GВbص6 >?"`P &`P@ `T` D`0*@㿘  0 *  { |@  ? ?   P " T  H @  T "  >5 z ">0 z> P & P z"  0" ~> z#  ~. }? . ~  & T } h . } * } ~@2 0& T@ 0#H TԒ  0 T 28 { P. {  . | ? & P. X. |!. ~   ?    ? & P. X. ~. |   ?& P@@   | ?& P@8  | "  { 0 `"* 0  { | `:f 0 b`. { X @ { |2 T ~ ` & T X. z 0 @ *@J 0 2G 0 X . zA& T`  !   *~*X*Y*|*ZL@  y2*Z *Z !   *~*X*Y*|㿘 z "  h ! "  h0="7 h0: i*  6& L i*  >#0  >#*  >#$ > P L c& P >#>#   P & P Y Z @. x㿘> m#`##`  `Ho oP  c"P`Đ ?H 0㿘> m#`1#`  -) Ho o y  "L  L @ *yH 00 P `{"PH 0 0 c 0" 0(㿘 0a b   i   0 `  * @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "    (+  2 2 " 2+J " ?  $*0 ` + +    "* 2"* @(*`  *02 @"@ @b 㿐  `   ` @`>  L b    ?2    *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  `   `  @  ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@7  ?@3 @ ? @  &@l@㿐 @6``2  ?7 x 8" > mcx   @   @V XP    @'@"'5ک/@ @  x@@ 0`(` @/@:1@ #V@@ 7`/`  @)@@   ے@  7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @ 0`(` @̔/@@ "*@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؐ@@ 0`(` @ܔ/@"=@ #@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@ 0`(` @/@?f@ !@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =@ !b@@ 0`(` @ @0,@ #@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@ 0`(` @)@@  S@@ 7`/`  @(@@6(y@ "@ 7 /  /@@ 9#Ȓ@  1 )  / xs@ !@@ 0`(` @)@0@ #֐@@  7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@ 0`(` @)@@ ?;#@ @ 7`/`  @(@@@ "ِ@ 7 /  /@#J@  @ 1 )  ?@!B@@ 0`(` @@!}@"@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@ 0`(` @Ȓ@@#@ @ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ɛ@@ 0`(` @@:I@#@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@ 0`(` @@9@!@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= H "D@@ 0`(` @0@ʿ #@@ 7`/`  @7@*@ #@  7 /  7?$@  9@ 1 )  1V֒ !Ð@@ 0`(` @0@#3  @@ 7`/`  @7@?@  }@ 7 /  7!a@ !ѐ@ 1 )  1 "O@@ 0`(` @0@?9 "@@ 7`/`  @7@(P@ #@ 7 /  7@ !@ 1 )  Ȓ1=ߒ "@ @ 0`(` @0@/N "5@@ 7`/`  @7@ "@ @  7 /  :ᴐ7c@ @1 )     @& & & & @> @  `*@ 0* @*  @* `      +` *`  (*  ! `   @* * @ * ** 8㿘 '>_    &&@"  @ @Ð.$> ?٤!> ?0Р @> >> 0Ő . J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&``"   ` 㿘?#@6 6`q ` @ & $ @$@&@ ZV2   *  , "@@ 4 "  "  , @@ 4    -`@@ 5`  @@*  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@O㿘 J J 2" 2N@@  @` *N &* J " "  `  ?2  㿘@  H 'T> m#@[ T ;9?T2 7耦(7耢 2: - 4`44`44`4`ؤ45 5 ȕ4'5 5  A'7' `@#`@`*  @@`*  @@`*  @T  @T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 /`@  `7@', @@8`'*@2 -2, @  ?#   * ?9@#.  ?$$$6`6'  @"6``4@  * . ?  @26`@4@2@@ /`T$   . " @?* :@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 8 2 + ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* J" @ J2  @(*`   * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@  @( *` @ (* + @ @ ` ``z  @Z( 2 "" 2 @  &H/ /!?"@! "!H  H/ /!?"@"!H  㿐 $!'! ` `'   @    !  $!$!$!! @$! 㿈@` $` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " ,  $  , "   $  * `$  2`  "  `$ H 㿘``@J  㿀@ '?'''@ђ '. u @  :ɐ$'*`  , `*` ,@$@$`" > |L@ /w `@J?`/?N /2 @ '''. ' ' ] /3. @ ''''' N''l'h''h Am 7ex /@ `@`$ `'@ "@@=  ' ? '; I` Dx0Ax?;    @ 2  *@  22" =!` = 8 "0 t@ ݔ )c@ "O |  b@ ":  @"? N?@ "" hI?@ .!> m |@ >?@ 9? ` @` @5 `@"  (`@%`}@*%? `@y`u@"?  1#?" . %#?" .`.`@.6  ' ' ' ' ' ' ' ' ' N'쀢'> n X* 'N4 '> n X* '/@/V?c?  & t@7  @     . . . . . . ** * * . *N  * * * **** . . . . . y. ' ' ' ' ' ' ' ' ' '@e'  ~@ "8  }@ @ ?# *` * * *& t@0 `#@9: &> m#`/>!xT +  $& '`& `bq &     2 40&? 㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0> m c >!w t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` 'H`@ 'P'l'd'h `(<  > b `7p v@8*  7$⬒` V`⬖ ''''''''?ؖlh d ;蠤7d 2  )$3>"@ta @ P  "  @$  ``‎  l "` H:⬐" d "8{ 8x  2@ "` 2` 2`  2`  2` 2` 0? 4"`"` "` "`  ("`( @"`0 <"`4 D"`8 H"`<㾰@ D'8''4''<   5&  X’` @㾰@ '8''4''<    X` @ @ 2 0  $ 0 ` 0 ,?`$ 0VҐ 0Xz `Ք @㿈`@: '?(㿈`@: '?x`ؖ`: @?'' ؔ &㿈`&@'''͒ N` հ  J@ 'x` 2`( 'x'|| <  'x`` '''`' '''$' |?X`@ 't ؖ  'x@: `%@8؄????'''  5' |  'x :` Ȕ$    *  'xI'x7( | Ŕx`G`耢@x> ) `ؐ????|@x 2v|x )`耢@2` | @ "`  X`< "` ` '| | "(<:` T|tΔ `'x"@& 0" 0`, xU`0x㿈@ `  '`?'>'>G㿈@ `  '`?'='=Ғh@``` 0& 0#``'`'` '' ` `'`''f ` `'`''`@``` 0-`  0(` `'`''` `'`''q`' ` `'`''X@``` 05`$ 00` `'`''i&``''``'`'` ''```'`'` '`''|㿈@ '''ے㿈` @'''}㿘`  6`>!:6&& & &&&& =  &$&  Z (D&(,<&,0 P&0TLL ZH ZP@ @'''''V  X``D`  `f!㾐@ $`( X``D``0?"`0`,  T9`0  `:!㾘> ` $` $@2` 9 />   h `(!6  D ` hH! aU$ΐ` $ &&F0& > H "x`>" `J `@'` ''''`  '`   '` ! '` ( '``: '?{؁㿈` ''@#\  I 㿈 @<!:   ` '@#\ I X>b > ax >b >J#ז#>J(2  J J* ) * JJ#2 J J* :  b*쳔 @8 㿈ң ` !   `7   㿈  `  2 `7   㿈׮ `  2 `7   p` ` `'''@''Ԙ'''ե 㿘`  "` ;8`   7#3 (`*` 2 ` @'* `@k'쀢`   `` 3 p`` ` ''@''Ԙ''''؁8` [  (#$ (`*` 1 D*  ` '@'3K 㿐@`(  *`  '#'@ * @` '#'` 㿀`     : :`?@?<^ > 8" > Ԑ "㿈` ''@#\  G p` Ӕ  @?# @c"?`ea"` b`+ -0% -0"4`fd, -07!@? -03`` ` ` ''''#\' ܘ Ӛ o` ` `` ?'#\  `  '#\ ܘ w R` '#\ ܘ G F#> baM `> b!xH P `& >bߐs  `& $>bՐi $ `$a> <bʐ^ `$` `' ܀8'ܐ= ܀ ````3?  &``( 㿘 @:!: @> ""԰ 㿈 @:!:   ` '@#\ G  vm_map_lock_read: intrsafe mapdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrgifsystraceksymsccdvndtbptygrevlanbridgeenctunsppppppslbpfilterlooppflogpfPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sTarget %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'Fabric Nameserver rejected %s (Reason=0x%x Expl=0x%x) for Port ID 0x%x(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)????21002200230023121240bus %d is in %s Mode1280108012160LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dRam Checksum Failureskipping f/w downloadBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dloadedresidentFirmware Attributes = 0x%xInstalled in 64-Bit PCI slotLast F/W revision was %d.%d.%d%d max I/O commands supportedCannot setup DMAfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xNot using any WWNsisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xF Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08x2Gb link speed/sConfig WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?????giving up on synchronizing the port databaseRemap OverflowNo LoopFailed to allocate IOCB bufferFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a target%xSNS Failed- %sGID_FTGPN_IDGNN_IDfabric too big for scratch areaRegister FC4 types succeededAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceRequest Queue OverflowRequest Queue Overflow+out of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldUnknown Control Opcode 0x%xdriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abortMbox Command Async (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyoptr %x soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xQueue Entrycontinuation segmentinternal queues fullbad header flagbad request packetunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)asked for %ld got resid %ldRequest Queue Entry bounced backunhandled response queue type 0x%xAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)Unknown Async Code 0x%xfast post completion of %uIgnored Continuation ResponseUnhandled Response Type 0x%xSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=> GOT_BUS GOT_TGT SENT_CDB XFRD_DATA GOT_STS GOT_SNS XFR_CMPLT status=> Disconnect Sync_xfr Parity Bus_Reset Device_Reset Aborted Timeout Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freemarkednot markedInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport unavailable for target %dport logout for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%xCommand for fast post handle 0x%x not foundGET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET/SET DATA RATEGET PORT DATABASE,, ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTSLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDREAD RAM WORD EXTENDEDUnknown Command 0x%xno parameters for 0x%xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USETIMEOUTerror 0x%xMailbox Command '%s' failed (%s)skipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xUsing Node WWN 0x%08x%08xUsing Port WWN 0x%08x%08xisp_reinit cannot reset cardisp_reinit cannot restart cardinvalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understoodNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM: maxfrmlen %d execthrottle %d fwoptions 0x%x loopid %xPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sispadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%dfinished command on borrowed timerestarting blocked queuewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandrestarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATERrequeued %d commands, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08xTarget/InitiatorInitiatorTargetNoArrivedDepartedName Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port%s Fabric Device @ PortID 0x%xout of space for fabric devicesInternal Firmware Error on bus %d @ RISC Address 0x%x%s: espFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure %d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%d sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not exist ncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p [flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: lost carrier %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d /dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf: state insert failed: tree_lan_ext lan: gwy: ext: pf: state insert failed: tree_ext_gwydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf.cpeerpeer->state == cur->statepf_dynaddr_update%u.%u.%u.%u:%u:%x[%u]TCP UDP ICMP ICMPV6 %u [lo=%lu high=%lu win=%u modulator=%u] %u:%uFSRPAUEWpf: NAT proxy port allocation (tcp %u-%u) failed pf: NAT proxy port allocation (udp %u-%u) failed pf: loose state match: seq=%lu ack=%lu len=%u ackskew=%d pkts=%d pf: BAD state: seq=%lu ack=%lu len=%u ackskew=%d pkts=%d dir=%s,%s inoutfwdrevpf: State failure on: %c %c %c %c | %c %c pf: ICMP error message too short (ip) pf: ICMP error message too short (ip6) pf: ICMPv6 short opt pf: ICMP error message too short (tcp) pf: BAD ICMP state: seq=%lu pf: ICMP error message too short (udp) pf: ICMP error message too short (icmp) pf: ICMP error message too short (icmp6) pf: ICMP error message for bad proto non-M_PKTHDR is passed to pf_testpf: dropping packet with ip options pf: IPv6 short opt pffrentpffragpffrcachepffrcentdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf_norm.cBUFFER_FRAGMENTS(frag)%s: pf_purge_expired_fragmentsexpiring %d(%p) !BUFFER_FRAGMENTS(frag)TAILQ_EMPTY(&pf_cachequeue) || TAILQ_LAST(&pf_cachequeue, pf_cachequeue) != fragpf_flush_fragmentstrying to free > %d frents trying to free > %d cache entries LIST_EMPTY(&frag->fr_cache) || LIST_FIRST(&frag->fr_cache)->fr_off > frcache->fr_endfrag == NULL || BUFFER_FRAGMENTS(frag)frep != NULL || frea != NULLpf_reassembleoverlap -%d adjust overlap %d missing fragment at %d, next %d, max %d %d < %d? frent != NULLdrop: too big: %d complete: %p(%d) frag == NULL || !BUFFER_FRAGMENTS(frag)pf_fragcachefragcache[%d]: new %d-%d frp != NULL || fra != NULLfragcache[%d]: dead (%d-%d) %d-%d fragcache[%d]: adjacent (%d-%d) %d-%d fragcache[%d]: chop %d (%d-%d) %d-%d (*m0)->m_next == NULLm->m_len == h->ip_len - precutfragcache[%d]: gap %d (%d-%d) %d-%d fragcache[%d]: adjacent %d-%d (%d-%d) fragcache[%d]: chop %d %d-%d (%d-%d) m->m_len == h->ip_len - aftercutfragcache[%d]: gap %d %d-%d (%d-%d) fragcache[%d]: adjacent(merge %d-%d) %d-%d (%d-%d) cur == NULLfragcache[%d]: done 0-%d fragcache[%d]: dropping overall fragment pf_normalize_ipIP_DF mff and %d max packet %d reass frag %d @ %d-%d dropping bad fragment pftrplpfruleplpfnatplpfbinatplpfrdrplpfstateplpfaddrpf: started pf: stopped redcbqnoqaltq assertion "%s" failed: file "%s", line %d altq assertiontbr_set: no cpu clock available! ip4f_init: can't alloc %dth entry! altq: emulate %uHz cpu clock red_detach: no state found in red_list! invalid weight value %d for red! use %d wtab_alloc: malloc failed!cbq_add_class: no parent class! cbq_add_class: borrow class != parent No Root Class for %s No Default Class for %s No Control Class for %s %srmc_newclass: RIO not configured for CBQ! rmc_init: root class not allocated _rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_root_overlimita.out[ %s symbol table has bad start address %p ] [ %s symbol table has bad string table address %p ] [ %s a.out symbol table not valid ] [ %s has bad a.out string table index (0x%x) ] [ using %ld bytes of %s a.out symbol table ] gcc_compiled.???All breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d * %-12s? No such command Ambiguous Bad modifier Count missing Malloc debugging not enabled. calloutprocswatchesuvmexpregisterspoolpageobjectmapmallocextentsbreaksallpoweroffreboothaltdumpcrashsynchangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine ddb> Bad function Too many arguments Argument missing %#n ELF[ %s symbol table has bad start address %p ] ELFbad magicbad e_machine.strtab.symtabsymtab unalignedsymtab corrupted[ using %lu bytes of %s ELF symbol table ] [ %s ELF symbol table not valid: %s ] : = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o%*r%*x%*z%*d%*u%*o Bad modifier bhlAddress missing Value missing Count missing Symbol not found Syntax error Divide by 0 Negative shift amount ^R Bad character in number Bad escape String too long Bad character --db_more--  -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*luFaulted in traceback, aborting... Starting stack trace... End of stack trace. %-12s%#*ln %s+%#lr [after %6d] bsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s %s Sifting table %s: %s+%s [%s:%d]After %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! linestabstopsmaxwidthmaxoffradixUnknown variable No value ? All watchpoints used. No map. Already set. Too many watchpoints. Not set. No watchpoints set Map Address Size %s%p %8lx %lx * Unknown size %#8n = %#8n Nothing written. 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| () Score: %lu/%lu vm_map_lock_read: intrsafe mapcdlinemicheadphonesspeakeraudio audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmasterauddetaudiodetach: %s didn't detach audio_attach_mi: NULL oplmpuaudioprint: unknown type %d%s at %saudio_open: 0 precision audio_drain: copying in progress!?! aud_draud_hraud_rdaud_wraudio_write: cc == 0, swcode=%p, factor=%d vm_map_lock_read: intrsafe mapccdattach: count <= 0WARNING: no memory for concatenated disks ccd%dccdbufferccdintrccdiodone (mirror)%s: error %d on component %d%s ccdiodone: countccdfictitiousdefault labelccdlckMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... vm_map_lock_read: intrsafe mapsystrrd%s: attach to %u: %d systracef_ioctlstrprocplstrpolplsystracesystrace_forkdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/systrace.cstrp->proc == p%s: %u: policy %d systrace_answer%s: new, ents %d systrace_policy%s: %d -> pid %d %s: %d: code %d -> policy %d %s: %d systrace_getcwd%s: %u: %p(%lu) systrace_io%s: Trying to detach from %d systrace_detach%s: allocating %d -> %lu systrace_newpolicysystrmsg%s: %p: pid %d -> pid %d systrace_msg_childvm_map_lock_read: intrsafe mapWARNING: no memory for vnode disks vnd devicefictitiousvndiodonevnd%dvndioctl: null vpvndlckvm_map_lock_read: intrsafe map;n vAMaX ֣d° xrndrdvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_inactive: pushing activecd9660_reclaim: pushing activevm_map_lock_read: intrsafe mapRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASPvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] vm_map_lock_read: intrsafe map..cd9660_strategy: spectag VT_ISOFS, isofs vnode vm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0OpenBSDsys_execve: RELATIVE without basevm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessarydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/exec_subr.cocnt > 0vm_map_lock_read: intrsafe mapCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2002 OpenBSD. All rights reserved. http://www.OpenBSD.org swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedcryptocrypto thread/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spaceexec %s: error %d init: not found no initvm_map_lock_read: intrsafe mapacctAccounting resumed Accounting suspended vm_map_lock_read: intrsafe mapfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfilefdexpandclosef: count < 0closefclosef: count: %d/%dkqeueplknoteplkqreaddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDvm_map_lock_read: intrsafe mapexecve: argp == NULLexecve: no vmcmdssys_execve: RELATIVE without basesys_execve: falloc indx != ikernel mapping failed %d user mapping failed vm_map_lock_read: intrsafe mapinit died (signal %d, exit %d)reaperwaitvm_map_lock_read: intrsafe mapprocppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qvm_map_lock_read: intrsafe mapktrace write failed, errno %d, tracing stopped lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: LK_RELEASE of unlocked locklockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendingvm_map_lock_read: intrsafe maplkmopnDDB symbols added: %ld bytes temprp_addrip6rrNDPip6_options1394data1394ctlpacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataEXT2FS nodeadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeLFS nodeLFS segmentsubprocproclockffile descfileVM pvmapVM pmapVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopsnameisysctlsooptsifaddrfragtblroutetblpcbdevbufmbuffreemalloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple freeskmeminit: minbucket too small/struct freelist too big%d,%s,physbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbuf: private buf B_WANTEDprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0chgproccnt: lost userenterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curprocplimitplvm_map_lock_read: intrsafe mapsigaplpausepsignal signal numberProcess (pid %d) got signal %d issignal postsigpostsig actionpid %d was killed: %s sorry, pid %d was killed: %s %s.coreuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cnthook_disestablish: hook not establishedpowerhook_disestablish: hook not establishedvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlock%s,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_synch.cphztsleepsleep called with priority %d > PZERO, wchan: %p old sleepsleepwakeuppreempt: cpu_preempt not yet implementedmi_switchsetrunnablemawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-9s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-9.9s %-16s %-16s %-8s %18p %s vm_map_lock_read: intrsafe mapdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks < 0?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func >>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s (root)%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failedconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_activate_children: shouldn't get hereevcnt_attach%s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs extentplextent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixedextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx vm_map_lock_read: intrsafe mapklogvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpoolpool_destroy: pool busy: still out: %u pool_set_drain_hook(%s): already setpool_get: must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistent pool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %p pool_get: nidle inconsistentpool_get: %s: nmissing inconsistentpool %s: putting with none out pool_putpool_put: %s: page header missingpool_prime_page: %s: unaligned pagepool %s is locked; try again later POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu page list: page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULLvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%d%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad base?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device enabled %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... selectpollpipespace: out of kvmpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipeplptrace: impossiblevm_map_lock_read: intrsafe mapmsginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULLmsghdr->msg_spot out of rangemsghdr->msg_spot != -1sys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed upmsgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segmentsmsg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3sema is NULLsemu is NULLsemu_alloc - second attempt failedsemwaitsemop - can't undo undossemexit - semid not allocatedsemexit - semnum out of rangeshmgetshmseg free count inconsistentvm_map_lock_read: intrsafe map@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk tty_detach: tty_count < 0vm_map_lock_read: intrsafe mapputc: required clalloc b_to_q: required clalloc PTCLPTRTCN46vm_map_lock_read: intrsafe mapWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsofreesoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3sonewconnsoqinsquediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress (sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d acceptvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrrequnp_attachunp_connect2unp_disconnectvm_map_lock_read: intrsafe mapbremfree: lost tailbufplbuf_dirtybuf_undirtygetblkallocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsizegetnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependenciescleanerClean buffer on BQ_DIRTYbiowaitbiodonebiodone alreadyvm_map_lock_read: intrsafe mapcache_enter: name too longnchplvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bpcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memorycluster_callbackcluster_callback: too little memorycluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeallvm_map_lock_read: intrsafe mapoperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.vm_map_lock_read: intrsafe maplf_findoverlap: defaultvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vm_map_lock_read: intrsafe mapvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'svgetvref used where vget requiredUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvclean: lock not drainedvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) kinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbrelvp: holdcntbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vm_map_lock_read: intrsafe mapsched_sync: fsync failedsyncersyncer vnode vm_map_lock_read: intrsafe mapvfslockmount: lost mountunmount: dangling vnodevm_map_lock_read: intrsafe mapvn_lockvm_map_lock_read: intrsafe mapdefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_selectvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritevm_map_lock_read: intrsafe mapdead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockvm_map_lock_read: intrsafe mapfdescvm_map_lock_read: intrsafe mapfdfsfdttystdinfd/0stdoutfd/1stderrfd/2..fdesc_getattr%dtag VT_NON, fdesc vnode fdesc: bad opvm_map_lock_read: intrsafe mapfifo_read modefifo_write modetag VT_NON , fifo with %ld readers and %ld writersfifo_badop calledvm_map_lock_read: intrsafe mapkernfs_get_rrootdev: no raw root device kernfs.kernfs_root: findtarget returned NULL kernfs_root: couldn't find root vm_map_lock_read: intrsafe mapipsecversionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...kfs%ld %ld %d %d %d %d %ld %u tag VT_KERNFS, kernfs vnode: name %s, vp %p, tag %d kernfs: bad opvm_map_lock_read: intrsafe mapnull_node_find: vget failed. null_node_alloc: no alias for devicenull_node_create: aliasnull_node_create: lower has 0 usecount.vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapnull_bypass: %s tag VT_NULLFS, vp=%p, lowervp=%p nullfs lowervpvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapportal_closefd: error = %d portalconportal_open: %d extra fds tag VT_PORTAL, portal vnode portal: bad opvm_map_lock_read: intrsafe map(%s)vm_map_lock_read: intrsafe mapwaitrunstepdetachattachusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_controlvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %u, %u,%u vm_map_lock_read: intrsafe mapprocfslprocfs_allocvpvm_map_lock_read: intrsafe mapprocfs: invalid directory entry sizeprocfsvm_map_lock_read: intrsafe mapexecmdlinenotepgnotestatusctlfpregsregsmemfile...cpuinfomeminfotag VT_PROCFS, type %d, pid %d, mode %x, flags %lx %ldprocfs_getattrcurprocself%svm_map_lock_read: intrsafe mapspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledvm_map_lock_read: intrsafe mapumap_node_alloc: no alias for devicevm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapumap_bypass: %s umap_bypass: user was %u, group %u umap_bypass: user now %u, group %u umap_bypass: component credit user was %u, group %u umap_bypass: component credit user now %u, group %u umap_bypass: returning-user was %u umap_bypass: returning-user now %u umap_bypass: returning-component-user was %u umap_bypass: returning-component-user now %u umap_getattr: mapped uid = %u, mapped gid = %u umap_getattr: original uid = %u umap_getattr: original gid = %u tag VT_UMAPFS, vp=%p, lowervp=%p umap_rename: rename component credit user was %u, group %u umap_rename: rename component credit user now %u, group %u vm_map_lock_read: intrsafe mapunlstlkunion: unidentifiable allocationunion: . not lockedunion: allocvp not lock ownerunallvpunion: dircache table too smallvm_map_lock_read: intrsafe map:::union_mount: bad um_opvm_map_lock_read: intrsafe mapunion_lookup returning. (%x) not same as startdir (%x)union: missing upper layer in writeunion remove: null upper vnodeunion_link called without LOCKPARENT set! union rmdir: null upper vnodeunion: dangling klockunion: dangling upper lock (%lx)union: locking against myselfunionlkunion: unlock unlocked nodeunion: unlocking other process's union node tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p uppervplowervpdircache:union_strategy: nil vpunion_strategy: writing to lowervpvm_map_lock_read: intrsafe mapdos2unixtime(): month value out of range (%ld) vm_map_lock_read: intrsafe mapdenodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activevm_map_lock_read: intrsafe mapfatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmapvm_map_lock_read: intrsafe map. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? vm_map_lock_read: intrsafe mapRRaArrAaUmsdosfs_sync: rofs modvm_map_lock_read: intrsafe mapmsdosfs_create: no namemsdosfs_write(): bad file typemsdosfs_rename: no namemsdosfs_rename: lost to startdirmsdosfs_rename: lost from startdirrename: lost dir entrymsdosfs_rename: updating .. in root directory?msdosfs_mkdir: no name...msdosfs_strategy: spectag VT_MSDOSFS, startcluster %ld, dircluster %ld, diroffset %ld dev %d, %d, %s (LOCKED)vm_map_lock_read: intrsafe mapbpf: ifpromisc failedbpf_detachd: descriptor not in listbpfbpf_mcopybpfattachif_attachhead: mallocif_attach: mallocif_downif_up%s: can't handle af%d d;n &0vAkkQMaXPq< D֣ad°Ԡ x!! $ l t X @ lcp!!H \ D L T d ipcp#!   t    pap#!    h      lchap%s: input packet is too small, %d bytes %s: PPP packet in Cisco mode %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow %s: no memory for transmit header %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%lx %s: loopback %s: up %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: %s output <%s id=0x%x len=%d> %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s up(%s) %s: %s down(%s) %s: %s open(%s) %s: %s close(%s) %s: %s TO(%s) rst_counter = %d %s: %s %s->%s %s: Up event(incoming call) %s: Down event (carrier loss) %s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] send conf-nak max_failure (%d) exceeded, closing send conf-ack %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: lcp nak opts: magic glitch %d %s: phase %s %s: ipcp_open(): no IP interface %s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack %s: ipcp rej opts: %s: ipcp nak opts: [wantaddr %s] [agree] %s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%d%s: chap TO(%s) rst_counter = %d %s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging supressed %s: chap tld %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: pap TO(%s) rst_counter = %d %s: pap peer TO %s: pap tld %s: down conf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%xchallengeresponsesuccessfailurereqacknakmruasync-mapauth-protoqual-protomagicproto-compaddr-compaddressescompressionaddressinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegaldeadestablishterminateauthenticatenetwork %02x-%02x\x%x%c%d.%d.%d.%dlo%dlooutput: no header mbuf%s: can't handle af%d lo_altqstart: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_setifmedia_match: multiple match for 0x%x/0x%x sl%dsl%d: can't allocate buffer %s: af%d not supported ppp%dpppdealloc%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x %s: af%d not supported %s output: ppp_requeuepppintrif_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full %s vm_map_lock_read: intrsafe map%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! %s input: %s bsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary z_compress: deflate returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_incomp%d: inflateIncomp returned %d (%s)       %0!%ư!\!unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check??invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat #+3;CScs !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream endvm_map_lock_read: intrsafe maptun%dtunreadbridge%dbridge_input(): no HDRbridge_broadcastvlanattach: MALLOC failedvlan%dvlan_start: impossible (altq)%s: initialized with non-standard mtu %d (parent %s) %sdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/if_vlan.cmc != NULLrn_addmask: mask impossibly already in treeMask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtrequest deletertinit: wrong ifa (%p) was (%p) /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/route.crt_init_done == 0rt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputrt_msg1routeenc%dpflog%dgre%darp_rtrequest: bad gateway value arp_rtrequest: malloc failed arpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! arp: ether address is multicast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s arptfreearplookup: unable to enter address for %s revarp[NULL][%d,] ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) in4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data in_controlinvalid argument to in_lifaddr_ioctlIPv6 pcb passed into in_pcbconnectin_pcbnotifyin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d in6_pcblookup_connect: faddr= fport=%d laddr= lport=%d interneticmp_erroricmp lenicmp_mtudisc_timeout: bad route to timeouticmp_redirect_timeout: bad route to timeout %d.%d.%d.%dipqeplip_initaeshmac-sha1deflateipintr no HDRattempted source route from %s to %s save_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %dmalformed IPv4 option passed to ip_optcopyrip_attachrip_detachrip_usrreqtcp_sack_optiontcp_pulloutofbandtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_output REXMTtcpcbplsackhlpltcp_initassumption failed in tcp6_ctlinputUdXY[,tcp_usrreqIPv6 inpcb to udp_outputudp_usrreqIPcompIPsec ESPIPsec AHIPv4 Simple Encapsulationno tdb hash table tdb cnt bucket cnt %d%c %d +uniqueinvalidhalfivpfstunnelingnoreplayrandom paddingskipcryptousedtunnel!X!`!h@!p!x!ψ !Ϙ@!Ϩ!ϸSPI = %08x, Destination = %s, Sproto = %u Established %d seconds ago Source = %s, Proxy = %s MTU: %d, expires in %llu seconds Local credential type %d Remote credential type %d Local auth type %d Remote auth type %d Flags (%08x) = <none> %s,> Crypto ID: %llu xform = <%s> Encryption = <%s> Authentication = <%s> Compression = <%s> Next SA: SPI = %08x, Destination = %s, Sproto = %u Previous SA: SPI = %08x, Destination = %s, Sproto = %u %llu bytes processed by this SA Last used %llu seconds ago Last marked/unmarked %llu seconds ago Expirations: Hard expiration(1) in %llu seconds Soft expiration(1) in %llu seconds Hard expiration after %llu bytes Soft expiration after %llu bytes Hard expiration after %u flows Soft expiration after %u flows Hard expiration(2) in %llu seconds Hard expiration in %llu seconds after first use Soft expiration(2) in %llu seconds Soft expiration in %llu seconds after first use (none) Hashmask: %d, policy entries: %d %d.%d.%d.%d(unknown address family)ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) ipsec policyipsec acquireipip_input: should never reach hereipe4_input(): should never be called ah6_input: l went zero or negativeesp6_input: l went zero or negativeipcomp6_input: l went zero or negativecc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("cryptopcryptodesccrypto_waitcrydevcuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: empty%s: len %d < 0cuio_apply%s: off %d < 0m_apply: null mbuf in skipm_apply: null mbufSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESARC4HMAC-MD5HMAC-SHA1HMAC-RIPEMD-160Keyed MD5Keyed SHA1MD5SHA1Deflatebind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d vm_map_lock_read: intrsafe mapnfs_read modenfsbioread nfsbioread: type %x unexpected nfs_write modenfs_write procnfsvinvalProcess killed due to text file modification nfs_doio: type %x unexpected nfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply vm_map_lock_read: intrsafe mapnfs_hashlocknfsnodeplnfs_inactive: pushing activenfs_reclaim: pushing activevm_map_lock_read: intrsafe mapbuild > MLENnfsrv_read iovnfsrv_write: nd_mrep not freenfsrvw_coalescenfsrv_coalesce: bad offvm_map_lock_read: intrsafe mapnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilis alive againnqnfstrybuild > MLENnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s nfs getstreamnfsd wakeupvm_map_lock_read: intrsafe mapnfsrcnfsrv cachevm_map_lock_read: intrsafe mapbuild > MLENnfsm_uiotombuf: iovcnt != 1nfs S too bigvm_map_lock_read: intrsafe mapcld kerbnqnfstimrnfsd initnfsdmbuf siz=%d Bad nfs svc replynfsidlnfsionfsauth1nfsauth2nfs_getnickauth verf too smallvm_map_lock_read: intrsafe mapbuild > MLENrootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap nfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfsconnfsdismvm_map_lock_read: intrsafe mapbuild > MLENopen eacces vtyp=%d EEK! readdirrpc resid > 0 EEK! readdirplusrpc resid > 0 nfs: sillyrename dir .nfsA%05x4.4nfs physio/asyncnfsfsyncnfs_fsync: not dirtynfs_fsynctag VT_NFS, fileid %ld fsid 0x%lx bwrite: buffer is not busy???vm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cylffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapuid %u on %s: %s vm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapffs_isblockffs_clrblockffs_setblockffs_isfreeblockvm_map_lock_read: intrsafe mapffs_mountroot: can't setup bdevvp'sffsroot_deviceWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1ffs_statfsfs = %s update: rofs modinodeffsinovm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %dffs_write%s: nonsync dir write%s: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyvm_map_lock_read: intrsafe mapdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepinvalidsema_release: not heldsoftdep_free: unknown type %dadd_to_worklist: already on list%s_process_worklist: Unknown type %ssoftdep???softdep_move_dependencies: need merge codesoftflushpagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplsoftdep_setup_inomapdep: found inodesoftdep_setup_blkmapdep: found blocksoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the head softdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entryallocdirect_check: old %d != new %d || lbn %ld >= %dnewfreefrag: frag sizesoftdep_setup_allocindir_page: Bonk art in the head setup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %scheck_inode_unwritten: busy inodehandle_workitem_freeblocks: block counthandle_workitem_freeblksindir_trunc: lost indirdepindir_trunc: dangling depfree_diradd: unfound refnewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %dsoftdep_change_linkcnt: bad deltahandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncatehandle_workitem_freefilesoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %sinitiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepageinitiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2disk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %shandle_allocdirect_partdone: dangling dephandle_allocindir_partdone: dangling dependencyhandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %dhandle_written_inodeblockdirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedephandle_written_mkdir: bad typehandle_written_filepage: not startedhandle_written_filepage: attachedsoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedsoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirtysoftdep_sync_metadata: Unknown type %sflush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedrequest_cleanup: unknown typesoftupdateclear_remove: vgetclear_remove: fsyncclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2softdep_check_for_rollback: Unexpected type %ssdsdtydrain_outputsoftdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error%s: got error %d while accessing filesystem vm_map_lock_read: intrsafe mapmfs_mountroot: can't setup bdevvp'smfsmfs_rootmfs_mount: dup devmfsidlvm_map_lock_read: intrsafe mapmfs_open not VBLKmfs_strategy: bad devmfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_closemfs_inactive: not inactive (mfs_buflist %p)tag VT_MFS, pid %d, base %p, size %ld mfs_badop calledvm_map_lock_read: intrsafe mapufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specified ufs_getlbns: indirect block %d not foundvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapffs_inactive: pushing activeufs_reclaim: pushing activevm_map_lock_read: intrsafe mapmangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory vm_map_lock_read: intrsafe mapundefinedgroupuserchkdqufs_quota_free_blocks2: vnode is not locked %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too longchkiq %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too longchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquotquotaon: mount point not busyquotaoff: mount point not busysetquotasetusedquotfree dquot isn'tdqsync: dquotdqsync: filedqsyncvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapchown: lost quotaufs_link: no nameufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown opufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_mkdir: no nameufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no namevm_map_lock_read: intrsafe mapext2fs_alloc: missing credentialfile system full %s: write failed, file system is full mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapbad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodestart = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapuid %d on %s: %s vm_map_lock_read: intrsafe mapext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cachevm_map_lock_read: intrsafe mapext2fs_inactive: pushing activeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapext2fs: e2dir->e2d_namlen mangled entryi_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrydirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2checkpath: .. not a directory checkpathvm_map_lock_read: intrsafe map%s: modeext2fs_read%s: short symlink%s: type %dext2fs_write%s: nonsync dir write%s: typevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapvm_map_lock_read: intrsafe mapext2fs_mountroot: can't setup bdevvp'sext2fsroot_device%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsfs = %s update: rofs modinodeExt2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optional feature vm_map_lock_read: intrsafe mapext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_makeinode: no nameext2fs_reclaim: pushing activediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing therevm_map_lock_read: intrsafe mapamappl/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countvm_map_lock_read: intrsafe mapuvm_anon_add: can not allocate %d anons uvm_anon_adddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_anon.cpg->loan_count > 0anon_pagein: uvmfault_anonget -> %dvm_map_lock_read: intrsafe mapuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getpageuao_getpg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)(pg->flags & PG_RELEASED) == 0vm_map_lock_read: intrsafe mapudv_attachdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detachudv_faultvm_map_lock_read: intrsafe mapfltamapcopyanonget1anonget2flt_noram1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->endvm_map_lock_read: intrsafe mapuvm_fork: uvm_fault_wire failed: %dschedulerschedpwaitvm_map_lock_read: intrsafe mapuvm_init: page size not setvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerUVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0vm_map_pmap(map) == pmap_kernel()km_getwait2uvm_km_alloc1: non-released pagekm_allockm_alloc1wvallocwaitvm_map_lock_read: intrsafe mapuvm_loan: intrsafe maploanagainfltagain2uvm_loanuobj: object has no releasepg functionloanzero1loanzero2uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!vm_map_lock_read: intrsafe mapvmmaplkvmmapbsydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?%s: %d/%d ownspace %x != %x %s (last)%s: space %d != %d %s: corrupt: %p >= %p %s: nentries: %d vs %d %s: lookup: %d: %p - %p: %p uvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)uvm_mapent_alloc# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekplUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthvm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> BUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJPAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page_i.hpg->wire_count == 0lcv != -1/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapvum_page_physget: out of memory!uvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %d uvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d obj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %dsaved_loan_count == 0vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager_i.hrvpg != NULLemergva/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY!uobj || obj_is_aliveuvm_aio_biodoneuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0vm_map_lock_read: intrsafe mappagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0vm_map_lock_read: intrsafe map%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem/mb)=%p/%p/%p vm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in list swstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filesw_reg_iodonevnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrvm_map_lock_read: intrsafe mapswap_decrypt: key not initializedvm_map_lock_read: intrsafe mapsbrk: %s %ld failed, return = %d growshrinkuvm_coredump: user process with submap?vm_map_lock_read: intrsafe mapuvm_deallocate with null mapvm_map_lock_read: intrsafe mapuvnsyncuvn_attach: blocked at 0x%p flags 0x%x uvn_attachuvn_deref: vnode VM object still has pages afer syncio/free flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncHuh? Thought in6_pcbnotify() never got called with mapped! gif%dgif_output: recursively called too many times NULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin6_ifloop_request: %s operation failed for %s (errno=%d) ADDDELETEprefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_ifawithscope: output interface is not specified %s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) bridgein6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled %s: didn't unlink in6ifaddr from list in6_cksum: mbuf len (%d) < off+len (%d+%d) in6_cksum: out of data internet6m_pulldown malfunctionm_pulldown malfunction%s:%d: ip6q already locked /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/frag6.cip6q_lock%s:%d: ip6q lock not held ip6q lock checkicmp6_mtudisc_callback_registerm_pulldown malfunctionENOBUFS in icmp6_error %d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_notify_error: in6_embedscope failed should not reach heresanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d (src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s assumption failed in %s:%d icmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s m_pulldown malfunctionip6_pullexthdr: invalid nxt=%d ip6_nexthdr: m == NULLOpenBSD-currentcannot forward from %s to %s nxt %d received on %s cannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s register_mifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriescannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitm_pulldown malfunctionm_pulldown malfunctionnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_option uninitialized ndopts in nd6_option ndopts == NULL in nd6_options uninitialized ndopts in nd6_options duplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt rt=0 in nd6_timer(ln=%p) rt_llinfo(%p) is not equal to ln(%p) dst=0 in nd6_timer(ln=%p) nd6_lookup: failed to lookup %s (if = %s) unspecnd6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) default router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address ifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) defrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_addifreq: failed to install a route to interface %s (errno = %d) dr == NULL in defrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: there's no default router and no default interface defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) in6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_attachrip6_detachrip6_usrreqPF_KEYipsec policyaes3desdesblowfishskipjackcast128deflatehmac-sha1hmac-ripemd160hmac-md5vm_map_lock_read: intrsafe mapiommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameobiovmelvmesvme%s at %s addr %p vec 0x%x"@"8"0" interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxregmatch no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02modelno prop: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintr;Zx0NWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! power ledleds sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s %s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemeintr%s: channel %dzs_set_speedttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. fdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo drive %d[version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c fdprobe: %d stati: %x : %s %d cyl, %d head, %d sec : density unknown fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive fdc reset fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %s cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d timeoutfdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossiblehard errorfdioctl: impossiblefdformat: blkno %x count %ld fdformfloppy diskfictitious%s: %s Insert filesystem floppy and press return.sbusslave-only%s at %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supportedsbus_establish: can't find sbus parent for %sreset %s:%s: dma card found in non-dma sbus slot %d: not supported zstty flags 0x%xinputoutput (console %s)i/okeyboardmouse: %s zs_shutdown: not enabled?%s: device enable failed %s: %d silo overflow%s, %d ibuf flood%s s '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| " O"  " " O"  "zskbdkeyboard, flags 0x%xkeyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : reset timeout %s: reset: invalid keyboard type %x %s: %d silo overflow%s, %d ibuf flood%s smii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failed mii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@mii_phy_setmediamiiautnsphy: %s, rev. %d DP83840 10/100 media interfaceqsphy: %s, rev. %d QS6612 10/100 media interfacescxsplgetxscannot allocate scsi xs scsi_free_xscould not get size scsi_donescsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossiblescsi_scsi_cmd: buffer without nosleepscbusyunknown error category from scsi driver DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) %s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense#X#@#######`#0######p#X#(####X#(#####h #P #8 # # # # # ##p#X#@# ######h #X #@ # ####h#P#0######p#@# ####h#0####`#8######x#P#0## # # # # p# X # 8!# !# "# $# %# &# h&# P&# 8&# '"8(# (# )# *# h*# P*# 8+# ,# ,# ,# -# p/# H0# (0# 0# 0# 1# 1# 2# X2# 83# 6# 7#9#:#;#;#h;#@;#;#;#;#;#;#; #x; #X; #8; #; #;#=#>#?#P?#8?#?#@#A#B#xC#hD#PE#0F#G#H#I#J#K#L#`N#@P#(P#P#Q#R#S#S#S#hT#@U#(W#X#Y#Z#Z#hZ#HZ#([#[#[#[#\#\#\#x`#ha#Pa#8a#(b#c#d#Illegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode 0x%x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %dscsi_user_doneUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrscsi_do_ioctl: impossiblescsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEBCD-24XBCD-16XSW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROP0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM C-OLYMPUS 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixedDECTZ30TK50 not configured vm_map_lock_read: intrsafe mapcdNEC CD-ROM DRIVE:260 cdstart%s: not queuedATAPI CD-ROMSCSI CD-ROMfictitious8ˌTcd_scsibus_get_mode: Mode page %02x request bad size: %d bytes cd_scsibus_set_mode: Set mode request bad size: %d bytes \,ch02009000SPECTRA %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s%s: warning, READ ELEMENT STATUS avail != count %s: could not sense element address page %s: could not sense capabilities page vm_map_lock_read: intrsafe mapsd %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook sdstart%s: not queued, error %d SCSI opticalSCSI disk%s %s%s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d p%s: strange capacity descriptor byte5 0x%x h%s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry %s: WARNING: cache synchronization failed ????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled%s: already open %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d ststart%s: not queued %s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d genericFujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ssC7670A C6270A C7190A C5190A C6290A C5110A C1130A C2520A C2570A C2500A C1790A C1750A HP MUSTEK %s: %s %s: generic scanner %s: already open %s: not queued %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi %s: not queued mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC2570AHP ScanJet 3pC2520AHP ScanJet 3c/4c/6100CC1130AHP ScanJet 4pC5110AHP ScanJet 5pC6290AHP ScanJet 4100CC5190AHP ScanJet 5100CC7190AHP ScanJet 5200CC6270AHP ScanJet 6200CC7670AHP ScanJet 6300C set_window failed compute_sizes failed %s: set_window failed %s: compute_sizes failed *f0S%s: trigger_scanner failed %s: not queued *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a4T*a1I*a5T*u2T*a%dG*a%dL*a%dK%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Euk %s: unknown device %s: already open dmaledma[%s at %s] offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameesp%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/GENERIC/../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer[%s at %s] offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintrespaudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio: expected 1 interrupt, got %d pri %d, softpri %d intrmulawmicvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecordaudiocsSUNW,CS4231: expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d, softpri %d intr%s: error interrupt %s: timeout waiting for reset mulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration micvolumedaclinecdmonitoroutputmuteonoffrecordsourcespeakerheadphonesinputsoutputs%s: attempt to free rogue pointer cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %x %s: trigger_input: already running %s: trigger_input: bad addr: %x depthwidthheightlinebytesfb_setsize: inappropriate bustypescreen-#rowsscreen-#columnsvm_map_lock_read: intrsafe mapwsdisplaydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memory wsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl deviceWSSCREEN_HAS_EMULATOR(scr)sc != NULLwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wscons: copybuffer memory malloc failed vt100"l#43M$d%`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100.cedp->console == 1wsemul_vt100_output_c0c1: ESC in kernel output ignored edp->tabs != 0wsemul_vt100_output: kernel output, not consolewsemul_vt100: invalid state %d [>24;20;0cdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100_subr.cedp->tabs != 0P2$u%s%d/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_dcs: bad type %d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ $ %%% %%<%%$%4%,%"d"e"`  "% "# #!%## # #  ""#*"d"`"e"+"4"""""<"C!!"a"""")"*"'"("!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100_chars.cnrc < sizeof(nrctable) / sizeof(nrctable[0])[34~[33~[32~[31~[29~[28~[26~[25~[24~[23~[21~[20~[19~[18~[17~[15~[14~[13~[12~[11~OSOROQOPOyOxOwOvOuOtOsOrOqOpOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCvm_map_lock_read: intrsafe mapwsevent_readvm_map_lock_read: intrsafe mapwskbdwskbd at %s (mux %d ignored for console) mux %dcannot load keymapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmux_detach_sc: not allocated wsmux_detach_sc: not found %s: connecting to %s %s: disconnecting from %s sunT$Xdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %drasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not locked bwtwobwtwo/p4model: %s, %d x %d cgtwocgtwoattach: impossible bustype: %s, %dx%d cgthreecgRDImodel: %s, %dx%d cgfour: cgfour/p4, %dx%d cgsixSUNW,cgsixcgsix/p4modelcgsix on mainbus? : %s, %dx%d, rev %d cgeight: cgeight/p4, %dx%dcgfourteenmodelname: %s cgfourteen: expected %x bytes of control registers, got %x cgfourteen: expected %d registers, got %d, %dMB, %dx%d, depth %d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %spnozzp9100: rev %x, %dx%d, depth %d cmsizetcxSUNW,tcx tcx: expected %d registers, got %dmodelTCX on bus 0x%x? : %s tcx-8-bit%s: %dx%d, depth %d, id %d, rev %d, sense %d vigravs10vs12model: %s expected %d registers, got %d, %dx%d %s: lost carrier on UTP port, switching to AUI portAUI port, switching to UTP port %s: lost carrier sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d %s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrxdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout Software fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrxyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsisw si_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p si_minphys len = 0x%x. si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC si_reset_adapter si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer Polled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sPTI,ptispptispSUNW,ispQLGC,isp: expected 1 interrupt, got %d clock-frequencyispPTI,ispISR 0x%x SEMA 0x%x%s: cannot allocate request queue %s: could not mapin request queue %s: cannot allocate result queue %s: could not mapin result queue %s: kdma handle already allocated %s: Request Queue Overflow++ %s: kdma handle not already allocated vm_map_lock_read: intrsafe mapcnopen: recursivefpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2WARNING: matchbyname not valid on sun4!%s /obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiestwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetsst-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intr%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector #`#h#led#x#p#`#P#h#H#0#(####virtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error##h####H#(###eccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d search_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !PROM exit failedPROM boot failedraidrdstxdsdxyuse one of: %s[a-p] %sparsediskno memory for mountroot_hook%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right  %cconfig_attach: device name too longcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent vm_map_lock_read: intrsafe mapfp align without being the FP owning processstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmiintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsetrunqueueremrunqueuevm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapdev: zero sizemapiodevcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed warning: ldcontrolb called in sun4m vm_map_lock_read: intrsafe mapmmrwmmrw: out of space in kernel_mapvm_map_lock_read: intrsafe mapVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4_4c called on Sun4M machinemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%xpv_syncflags4m: no pte pmap: 0x%x, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) rp->rg_segmap == NULL! pmap_init: no memory for pv_listpvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below KERNBASEkvm_uncache: table entry not ptekvm_uncache !pg_vkvm_iocache: 4m iocache not implementedkvm_iocache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 inttag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsvm_map_lock_read: intrsafe mappagemove 2dvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvallocwaitvmapbuf: null page framevunmapbufcpu_fork: curprocsdcddisk label read errordisk label corruptedno disk labelSunOS disk label, bad checksumi7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt kernel: %s trapFaulted in DDB; continuing... prom?%s(0x%x, 0x%x) at i7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), vm_map_lock_read: intrsafe map/emul/svr4vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapsbrk: grow failed, return = %d svr4_waitvm_map_lock_read: intrsafe mapsvr4 socket cookie mismatchunknown0unsupportedvm_map_lock_read: intrsafe mappc or npc are not multiples of 4! T_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR (sparc) svr4_sysarch(%d) vm_map_lock_read: intrsafe map/emul/sunosvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map4.2ffsnfs1Magma 2+1HS SpMAGMA 2+1HS SpMagma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_SpMAGMA_Spmagmamttymbppmagma_prom %s (unsupported) clock pri %d softpri %d: %s %s%x: fifo overflow %s%x: ring buffer overflow : %d tty%s smttydcd: %d port%s mbppdelaymbpp_sendmbpp_recvspifsttysbppSUNW,spif: expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMhz stcpri %d ppcpri %d softpri %d : %d tty%s ssttycd%s-%x: ring overflow CCR: timeout : %d port%s bppSUNW,bpp: Zebra : DMA2 : Unknown type %s: draining still active (0x%08x) xboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %sexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl: expected 1 interrupt, got %d : expected 1 register, got %d pri %d intr%s: %s%s, %s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected ack value (0x%02x) %s: (op=0x%02x): unexpected data (0x%02x) in state %d %s: SHUTDOWN REQUEST! %s: VERY LOW POWER WARNING! %s: LOW POWER WARNING! %s: main power %s removedrestored  %c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapCLGET: returning %x getflags: %x vm_map_lock_read: intrsafe mapreaddir_with_callback: bad reclenvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapsparcvm_map_lock_read: intrsafe mapOpenBSD3.2GENERIC#36 @(#)OpenBSD 3.2 (GENERIC) #36: Thu Oct 3 20:47:45 MDT 2002 OpenBSD 3.2 (GENERIC) #36: Thu Oct 3 20:47:45 MDT 2002 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC $?sun4c compatible0 0 f8000000 15c6a0 map-pages$?spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4B"  <<d d@@((EFG@HID @-|5w1vu@H  0 0    а Ш Р И А Ј Ѐ x p h ` X   fJKLMNOPQRSTUVWX]YZ[^\ !"?@ABCstuklmnDEFG&'(567&'pq569:#$*>9;}8-vy$$$ap$d%h%h$ap$d$0$H$ap$d$$$ap$d$\$t$ap$d$$$ap$d$4$L$ap$d$4$L$b$d$$$ap$d$$$b$d$$$b$d$h$$b$d$h$$b$d$$$ap$d$$$b$d$$$b$d$$$b$d$$$b $d$d$|$b$d$$$ap$d$$$b$d$$ $ap$d$h$$ap$d$h$$b$d$h$$b($d$h$$b0$d$$$ap$d$$$b$d$$$b8$d$$$b@$d$$$ap$d$$$b$d$$$bH$d$$$bP$d$$$bX$d$$$ap$d$$$b$d$$$<$ap$d$h$$ap$d$h$$ap$e$h$$ap$e$$$b$d$$$b$d$P$h$b$d$|$$b$d$$$ap$d% % $b$e% % $b$e% p% $b$e% p% $b$e%%$b$e%%0$b$e%%$b$e%% $bh$d%% $b$d%% $b$d% %8$b$d%L%d$b$d%L%d$b$d%x%$b$d%%$ap$e#%%$ap$e#%%$b$d%($~$bx$d%($~$b$d%($~$ap$d#%($~$b$d%($~$ap$d#%%$ap$d%%$b$d%%$b$d%%$b$d%%$b$dX$%%$b$dN%`%`$b$d%`%`$b$d%`%`$b$d%`%`$b$d%`%`$b$d%a%a,$a$eQ%a%a$b$d%bL%bd$b$d%bL%bd$b$d%b%b$b$d%b%b$b$d%b%b$b$d%b%b$b$d%c\%ct$b$d%c\%ct$b$d%c%c$b$d%c%c$b$d%dl%d$b$d%d%e $b$d%e|%e$b$d%f%f$b$d%f4$~$ap$e T%f4$~$ap$dT%f4$~$b$d%f4$~$b$d%f4$~$ap$dT%f4$~$b$d%f\%ft$bp$d%f\%ft$b`$d%f\%ft$a$eQ%f\%ft$a$eQ%f\%ft$a$eQ%f\%ft$a$eQ%f%f$a$eU%f%f$ap$eU%f%f$a|$eU%f%f$a$eU%f%f$b$dY%f%g$a$eQ%f%g$a$eQ%g%g,$b$da%g|%g$a$eQ%g%g$b$d%h$~l$b$d%%$b$d%%$ap$ed%%$ap$ed%,%D$b$d%X%p$ap$e d%%$ap$e d%%$b$d%%$b$d%H%`$b$d X P H 8 0 (    иP   j * B<  (  ? D o@o\YT\T ܀ x ` X 8?????OOOO? ` P @ 0  p h X H 8 (  h X @  p ` H (  p X @ (  h P 0  O/!OO1OO ` P @ 0  P 0 p h X H 8 (   h H (  p ` P @ 0  x h @ 8 (  x ! xQ-Z<< << $~$~$~$~$~$$$$ $$$$$ $$$(''!pDDD!hJKKx!pDDD!pDDD!pDDD!`...!pDDD!pDDD!pDDD!pDDD!pDDD!pDDD  !iLjk l,lpmn'!8!02!$!tH!x!x`!xx4!pxx!hx!`x!P!Hy!@!{|!{!{!{!{!{! ! ! L! L! 0! 8!  ! x ! pt! ht! `t! X@! P\! H! @! 0! (! 8! ! ! {! z0!!02!$!$!y(!L!!{~d~(08xx'('(P$$)!'0$!'($(!'$!'$!'$$h'2!)!(!(!)!)!(@˘!) t !,0!,(!, !,!,!,!,!+-PaRSSWDWWWs'̈'̈pPX8TF PNRRtCEST\NMCL0PL0RE @RRtCEST\SL`RRtCEST\ERdCEST\L$Ƞdlάdd$st$$$d$Pd$|($0$8$h$,P$X$d$sd$Ԭ$$`q@$l$d$ܤ$$d$Pd$d$$$ $0r\$\($$$$ $hH$8$$d$d$rH'P$`$st$ d$$ $P $| t$ $8$h$,P$X $ 0$l$ H$ D$`q@$ $ $ $$ $P $ $ $ $ $0 $\($$$$ $h P$8$$d $ H$rH'L$$st$ .$$ 68$P 68$| .$ 4$8$h$,P$X 1l$ 2$l$ 3<$ 3$`q@$l$ 68$ 68$$ 68$P 68$ 68$ 68$ 68$ 68$0 68$\($$$$ 4$h 68$8$$d 5$ 60$rH'T$@ ߄4anative$@$pnative$Xp!=X!=H!=8[dd| t d "`8  טD  2< h dDTh  (  (( 'DhD L lXs D 0h0T Ҍ3 t  M@ T \ Ĵ d,4 4\`   <TH %P  # ̄ H H H 8 X l P  #  8   L ʤ!<%   ! P   X 0 0x#D"\ p ϰ l  Ҩ  X   ´()  l0"X#t t,t h$<(HѼ X  P  # " * `d   X 8 %L  Ը&t,  H788 )lCCCC5<DxD5|55665$$$$$$!G!G!G!G!G!G!G!G!G!G!G!G!G!G!Gp!G`!GX!GH!G8!G(!G !G!G!G!F!F!F!F!F!F!F!F!F!F!Fx!Fh!FX!FH!F8!F0!F !F!F!E!E!E!E!E!E!E!E!E!Ep!Eh!EX!EP!E@!E8!E(!E !E!E!D!D!D!D!D!D!D!D!D!D!Dp!Dh!D`!DX!DP?? 0 Lx$($0$8$8B@$e$!S(!S!Sbb|$| L h !h!h!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!g!gx!gp!gh!g`!gX!g!gP!gH!g8!g0!g(!g !g!g!g!gA<x`x8`X4xttyclsttyopnttybgttyinttyoutMMNOP-XT`W^Ho.PT8TDDDDoDDU-XT`W^Ho.PT8Tt,`DT8U .D 0DD 0 : 3U n p4 ql sp v ~TDDDDoDDU H!w!w H!w!w!w!wxt(!wp!wh @!w!w`!w!wx x!w!w`!w!wx @!wX!wP x!wX!wP !wl$ ,$ , ʜ \ d ʐ!y8x?$$ l|Pnetconnetclsnetionetlck$ffsH$Dmfsl$,ext2fs$(cd9660 $msdos$`nfsJH$procfs $null $union$umap $8portal$|fdesc$kernfs $$t$X$$$t$p$x$$$$@$$$0$$$$$$$|$X$$$s0s82lockf@` !!!!!!!!! $st$l$$\ǔ$l$r$r$8$r(-4$$ L   D !!$!$ !$ !$H !($t !8$ !H$ !X$ !h$$ !x$P!$|!$ !$!$!$,!$X!$!$ !$ !$ !($H !8$t !H$ !X$ !h$ !x$(!$T!$!$ !$ !$ !$0!$\!$!$!$!($ !8$8!H$d!X$$$h$$$$$$P$|$$$$,$X$$$$$4$`$$$$$$P$$$$$0$\$$$$ $8$d$$$$$@$st$ $$ $P $| $l$ $ $, $X $ $ <$ $l$ $ $$ $P $ $ $ $ $0 $\l$l$ 0$r$ $h $8 $r$d $ $l(-<$\ `    d t hddd dd$st$ $$d$Pd$| $x$l$l$ $$, ($X ,<$ ,x$ ,$`q@$ ,$l$d$ .($$d$Pd$d$ .P$ )$$ +$0r\$\ -4$ -X$r$r$ .x$h .x$8 .$r$d -$d$d(-@$!@ !P !` !p!H$st$ .$$ 68$P 68$| .$ 4$ 6($ 6($, 6($X 1l$ 2$l$ 3<$ 3$4 6H$`q@$l$ 68$ 68$$ 68$P 68$ 68$ 68$ 68$ 68$0 68$\ 4h$l$r$r$ 4$h 68$8 5p$r$d 5$ 60$l 6 7, 7 7(-L$ fifo 90 9 9 9d :Dlddd ;dd a!8m!0m! '\$ !$$ !!;$!/ !_!$`$!5$!$$!)o$!Y$!$$!#ް$ !#޸$!$$!)#$!x)uLc$!p$$!h%G$!X$G$!P$!H[$!@#$!8k$$st$ A$$d$Pd$| B$l$ B$ B$, D$X D0$ D$T$d$`q@$l$d$ G$$d$Pd$d$ G$ EH$d$0r\$\ F$ F$r$r$ G$h G$8 GH$r$d F$d$d(-P$d K M8 M@ M M N N O O( O0 Gdd$ O8$ Q$$\ Q$ Q$8 R($| Q`$ R$ R$ S $ S($h Rh$ R(-d$ S U U Vd Vldddldd$st$ W$$d$Pd$| Y$l$l$ ]$, ^$Xd$d$T$d$`q@$l$d$ `$$d$Pd$d$ `8$ _ $d$0r\$\ _$ _4$r$r$ ``$h ``$8 _$r$d _$d$d(-h$t! !!!!! !!!!!!!!! ! ! ! ! !!!!!!!!x!p!h!`!X!P!H!@!8!0!( w x x xd ylddd rdd!!! d!! l!x h!p!h !` !X !P !H t ! t! t$st$ $$ },$P },$| z$ {T$ $ }4$, $X u$ u$ {$ },$ },$ },$ |$$ },$P },$ },$ }$ $ $0r\$\ {$ | $l$l$ {$h },$8 |$l$d |4$ },(-$devopndeviodevwaitdevindevoutdeviocdevcls$st$ d$$ $P $| t$ $ $ $, $X $ 0$l$ H$ D$4 $`q@$ $ $ $$ $P $ $ $ $ $0 $\ $l$r$r$ $h P$8 $r$d $ H$rH(-$H x  dd$ D$ $\ $ T$8 $$ ($ $ 0$h $ (-$ $ @ d $lddd dd$st$ |$$ 4$ $P X$| ,$ 4$ ψ$ x$, Ѵ$X Ұ$ $ Դ$ $ <$ Հ$ 4$ ׄ$$ D$P $ $ @$ $ <$` d$0 $\ ߼$ $ $ h$ 0$h $8 $ $d $ (-$T!#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ . ;, ;4 ;d < =Dd = >8 Hd >\. .. $st$ $$ >$P @$| @$ @$ A$ B$, D$X G$ J$sd$ O$ P$ P$ PH$ P$$ P$P W$ [T$ \,$ \T$ b$0r\$\ ($ $ b$ c$ cL$h c$8 e$ c0$d e$ e$ c$rH(.$$0  y$ y20123456789abcdef^^3333!! !P!#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@$@$x$Ű0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef `  4 `  @  X p  | @ X  X p  | @ X           !p!!!!!!!x! $4 ʜ t \ ʐ L!Ő Ό$$4,2$  x $$m|} pm<$, 0O|c\@LTLk,$ 8 4 h $ w 4 h sp $j` 4 h $)j` 4 $ 7 4 h 6p ? AP$3 4 h $28 4 h $a 4 h $l 4 h D$/ 4 h \$7P 4 h $ 8 4 h !$$ < dX}E#(D<8Q @X,2(@AAA==(A* d @@@@@@@@@$$<$D!X`ltt!**+1\:!,40!BBC C,Hh$ͼ"7$,4$\$d$l$t6666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\"BpAAAB4"BxB\BBC"B8C,CHCdC"BCCD DH"B DpDDD "B EHEdEE "B "B X }8F$ ~0"B \tFDt"B `F "CX }8F$ ~0 "C\tFDt "C X }8F$ ~0"C(\tFDt"C0ZFdF' @z@PslӰ&,TL8, @>_`H~@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''$,$0$<$V$j$v$Ո$՚$ղ$$$$$$:$X$ր$֢$ֶ$$$$@RYHVxWPYP=WX<Y8Y@XDYX$st$$$݈$PT$|`$bH$Y$b$,hh$X8$[<$l$T$t$4r$`q@$($$!h$$ $PS$t$0$~$p$0r\$\r$r$r$r$ `$h$8($r$d$$d$t)t$ט$st$ d$$ $P $| t$X$$b$,hh$Xx$$l$ H$ D$`q@$($ $ $$ $P $ $ $ $ $0 $\r$r$r$r$ $h P$8($r$d $ H$ $rH)p$$st$ .$$ 68$P 68$| .$ $$b$,hh$X,$$l$ 3<$ 3$`q@$($ 68$ 68$$ 68$P 68$ 68$ 68$ 68$ 68$0 68$\r$r$r$r$ 4$h 68$8($r$d 5$ 60$ 68$rH)$?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@$۠$۠$۠$ܠ/$13p4779:,sl t̀`t,$st$T$$T$'$P$|h$$$$,t$X;$?$sd$$d$$l$4H$`q@$D$$|$%D$$($P44$8$:$;$=$0r\$\$H$> $>H$ ۈ$h>$8@$>t$dD0$D$`$rH)`$$st$ d$$ $P $| t$A0$$$,t$X@$@$l$ H$ D$4 $`q@$D$ $ $$ $P $ $ $ $ $0 $\$H$> $>H$ $h P$8@$>t$d $ H$ $rH)\$`$st$ .$$ 68$P 68$| .$B$$$,t$XBl$B$l$ 3<$ 3$4 6H$`q@$D$ 68$ 68$$ 68$P 68$ 68$ 68$ 68$ 68$0 68$\$H$> $>H$ 4$h 68$8@$>t$d 5$ 60$ 68$rH)d$"[H"[@"[0"[("["["Z"Z"Z"Z"Z"Z"Z"ZDS /$83p477א:,׈sl $st$x$$x$Px$|פ$$x$x$,x$Xx$x$$x$`q@$ $x$x$$x$Px$x$x$x$x$0x$\$$$r$r$ ټ$h$8H$r$dx$x$rH)$"o"o"op ... ...IHIIHIIHJ $$$|$TH\sl$st$|$$$P $|$$$X$,$X$$sd$$d$$l$4r$$`$$$$PL$t$̐$zD$`$0r\$\l$@$> $>H$ _$h>$8@$>t$dD0$$rH) $d$st$ d$$ $P $| t$A0$$X$,$X@$@$l$ H$ D$4 $$ $ $$ $P $ $ $ $ $0 $\l$@$> $>H$ $h P$8@$>t$d $ H$rH) $$st$ .$$ 68$P 68$| .$B$$X$,$XBl$B$l$ 3<$ 3$4 6H$$ 68$ 68$$ 68$P 68$ 68$ 68$ 68$ 68$0 68$\l$@$> $>H$ 4$h 68$8@$>t$d 5$ 60$rH) $<@ , \$$ $6h9H9XL#<D$>L#<TLLX#?hhNN@#?#@4W<W`#Bop<X#E,dp0Lh,h#Hamd7930xaudioamddH(H x (8xlL#KSUNW,CS4231aonboard1@%+>IV"k}3 3 D #OPHڈpxx#d(#W*t2-.x./P0/t/|//0#^#^#^#^#^#^#^#^#^#^#^#^x#^p#^h#^`#^X#^P#^H#^@#^8#^#^#^#^#_@#_8#_0#_(#_ #_#_#_#_#^#`XUVZYd2d^\_D`@aDgph4++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy#e#e#e#e#e#e#e#ex#ep#eh#e`#eX#f#e#e#e#e#e#e#e#e#eBoldface%">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||Gallant %.000` 3ff?ff`f>``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp%%-  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް%T%U2%U)%Va%V0%V%V%WT%Wd%Wt%W%W%W%W  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%X`o%Y %Y%Y%Y%Y  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     %ZPa?%[P%[%[%W&%Y!%[std%`0%`X4LH#|8std%`%`4`8<#|pstd%a@%ahh P@#|1+$A'* + + std%a%bt8 04#|std%bx%b  , 8   `D4#}std%c%c(pXh 4#}pstd%c%ctx P8#}std%d%d8'L)*++$+T###~Hstd%d%d.004002XH,|,#~std%e %eH6 9L:D::823#~std%e%e=??8??BT;d;#PGH`# ###(LN8#0Pz{|#t# #X,#`6##, 8d0C0CT#### # ####DDDDDDDDDDDDDDDʤ`Ǽ`lDDDDDDDDDDDDDD|(LTprs}pl$,+(T@TDDDDDDDDDDDDDDDDDDDD D LLLLLxpTL4DDDD4DDDD4DDDD4DDDD4DDDD4DDDDLLLLLD 4 , D DDDDDDtDlxhlDL4@HH0Dt(DDDDDDtDDDDDDDtDDDDDDDtDllDDDDDDDDDDtDʤ <ǼDtDDDDDDDtDDDDDDDtD1p455p59l0KDL4DDDDDDtDDDDDDDtDDDDDDDtD_<_d_|Dc0D`Da|PDtDXDtDDD DDDoqr t<}u$}KDL4vvwdyX}l}{DL4DDDDDDtDl#$@$DtD1DDDDDDDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtD(T@DtDPDDDDlDDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDYYYYYDDDDDDDDDtDDDDDDDtDDDDDDDtD D LDtDDDDDDDtDDDDDDDtDDDDDDDtDxpDtD݌ݴDDDDDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDѠҨ  lD8XDD lDDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtD,x0K^\__xD_DfDLLLDLDLDLLLDLDLDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDDDDDDDtDLLDDLltDLLDDLltDDDDDDDtD 1 54 6 6x 7 9$ 6KDL4 @ BH B B Bl D D N Q Y Z R Z ZhKDL4 c c d d d@l d8D f fD hH hltD j k k m oDD wTD x`LLLLLDtDLLDDLltDLLLLLltDDDDDDDtDpr||}DtD * * 4 8 1D =D >DD`DDD4DDDDDtD4DDDDDtD4DDDDDtD4DDDDDtD4DDDDDtD4DDDDDtDHt$DDd8$$d\  $_%`(%`'հ:MGX0V ^F@k%s$44 -XDXh @(8h!(p@ =D f"$ 2 D=4IVU$@i tD  x4,, p@h 5$ q d 4$D,9J$\$\ f$mWP@v&`\@(*h$}`T` PHpD0(6 xt"h)"D@L(3|\R^*dmLty$P@$  t,.H@)AX"($و@< LTSx&,/T=4DPX e s %e(,= ( )hܤ( d0<,H'h&%d(9$(O `Y)O\ozPL-X )x \,,'(.P` $($˴0 k 9$ A0VlaH|q{($  $8p#P:'` Y$($$$  .,>U0J[ ($e 3<p >|$ܠh(),%+X"$~ Vl)  Z 0$ ,<$~.T6A' L|(_ rtlBdx$<[$C( LX(%$%4\2DL@ <hQ pcRtT8,0  x<%e D((8$8%(%*'3H ?dK XX =Htj'(qJy] '@$|8 $<hLp 84 $ d Ō( 7 A`HhHR$e)dy% # <L (9h(-P%Xh(*l$$ $$'c<=`M$^$~lejnj@|# ''v4%fhDtt@<18  $(-P* D6P@dLSHi|$h}l$B((64$D)uh)h AH xǜ(R8&XT2)B :c8CMUhcptpgh0 ( `d$H D+)(02'l>$I V0p$ǀz d TD$4lx$(&Th lL(- $*N$T6LA$K%Tdc$|oH{ R8XT ,x$X$ Y0 ,< X & X 9 d C  L%fL ^  gQ x ?\ D \D .@ ( @( 88 0 8 X!$\!8!+dH!B !Q $!^Ax!l$!x$4!)%! R(@!\0! Zh!3l!T(d!ф4!L!$! !gp")ul" * "(pX""/d"@(%"M' "\"jy"w"X "\"3t"" T "@"5$"$"?"0#h#)up#$8#3$8#D#N$$#_$d#s{ #^# Rp<# 4# {T#x#Q@##j,|#$$$f$ kX$'p$0$$9$A $PX$^'$h $uz$~Ӏ$oH$#$l$6$(-$$P$ $$$'p $4%$a% "@%- b%>1<%MA %Z(-%i$%x<$%%^p%%%t%X%`l%_%% X%;,%'0& & &$ x<&2$X&AWD&N&\T&h(68&v#iX& &$&ԬH& k$&|& g& | &'' '|'.d'BMp'I$`'L`@P'Y@'b!\@'r ''<')L'%''' P'e'$('|( etl(% P(;<(F(M% (W$(ach(x`(r4(il((`(((8()( (]T`(p) )),)()4T)?$t)S')[ T)i(3P)q{){')~$D) )v))Ҩx)P) h) d) Zh<) c,*S *(($*0$@8*Ap\*J$*b$L*md|0*v~ * d *$@$*h* t* (*$@* K|*P* tx++$+ y+-<+@t+Tp+c|+k$\+z(&+$+'|+H+$+,+,+1 +d0+$,x,)qX,( 4,3Ht,BL,U=8,^)%t,mxP,x$, ,x\,%\,[,(-4,, ,p|,- h-nxH-*(3d-2 N-A$a -I#j-VD-b8-o-{$-HP-i-8-'~-$t-$P--%.rH.'.,.<h.P@D.^$\.s\.||.-8. 68.8..C . .(%.`.]<|/>L/ @T/)0/ F$//G/< (/KL/`$/{D//Dh/ 2 $/,</@/,`//$$/d0 Hx0@0+$09 x0DRL0NJX0[xH0q$@0| l0%000+4|0Q$00 `0 $0t0l0P05L1%f1$1T411) 1<(1HP1T1c1 h<1bD1h1)`1X1$1M\1(%1x 1 2`L2D2%$x20)2> 42K(%2Y72d-l2t2)qL22 p`22 (H2t02T2$h2 p42 d2j3H3ǰ(3'%k3/ P3: |P3@.P 3I`D3^3m ԴD3yY 31\3ppt3$3X3 3 :D3h,8N @8X5|H8f)ut8| d@88$˼8DL8()0 8@8ͤ8 8'88 R48@9*99 9#zDx929@h9Q$$9]#9e`L9n)ux9t4p9l909 89[tp9 ?l99'~9(,$9%c9 $:( h(:"$:0$:= 4:E?`:W 8:b:t:|$:XP:$:IT:0:$:#A:8:::%g;x;$H;;,$H;4rt$;D <D;QM;^% ;nO0;x%;$<h;*`;'x;;(;$8;$;7;$;$(< H0<L<,<(<1$<@@D=7Xh=B$8$=QIx=[(h=g% x=s4D=-\=uL= eD=$=$,<=%=% H=(=(\='=$4 =L= >)uH> >)r>% >8p\>Kt>V%>_>o> (>xH>D>n>`p> >$`\>h>S>0>$>`> l?? l$?"$?* ʤ?@'@?N($?Zm?f$?obH?yl?;D?24|? 0l? ?# ?h?|? }4?(-\@)@@$$@0)%x@9f4@EL$@Q)@[ h,(@g@t0@~ $@ >\D@Y(@w|@($@@$h@ E(@ x@,4@%gPA AtlA\A''A2$ A<8AI 8A^'AehlAmt$Az0AtA:|A$HA׈A%Ai<A' APHA'A)OpAXB $Ѐ B  TB+`B7B<gBG'~BO'B\ LBmBy( B |B78B1p$BBDBdBD$B <B)BXBCCC!C"Ĩ0C:W,4CHRdCX Cc@Cp@C~ `CC|C$C$C\pCHCDDPD $xxD*XD>L4DNP`DXDj% Dy$4DD BDD$D dDD pDn(@D%c(DDF4E  E,E'$E0 E;XEK 0EV,Eb)Ei$Et\LE$_E UEDEdEyXEE)E'E'E F_DDF#(%FF' F4,F?+LtFIFWFgPFtiL4F'FF ~hFT F5HpFۈ\F$LF$tF 8FmGlG * G{G)(GC}tGQɰGe$8Gx_dG%d<G lG%G$8G>xGOx0G ,H H 4H* (H8'4HE|HV xLHk@Hy$@H$H%H% H PHhH|HOhHB4(H$H TH)uH`4II(GdI0pIF$IO"I]$Is I:`IӔI@HI߄IhI{`I$$I )lI IPTJ)- J!H|J.$0J<hJF$@JMpJVA(Jb`Jws J$J`J$|JJ8JJ3JDTJ'~J4K$K %8K(-K(dK;)nKH`HKP4TTK\ xTKkDKsY@K~Ud(K)oK$K pK HxK$K%fK K)n8K(L O0L% LL%L.)pdL=jLLjx<L] 6x`Lg!PLz%gTL)u(L LӬLL$LodL'L8L.\MThMMM*XM4 ,M? ;4MO@Mc Mq lM :M ,M%MߌMMʹMdM)M JN pN&N;%NNN^ȠDNjNs%DN}|`N 44N 0NPN8N$N NN DN.@N%a'O$OpO$ O,4O:,OM-\`O_#<`Os04OCO(&XOdOOT(O'O$̐O Ό O#O'P PdHP) P8)&tPI @P])Pj -4$Py dP \ P(dP$`PP@PuPPTP <PQ(+Q Q!tQ+ Q1(-`Q@QKQR d8Q]tQl)Qu0DQ k<Q) PQ tQDQH(QIQ,<Q$R$̨ RDx<R+LR+hR9 D$RD0RX$Rb 9Ro$`8RzhR R"R RR'xR$Ӥ$RRRD8R ,S LS$HS' `<S0 wS;8ddSQ|SX\hSi$S}) S vS0S',SS$@ SpS,S2PSX8TxlT)uT$D$<T/08T<$0TLxTX Tf$Tx$TgT TPT'~T%aT<TXT%(T tT,|8URPU$Р U!tU* ,8U58UGHUR\UX8UgUvC,UU`U!;U?Up|U$$UYU _ U"lV'pVV*i,V8VJ$|VSGV])OtVv)qPV tV 7PV$4$VV$V XVV$W$$W @,W#'LW3pTW?$dWP`W[ M,Wel WspLW}K8WP WfW +W ߼HW WW FtX X9Xd X. *XX?%XE`XO(X^dXnhhXy<X tX(X<hX0X\LX$X%@Y8@YxY.(.(Y9)q\YE)OxYNdY[[HYjYu)uY`LY,Y LYYY() Y%gYa|Y%gYY9LZP`ZxZ+dZ3 PZDTZUPZi%hZtTZ(Z`ZZPdZZQ (Z lZ tZiP[$8[([/,[@$t[JX[O' [\۬D[n$[54|[([ \[( 4[Nxh[X[\[#[ Pp[$\Ũ@\#%a,\, 3\8 `(\@8\Ep\Rp\[$< \h$L\u @\P\\r \|\LP\p\@\\$\)u\'(]$L]]'F]0p ]=>!D]K(]Z']j ]v$]}$] V@] H(]p]\]H]$]%e|^j<^$^!^*^:$Ҩh^H C^UT^ed^vH^$^T^$@^ ^`X^h^DL^$0_ Q_ X<_(3h_)r 0_1 p_C `_N0_^8_o% _w|p_ b`_8T_T_'_%_)o<_'<_J__(` u` %bL`(`)"hT`5$0`> @8`N)u`Yh`f$~`m`{%b` <`TT`m`)q``h`}`$`340aDa 5pXa6 a0a- xa;laG.PaPTaY4adq at)o a% (ta$ataa$(a $<a+8aDaab(bK0b-b<ʤhbC(bMTb]pbg<Xbu$b t,b,b(Pb'|@b Xb% b Hbpb% b݈%4c c ^4c% c2$cE$0c["cePcm 0cutpc$ c$ cdcL0c<c'Xc$Hc"cdd%ed 4d% d)U<d5$dEP`dU6LdcTd~ =d 4d {0dTd)odxdzd$4d0 dXehee Ue e+ e2 `e= eNheben ?ezhe=@e8e`ee tDTe( eo$De0efdf xf+(%f30f@",fS)Qf] tfj<f%b(f$ fdf'PfPf_D4f <f`f $gtg $$g8g$Tg+ gA0tgO%gc cdgnggg$tglg g`gq ghggtHhΨh&h:()$hE'hN$hW 0,hg!`ht@h$@hXhHh_\h)#Th$ h0h d|h)ui84i&,i ,i%p\i/<iD<DiPuH0i\@|iiF i|hibi$0i$i$di(i%`ti@i$Pj Dj5x j"j:CjB$djR \jaͼ4jh( jwLj j$8j @j)$j8j)Oj$jotjj$lkz,k$ k $Tk.HkB[kJ%kS pkX\$kg#tkuETk$|kk(pk' kx|Pk kO k?hk$ak k$l$lThl')ul5Kdl?(+PlIL$|lV$`$lh%c\lsPl~|`l)$l$DŽl ,l V@ll%l zlllmm cPmJHm(('<m4 pmG H<mT GH4ma$$mr$~my m|p\mPm)m$$m Tm$hmnX\m/LpmDm Vn nnZn$ \n3S n=nK nXnfxnnnwn$ nSn$n,nn$n `n8n%TnL0o _Po^o z\o*$oA$oNexoT oa%ok0o}%o% o)iho (o%o8opoWdo(&oW`poSP@o}`op$`(p(p,p6+p>'pM ],p\)@$pk4pt'Ӽp}$pYp (p! \p%p p p#p$tp?p<q 0Dqq#'xq3@qCDqQ%qYKlqn8q$Tq~ qC q)q$ $qq%`d(qM8q(8r`8r %rWr%trAD80rQY( r]$rsX\r{ir]0rF r .(r$pr%`\r$r%r WXss s(s%CHs4Uts;s[,Lss5<@s$8s G|sssTLsTs'Ls)0s$ht \t(9|t S(t($t:LtE <tT tc tn('@tvh(t) t;t(t0t$t$$tt'lt$dtlu $u lu/ puF hTuSPPufpuv$u` u {uu'0uHuu duPu @u r$v $0v{Tv,v7vD)vX Hvc$,$vtqv$aXv xTv (v2<dvCdDv v$Ҥvtv Zv 90vldw Xw$w %`0(w0(-w:OXwKwXETwf2<ww"Hw w Xwwfw8wlw,w1w߄w%xKxx%x(x)|px4 <x= ~0xF%XxN cxW xxcU@xo#0x~'4x3lx8Px'txxRLxè,xx,xh<y(0y'`y0xy5)p0yAL<yMHy^ 8yh yy$dy$~yLpy jyF\$yy]y,hy$yJz hz$z z.z<<zJz`\zhӰzu,zs|z$Pz$a4$z$z'Tz DPz$zppzDz l{\t{ 4{ED{)tt{6|{?L{\)qd{l${soh<{d{L{ B{H{ >{ 0{_Dl{{${ ;,{$8{'|)| o,| |,|8$Ǡ|DH|M @|[$0|bL|j`|qո |P$||| &|n `|F|@hD| XH|h|$}@}$_}$L} \}4XD}?(}Q$H0}f}m(%}{ d} l} L}}}}Hh\}} h}",}$}J~( ~%gL~")|~08h~=$۠~H(-h~Y$~i$T~ ~'~S0L~'DX~ t~(9|~~~$~ 04~0 hTnT@D@!τ5D`A\Ux\e`Hnu4D|(|&l$Ű8'$L%P 0T 4,<%0D$LS4H['h4lv\}h%xPh`D)uLU]`XH%g, ) $$Lp |`#V(0 \T|; @J%hV%dg(lu ,~,Ll$@P_t ~d)  `t+\t @ P,$L:G PS ^g)(r r r<հ8'L$t^ P @$ ~<(  uL8 Xp!4,L3hD H<]$hf uB<$8l|%c4( ϰ8$$̔(- \l) H 3!x`5\< 4PyX bm[x$($fe$P @)qh=<$ '0 l@!\6V 8GhY(.$k O(yh$ dP$d'~=l 'l$  ߴ8$#7l:$XHI|X8o$(+T ( lhP$@P I,%eH'91K :'I)'XV `hr`$H,54T0 4PTl Xp.#YP0\C ,U$c])p i~$$)  .l$7T 4LJ L %0$ z0td>'ܰG=Q),a|j̤{ N8%c( u08%LhcHdxlP pTm (2$|:MDV^TgSy$'%bd)Dx$X$W6:)2%9!JՀUc | @,%H<x('8@$x iPsdl   p$@+ 09HD%gRtH_$v άL D8d 04$P$|0T)0H7$ P J')uP0 HI$PlY#ߘb%gDk LZ&(d p ( $%a@( TP&t,8X>K4lV)s_lne{| , % f(34<`$~ "X! T2=|G$W7Hf c0w \('D$l L |$H$`@X"T3 `@4dME$Xlf'o,0u4$x$$4Y@ h0(&$ ( Q %04')7ͬC!xS (_,g),~8%$, 4H) Ah$v  & 34@dL4tXtg(w+$\Sl(ڈ\8 ,<<vxm%5l ,tY[,-<5$$lF DV $<`ptu'p6d .(h` $'t$8 ,$( 8>$Su``%fg\<nXw h$) T@$%h tDP`(P $_')u,8 .D?\PS 8^ t OP0$)u#k$$4 ($dd)uB   THPol( $P+; HF8L{| ](%k$($ 04$ 4T$0$ R, p,<h lB ,)u@ tKMV\j%ql~Qd4 h$N88 (-<\t$$@$D8\(Y5[<?$X$\g()Pq LP8 {$T Dq\$l$Thd$̜ ל84d. |05 JtV$f$a nl})$ƐL<z < ʜ|%eT(o<btP<°$ `)45(tE$R]xH` [Tn P@|$e$ _Ta8lL$   c.h~dhL7̠<%g@%H- '5 $`I0N$ZPiJvLL@I$p% $  00 |L'/,$ <'P<(7JR(-8]j ehy$јx@ X x@8x\$$'hy$ Pt# (4l=( 8FlTYdv g [$'0 PZH`p)uX%g(XX T%g )P$"P3%ahC xQ` i_$Pzs)!(0 8'4h\QP\),$  `(h1B(><pF$LjO(-d^R g'n8Pv, $%$($| $p8 @|<KP4X ky$d ;@  {˄D~Ph ` Q$<Hd0@-$8?8dK$V^H^,oL ,'( (\L:*0 @D0'P{ $$;0B)FdtSh4g h@r$<0l't$$$G  4;dd$)u, Q@6 4AdT oDe^}80$ (8%%g)/ Tx+t3T>)'lV_@m$̠ .H kX Ϝ|%` g DD` `D 8\6Pt>`ItpY6,lbo  L@D2 H$\ v*+xٔ$30> GK(DU te \t} <)n,@R)uO|X h[ @PHR8)! 83tD O(P\d)vzpd$h'dd( $$$$0$$@4H-flF6` xt |4t G(zL)vA0'n||8|$' $`T. 49 I6V[lHdx0l pxr8xD)d($ `< D8x(L4 D@]8LO\| f]8q($} C('HLh Jh@)`04 n %t,0X?tH^#-n K@Ty$ <$@%$ .)p4Pd $+(\ 80h*5SPE$@\" ek  {h$sP_ p$P$% ) Tl%b$( 3'0<I%c_ ,gT,oPP,(% EL hxp K 40P 4 @s .<p"*L*G|<@'Jm\ U ^dlh/8x)(Ph$x $ \$  ,Nx< )D',0b < xF' TDa4s)v  X` \$אh$ .x@# D+ L88$`; HJ$̌X(aLTlkDv\4 @30  { x\ _Pp$0 $XH@(T6K8AML,X&hPw(  s G8 ؈|$F,do(-$$ GXL:TD,<h8$E$LV_(;<j $tl@\  0H$X^L$PLL$$t .: 6(E4]0|k<vl<' ,<4%ph8'4zD pTt0(8pp a4`) &P5' ;DhLD[ 54e s 4_<( E i(' $$ &48 AP <8 #' 3TA7 M$$\%em(3Xy ((+)qH ,x< ?T$<}0CXk, @84 8` wPD!2,C XQrb0sT%h((Y p $|8 0 @ t  @4!:$EZ 8dm'Xz'#d((LdThj4DhP() ((,T  ,@'X`3>%<GXT$l,D)vdH$$84nlX`0' +t4' w82$<x4NP`W`,xIHD D}^4wfl cL| 48 h8PL$ hxP1LAOC\ _4Pk`8u$0HԘ)qlbxlp$x !<4'4@1@?H@K V)a`j w (P ()T%` up$8,DjtL(L&'. <?J48MvU$g 0w|)u\(:$p$xx P=$($(T$ LXP'T0K%at(]'jLs$d=dtd(30X^8 J| , ,H@ \-">V0F `M"8j X4}iXq@ -L x| Tx8)v&,DG$!$$0 T?$MlW \g Xo'{(+A p+Lh~@8(6l Rh,t0$ )< FxH0!$ 4,$DO i`Ns<((0g|   ,'$`X DP8D Xt 0$`%(L-8$`LB$N 0_^\i$0pT<D$˰)o qX $ S$`3 <H> pM`X fTy|W” "P4® hh¾ |M{( $h,"A0<02894DL$H^ 7i$~'ܴÈD×$ã~plï%fú)rX$̼()X%`X<%T4E)vV$d m <{$tċ z\ē&0Ě[ĤP0ī$Ļx0 8d2|x(\0,' {T\4$D' P0a)vj$| ł1tœ Ťrű}źT,PLT 4 =ph { &|4 1=)oGYU$e(u`d|Q$hƍ 90Ɯxxƥ,Ƴ $)n B $l (H( oD18? VJXW D_4kDw|ǁI@pǍDǜǪlpxǾ$tj`(%0L < K!'-'7 LIp ^$pȀ,ȍ Wș`Ȥ%,ȳl%l ר4)0l x @'`x'(3l0E:<MlTaPl)v8wgɒѤ$ɜ <ɩ$,@ɷ)p $$H$t xaP#r+l48$Q eb(l' z <ʆXʎ)(ʚhʩn0ʱmLTʺ?$% Xy(`dp P p%d 0:-JD`e($r$ayg@`ˇ h˓$4˨P`˵ l(Hl$aa\X @ j Ҥh2#0B$` U(b?l'r J̃H|̔ ̠7D̶ ̸ k L b( t)q. hP (\%hiZD4|͑(3H͛7Hͨ h4ͷ$8]dhxn` xd$/(-7J|B$N@LW(m$}(3L΅lΕ0Υ 0$α)$( $$  ( \:TF)[%f<lP|_ϋTϕ\ϝXTϪTϻ VH t   L\)t p\ -C%TKAXxc(.,m G,zxx,Ў8$Ф%`Э GH0 l'$T`<)FX7;G Q([HTg ppv)qTрFD я*њѫt<Ѻ $ 0HD d<$'$x; D`G ,dT |L[}lm s >҂ҏ$Ҟ 9PҪ$LҴ$$ $x$4$`$t  '\0' G 4tM$^^$tk$tӆtӖHӝ'Ӫ tӵpp),30 dH (P @%()\-8 #I DLP((0WH@` ĴzѠԄ 0hԑ(&ԙ<ԭ#4ԸD <$ͼ #d8$L$  %:%CQ!4L^ J08jtsl}(3\Ջh՛$$ի|ճ (@ռݴ(pd$dX(-ŘP h)o@\ /A/\P]%ckւ։ c֕ X֢j$ְ `$%a(<t|-d͠0!9$,(HRc#Ӏ sP׀%׎xטYxlסDpײmP׽l DM$ \'4 $& ,7$`< Q`TF$\V$^&k6`~@؆yXؓ(*@ؠ80خ 64ضh1T0TT t$ $ . 1D7$ G,<U i4a"4q  4} nًxٙ$x٠٦ ٵx$$) `V<%al" 8-\B)P$^%$,k$(z$pڄ 60ڑpڝBXڪHں M0L $@6 -$$P  wT ( :0C$`S$|Z+|b' o{ppۅ$$ۗ$X۟'۲'d   8 ( \ Ǽ( h`|8<D} MdU` n$~'܉YXܖ%ܟ>Hܫ8ܻ D H8$ݠ$$l  Yh F )$`1g`AjY(e l|n t<$b݈ݐ<ݜ)vݰ%<C,   \4B\($it4̐(t 7D<(T ofͰHu|TމKhޢ%ެ$p D *h$0$D5`A0hN'Y(*Df -pH~ h@߈@ߝ Ѵ߫ )0L8  ,D l CDX [X" k$1<C0U)$i  vdԸ j4 ) 'ܸ )n6h1T>$K$h`(,,o \$ (+lx$$<  H\x8 DH(DT"%dl.< O f W( a'k ]zMsx(6<$ $4$@ *%h$0y ]T<,,+ DX:J(-V˘0d$@xf@(( HYT@0$$Pc h$P PT,(.9dtC9lL vlZ th)uTw(+l (%f(%fҌ8Ѽ" po'pd& y$6%HV<aͰtOPX% et@vpxH0 4 B'h$`< f'$#ް)-+' 3ѰE tRm0ft<xo(:w w'<)( $`\( xdD),hh (4B@%L\p[ \g JDqW`|zTl%b)o4(%)EH t82x8($$epFd +_x5LD% pJ7Wn^y?H` ypI'u$x N) | $4@@)%4و>kS)`Xq  X$d %b  M@՘T )Dd h~%17JD^(-@n$DqtD 0 tXm$85X$lL w8#L  ($#dX.(L9 HNqVy(b cX,l[P|LX|* wD' T5 ՀC,($$(*' :)uD>Y,(N~d]4mu4@X$$$\8L#0A4t)q &(<3`EhL W<gudDs ~D<-dp,I$ F)p8 tD`.D'0d &$|2 $?(K(3TUJ$aM8 ml<zYxLj(aD,(&)'@l<( \ H),% 8()T6?F<FhXO4|\ pv$}9l X tP$~(Xp$_ 'l\A8=<l\-'\T5$xF hSs`m z,$XX,, zt u` `p4 pTX %b d<&{;dOL(\bHi<yU`x 28<,) ' 8'%  $ˤX%8@8 NF, U#8c'Hh)0{$k<l( ;T ($̸#l( *p/ 0>dH'| Q$^ cT k$8zxd]8@8'̈$\XzL ($ 8NFQ tb ~Tpl(u4)4)p j:x T$%fH,:@?0T$d$f$p%t<{|  0< jHxs<d @ UGD }h#lk,@|$4t 0?lMx]I8h\Xwa@8x @ 8d$ pt)B$5C$ܠL$Ӏ$W-P_)0| mly`D(.p0L,  @:,t$$Ǥ +08XAZPM2 L\#di 44pT})| 'Ј'pl")o0T Z8T B@$ ׄ/`?)D)R [(%`.h8vTL< %g%@U$dp@ p$| o$tD3$;|JBPU$b$xkr(*H'`$  yDFt9\`BlD ψ'( #:]@NM[pg 2rZ((-T3LlpL(%{ \D$~Dd  L!2)t9EH]ltz% g$L PHT (X ~Y||l~< )$P0ɜ\:TCO l^ ǐtk pwp/@| hHhXҨh$$ QP$T(* 0Sx\?(-FZ pblt {4tt<'HY`Hh< )"p LD , )zXh5 @H 8TT ] ;<i lPw$$u<eH(.DrTh@%c(bp /r,%  T&0@;PF"LH\V88`!p t(\}A,X('X(8$Ɣ   \ʐd%b)pD$  Z<#x4$LA$FRذa D px(,0(-(-D s%D<t%c, dDY\,)oD8@0GXR WL^ Фkhw\~L)oTD'` D%0'ht)) "$( 2(>OZ$x(Ld>n) h .ά$gt(p  ʐ  pI(h0;4$L $$ " H,$(6) A.Qt [D ldy)0 m$R G  aD<'  +P xT  %(:(0 2$L? 0P(-L_$$n$$x$P , "`%, HRLhld484F%~ :EZ$oIT{0d4DVx(t(%$lEDNG` $$$$3)?pQ,]$f 6pp` Dh$P@$ P8$ט8$  }8<'~)oH(4$8)7@(O,]'j$x8v Wnh\0d) x H ::  $  `8( "$|$ 0(% 8<0 @rh< N {x4 W@ g% < s$ L  s L p(  LXt ' $  J4 D ! d +l 9*\ O R$ [ aP|  i$T tp    x h 0 0 'd` 4 ǔp @ (*L !  '0 2|  @ @ M% ] iq@ | 5p0 xD $ @\@    (:0 D _ QT,  %  ;. B$$$ R  hԘ  ub`@ ~L )0 $| X Y8 s0 }( y@ d t < &$ 9 l G  L V$( c$~ u8    S  (% '4 )4 (H  #  <p<# /2!@`tN<Z$r |~4$0(%dD( )($)$Ƹ'o1$t`?@N `(Z'@bRlh{ H(3@ E@t|@ 8 dU % gH+AQ#ai `p%Hy\('4  L$ 9t$0p  &$dH$,8%lL5 <?'8J@Wp,e(.0n{{ 5d  < 6`y@% 7,X&t"'P( z 0 @>G4pTKx]'htwT|l *<l?pl\ },dŀT'$|< TO>H,Z8gcu'T }t 'XLi$$$*P0x hьD'| $|$$ 4'\=%It`V<p D|\@%¼  ($LDwd8LHgTLX ))?'E)xR$Zh l[8w 4+'|\l ? X s8,#d4 J DV,[(,8jLrC4z(:DԴ8Ix#j$@rp'%k \8)0<pHpUpT]%-<j@w_@%4$ H @C88 \ H ( t4'049@G,Q$W$_^ugk DhX HL0Tf$de|8HX@Upct$s$$8 j<  ,( T <`<0y\ hX(,"%(P9D@U T`Pcըxt h|$p'\* `*X|Ap$P$| A88&VX3%ct> @N$l$snLB4\hD$  / ,$lN<dd x5$d(L(0X#xf(y$<x<` d(v$lLۼ,$.X8 DC8PN$ϐ@_*4h  r\48X΀DpƤPp|H, 0)Put'(.48D@$IR'`Ϩn|Hud$$  7`4c((.@'{d|'$pTh%%h@-\$;!h0D tpV Lg$sn~ ` D<')t аH"ި  c %$ =$ J l Y l$ |h0 ׀ p '  -t H  L\ =<L L! 9lP!)!'tT!9t<!G!V`X!md!{$<!!! l!-t!@!<!J!L! <"%`("$"!$ф"3$">,@"J$ "QH"]z0L"g"o(+t"x @ "H"v"04"_D"b@"(,<"JP "| "'`""lH# p#t#'#9 t#F$P#M<#UW #^Bl#l)#}`#Y##(*P#'d#=## @d#R4#$#$$ $($&E($:X$KIP$X$ih$y$$e|$$!P$$${ $$$$$g% %)pH%"L0%*%f4%0$,%@%R(-H%Z B@%h%d(%x%\h%Ѱ%ټH%0%P%X%Up%%% xL%x&$|&'&%&2 l&D L&O &b$X$&p&w$&h,&D4&%`&pH&$& &D&!&fd&p'('!P'+}@'>)'H'Qg8'\D'x%8'C't'('%c't'L0'$8'(, ( $($dT(%+H(0Y(?)q(W(q({((,( L((tH(hH(%a(+,H(($)$)2 )1t)<%D)D)OU)Y$)c !X)t )$)/0)D)oL)% )) Ť<)Ր*y *!D*1bl*J *T%*^$(*gD*{q**|*$D*@**1T*m| *N8d*BX<+)+ H+Ƭ+)+,;+80+B'+Y `0+f)t+oDD+~$4+$dX+ +%d+ BH8+ P(+N4+(0+(6H$+ +1h+<<,$l,,*$4,7 |,A,T,fT,s  ,$,)xP,X,J,l,$|$, 8|,mL,l0,nl<- #(-  $-*%-1 6`-: l-JLj8-Y--r -}Ed-L4-%-0 -8- 8--t-)n-9`. .2Xt.+ .3BL.@#H@.Ty._(,@.jq.s .(-$.$d.((. EHP.۰d.t.\.d. // H/+x\/8)/=K/E$D/S,/\)/nF /x/4$/0/@/x/#40/(6@/ܼP/`\/<h0)O 0 @t0 $H0*z0=H0Ur0^0,l0m@0}0'p0%T000l`0H@0 $0$880 p15 1h1% 1+|1=11TE1_'`1fC1s1|1`|1$P1 01 !x1)r11((41%($1-<<2(L2 D2(|D2 20h2Hd2_2k902{5 2$2(62V2'd2X42H2',24HT2ol2 3 `830 3 M@l3+Mh3B<3b"D@3t#t|3 H3X38T3L3%,3 3D3$X4'844(+x4(t44,4F(*T4MjD4]%4i% 44u _4 l44$` 4I\L4%4"8<4442(4H44`4' 405%d5)15$$514|5D{|5N %Pl5hL85v()(57 55g5*5%L55$ˬ5%5L5OD6 6 ,,06(-l 6)G60xL6:$6CT6[$ 6g,H6u)oL6}6C6$646!p6(:X6 ,x6).6 06l,D7 (*X7)7"R7)X75D7G'x7Y, 7`|7l'|7y < 7p,7 7<D7Ph7(T 77$7@777(.H7 d78,h88() 85 8?r`8O,8c)8n 88}t8M@ L8%e (8 @8$ T8x8H8zhP88p8p9  T999$$92$9;(-,9E49S9` l|9u9%ft9#,9 U9 l9Klx9+9)$9T9[9$x:r`:%M(:1e|:@_:G':X ,@:l:u5(:::$:<<:: `l:p:$ :a:4:;%0;<;.";G ;P;YW;h;v;} hH;t;E\;Hx;$;)$;l;C;[d;W4<<<M8<)$h<-),<>"@> 0>!(>2 %p>?>M$`P>R$>`#޸>j{ >t 8> >'> r$>>h> |>)p> QT?Xt? 'd? D?%?5ˌT?GL8?U@?`$?i% ?t? 4???<?h?D<? sp0?d?3?&?l?@ $<@@)@%'@/@C@P@Z @fP@y l@uL@$@ @@CX@)@ZL@!<d@)u@$A$A%hLPA>AEYASA^\Ap$A~(A%aAA HA`tA ,A+$AA/tB`BtB%cB5B@$h$BR 9B] |BsphB$$B BBJdB@BlBB`B`C  CHC $<C(iTC8$CE(-0C[0Cb PCq'Cz_|C 0pC'lC(. C$Cf\PC$C%C%PCPC$CɸD %D) D.`D=dDEs8DQL4D^/D<Dn tDD@\D%DDD 4D,DF`DD$pExEtE,} 0E:htEHDEUKEa"xEk 0Et$`TEy:0E8 E8E?EdE EpEDE4E>tFF/DF( 4h F6XFG FR'DF] hFi F{0`F8F ,FTFFFT8(F(3DF%hF F$˨G$tG!G3 %@G?f`GQ |4G^%Ge~ \Gt|LG{ HHGfG pG"XG zlG( G$ѤG G(%GG(H 4H$XH5(+`H='pHF )HM1H\TpHio$HqpH}HGlH xTH,HH$8H`HH lH((DIj<I!l`I$I ƼLI5 _tIEhPIO$IVIb mIk$Iv`IILdI%I$I%I$I PItI%J t J ]JxJ"T`,J,$J8<JBJW6 Ja!tJk$Ju$~J)J DJ JdJJJ$J4JK)u0K?<K&AD8K/K>KG$pKT0K\$hKmK| hLKmK pKKdK WTK3dK(+L 'L4L$4L.L> hLLpL^)LjLz LkD,L LhDL ҰTL yL$< L LL%bL$ M$M x M$tLM9H,MD"(M_B|MgMwx<M(M$4 XM$M ,M)M \,M'׀M*$xN +DN 'N'N' N4$$N?tNM$0NfNm'Nw7N$\N'N NNYHNBXN$ǜN(.LNN <$O xO YLO$O-ODOVc0DO_ xOfYHOvǼOO$(O)tO 6HO,tO$OL`OdP8PP ahxP)|P2&hP; hTPM xP[@Po PP|P6$Pm< P P$P$P@PP ̄<Q$(8Q Q(Q<Q1$Q@cQI$`$QY)uQgQr ,|Q~#0Q QyT4QQ ,Q)dQ)4Q'xQ D0lQhQװR<<R, TR8' RF'RO R[pLRp@Rz˰0R R$R$R $R m4RR(R8R)iR8@R0R0R$S ZS$xS& \,(S6,SB% SOS`SqpSx7lS_LS)S!| Sh(S'8SG8S(3`S PSS$tT$T"\ T+h<T8H@TMT`t8Tm LTT%d8T)rTQhXT%T$aT(TX@T)OT$U HXUU U54U>HUJ'UN .P(U\Ue c4Uv(-U- UB8U:U P`UXUUxU(+UUM8$VV V* V<4DVEjXVS qlV['VgH@Vs%gV!lV$V O8V|VwVVXlVaV$V 4W$x@W$4W%%<W. <W=WH {8WTW^)p`Wl$W QW$ WWWW$$WW$(WXWWJ$XX#X. DX9LXI D XT(Xk$ X4\XX)X dX 0X$$X`|X * XkY(Y 0HY)%Y/PY<,YD)1YN Y]Ycۜ Yu lY$@YTY)(dYXY,Y4Y qpY[Y%Yk48Z iPZ  <ZRlZ0$ZGfZU XZj$Z'Z@Z%\Z `Z$0Z HZ%Z$`Z%Z$$Zۼx[ p[d[!G[-D[8%d([H^ [[ |([g [vxh[$[ (@[H[ b[$[ [:`[`[ |t[\I$\ =l\\#)n\280H\;qx\D\SQt\_g\\m+<\} B<\%g|\ \\\+\ 0 \0\`\4\ ]]!$a](\]:A]S,]b$]p M8]}z|]]x0]] d]$]L]h]$] _ ]l p]h@^^&̈^1p^?),^P L^_^k%D^skpx^| G,^ H^'^%,^$H^$4^`^ψl^<^ 2p^T_4T_ \_(*\_! \_-H|_:)_O `p_Xt0|_c(,_w_L`_(X_'h_ h_t_d8__$˸_($_$D<_(*`` @`Sh`/(*d`7  x`F t`T$`a|`p$4`Ap`$̘`$8D`טX``vl`8 ` `l`$a Pa$a!(4\a)l4a5 xaD laSTpaeav$aW<$a$a a)a88aDta( a"\|a,alda$,b'b%Hb$b2vb9$dbJ(+|bT|b](bpdb <b$br8b%d(bb \b tb xb R<b$?b' hc\cp8c&Hc/(6lc8 XcD$ cP(-c_0cfcp$$clc cc mc %c%fc6$<c cccLd ,Dd d, Xd7dH:dX\Tdb(dj|dxhdTddd \Xd$dd%c(d(d$$d0e@e e%e<$peR =DearenueyH e lpeheXeBhe$$ece(e<e#fXe5f'Hfvf'\f7`tfA 0*$fK f\Dp<fd DfmDf TTfa f$ftf% f Df 8f$ffPf\g$g"`g-}g:uxxgL)mgU g^',gh)8`g|g$g$gPg$gpHg8<g g qgBg3phhh 4hDh&ph.Dh8=hF$thN$`hYp4hd'hpYT|h% hwH$h)lDhWTh )hhXhS<4hĐh)(xh hi($(i i %Ti,F$ i:@iEiP $iX$i`δLif8iwi Bi iqX`i)oPiiN|ihi ei)@j Mj#W(j pj0j?ltjKH`jTk@j_jh_tj~ \Tj jbj$0j ?<j0#,j'|j pjj:j%k k)k!' k*"hk4'kBS|kJ/0kTDkc%e(ksפ(k| ``k pHkw8@k$k% kCHkJ$k*khk h,l(@l tl'l%0l-)o8l: kLDlH!Xxl_$4lg"lpb|,l}(llKllll$l@lj!llRXm m ,pmm$m3m?pmP mamkmwFlhm}vpmm$m @mm8m .((m)@m #<mxnlnn! G(n0tn= dnPn\'@nd)nn$n|%en)qnntn(+n<n$@n`n po(4<o"84o %o( lo8P oE `o]$|of$aspec_vnodeop_opv_desctcx_screenlistpfslowtimopmtu_probeunion_lookupuvm_map_callrandomreaduvm_page_lookup_freelistnfsv2_procidpf_normalize_iplongjmpimport_flownewblk_in_progressffs_vnodeop_opv_descxyc_unbusyprocfs_rwvfs_opv_descskdb_trapvfs_allocate_syncvnodecgthree_show_screenscsi_do_safeioctlarpresolvechange_displayparamzsc_intr_hardsys_minheritbridge_startputcharsystr_policy_pleeprom_takepfkey_addrfdesc_readdirchild_returnhmewatchdogsearch_promfdcresultuvm_map_initipsec_soft_first_usebpendsleepnkmempagesncr53c9x_scsi_cmdcopyinstrsys_getgidfpu_dtofext2fs_vnodeopv_descsdofilewritevdumpmagssmatchttyflushsys_setsockoptipcomp_inputvop_lookup_vp_offsetsdefrouter_lookupinetswpowerhook_establishcgthree_burnerkernfs_xreadip_reassin6addr_anyrt_maskedcopyfdesc_startVOP_ACCESSip6_get_prevhdrscheduler_start_insquepmap_changeprot4_4cdisk_findp9100_show_screennsphy_cdzs_printhme_mintsys_closebmsafemap_poolstrcpyin6_purgemkludgeffs_inode_allocnfs_receivedes_encrypt2mountlist_slocksys_setsidsvr4_sys_semsysbridge_timerprefetchaudio_attach_mitcx_setcolor__ashldi3vn_statsvr4_sys_fxstatvop_getattr_descunp_detachcompat_25_sys_fstatfsnd6_nud_hintether_ip6multicast_minsys_msggetchange_sign16_swap_bytes_be_mtsam7990_watchdog__mainsppp_lcp_downufs_quota_deleteportal_mounthardclocknptesghandle_workitem_freeblocksipsp_is_unspecifiedmyip_ifpin6_domifdetachdevopnnfs_syncfilt_audioreadwskbd_cndetachvop_whiteout_vp_offsetsdb_get_variablezs_read_datacd9660_vgetcrypto_dispatchtprintf_opensbppreadtcp_del_sackholesisp_reinitwsdisplay_burnerdest6_inputgsignaloptionsnodefdesc_statfspf_socket_lookupmii_mediachgipport_firstautocpu_hotfixipsendredirectsbpf_setifVOP_SETEXTATTRunp_internalizetk_rawccfc_lfcemptyvfs_export_lookupyieldifnetm_freemtbclosesc_print_addrcgfourteen_promcgthreeattachlogvn_writechkpmap_alloc_cpusoftdep_count_dependenciesin_ifscrubshmid_n2omttyioctlzskbd_rxsoftpdevnames_sizevfs_stdextattrctlroute_dstch_usergetelemstatusbridge_rtdeletewskbd_cdwsemul_sun_detachsys_getdirentriesbcmpcypress_cache_enabledb_set_breakpointsnd6_dad_startmsg_freehdrexec_maxhdrszam7990_stopblf_zerokeydb_force_whitespacesvr4_to_bsd_sigsetipsec_delete_policymmmmaprasops1_initticket_nats_activexdc_remove_iorquvm_map_spacefitsnewblk_hashtblsetjmpopenpromopenxyc_e2strwsdisplay_switchcgsix_stdscreenproc_targetsuvm_deviceopspppioctllogread_filtopsrasops_cursorvndxfer_poolfilt_fifowriteffs_specop_ptcp6_mtudisc_callbackcopyoutstrmainbus_matchpromcngetcext2fs_fifoop_opv_descuvm_swapin_remmodule_hypersparcimport_saxldcontrolbss_cdcs4231_get_propssd_scsibus_get_parmsswcr_newsessiontcp_attachsunos_sys_setsockoptwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writem_zeroffs_specop_entriesunp_gcingpf_pull_hdrbdevswbaddynamicportssemu_listau_set_lr_valueX_db_line_at_pcuvm_mk_pclusterp9100_scrlistptsstartdomainnamesvr4_sys_unamelockinitswap_encrypt_ctlgetdirtybufttywrite_filtopstcx_alloc_screennd6_ns_outputbpfkqfilterVOP_LEASEpmap_rmu_pzs_init_regnfsfifo_readumap_lockttyunblockmttystopremovedesi_dma_allocgetproplenigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2mfs_closenull_bug_bypassfilt_procdetach__divdi3amd7930_opensys_clock_settimebstp_designated_port_selectionpf_binats_inactivelocnamesnfs_vinvalbufdisk_busydb_breakpoint_alloctcp_pulloutofbandsddetachprocfs_domeminfopool_set_drain_hookmouse_copy_extend_linebe_tcvr_readarprequestsiginitfdesc_vnodeop_entriesvn_default_errorxydumpnfsrv_mkdirpf_frag_tree_RB_MINMAXsvr4_sys_socketip_sysctlsppp_ncp_checkunion_mountxdc_e2strmsdosfs_vptofhffs_fifoop_opv_descsuibytesvr4_sys_nicebstp_inputtrapbasecgtwo_accessopscgtwo_screenlistrasops24_putchar12setdisklabelnfs_disconnectdeflateknote_removemtty_caroutedomainfdesc_reclaimicmp6_errorimport_identityVOP_MKDIRip_protoxsys_settimeofdaysdstrategyaddlogpf_purge_expired_fragmentsuvm_page_physgetmsdosfs_syncbppclosestackgap_randomvlanattachendtrapcodeffs_clrblocktcp_timer_freesackbpf_filterchgproccntip_drainpflogstartdb_map_print_cmdsoqremque__adddi3nfsrv_initcacheuvm_map_inheritfifo_printinfosvr4_sys_pathconfbridge_flushrulecd9660_synccgtwo_setcolorsvr4_sys_sigaltstackin6_ifawithscopevop_inactive_descaudioreadfdc_cdnfs_rootuvm_schedulercgtwo_burnersync_printnchashvnopspool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenzeroin_addrprocfs_startuvm_map_protectwsfont_enumprintfin6addr_nodelocal_allnodesxdioctlencifrandomwriteprelist_updatenfs_sigintrhmac_ipad_buffercrypto_drivers_numsppp_pap_closeinit_machclkip6_protoxvsprintfsys_shmdtsys_recvfromcs4231_opensun4_hotfixswcr_freesessionunion_dowhiteoutttrstrtsys_sbrkpv_unlink4_4crandombt_loadcmapfdmatchzsnull_stintsysctl_doprocaudioattachkcopyvigra_stdscreenwsdisplayopenext2fs_inittiocm_to_zsrtfreechiptotimeunion_checkcuio_getptrcd9660_linkhypersparc_get_asyncfltsbpp_rwukattachhostnamelencgtwelve_stdscreencd9660_specop_entriesaltqioctlmulticast_register_ifm_tag_freegre_mobile_inputnfs_flushttyopensunos_sys_nfssvcnfsrvhashraw_ctlinputxyattachccdlookupticket_rules_inactivend6_ioctlppp_softcxystrategyipsec_in_useipsec_exp_allocationsbpfclosedevwaitsoftdep_setup_removesys_writevsys_setprioritycopywordsm_tag_prependsys_undeleteip_defttlsppp_auth_type_namearpintrfd_mountroot_hookkqueue_registercred0in_delmultinfs_fsyncuvm_forkvfs_op_descsnd6_rtrequestncr53c9x_selectuvm_km_suballocsun_dkioctlrasops_eraserowsbpfdetachfifo_ioctltunkqfilterttydefcharssigexithidirtypagesuk_cdfpu_normin6mask128pftm_tcp_establisheddead_lookupisbaduvm_amap_poolin_pcballocumap_unlockVOP_LOOKUPdb_shift_exprpftm_tcp_openingxdcloseclockmatchpcred_poolenqueue_randomnessbridge_ipsecipcomp_initemul_nativeienab_bis_4_4cwskbd_inputmachine_archdes3_zerokeysppp_cisco_sendsemcgsix_ras_copyrowshypersparc_memerrnfsm_strtmbufcrypto_getfeatvop_rename_vp_offsetssys_ovadvisehme_poll_stopsl_compress_initlockmgr_printinformc_delete_classwsmux_attach_scwsemul_sun_cnattachwsdisplay_kbdholdscreenufs_quota_alloc_inode2ipcomp6_input_cbVOP_WHITEOUTpnozz_cdtimerattachsocket_poolesp_read_regnfs_realign_countsemupgrphashsys_setpgidaltq_enablefd_set_motorkernfs_findtargetprofhzcbqopencache_enterdb_watch_tablefdesc_vfsopsexec_elf32_makecmdsumax_uc630_swext2fs_bufatoffsys_setlogindb_trapiommu_matcham7990_rintif_mark_ignoregre_in_cksumsppp_attachcrypto_kinvokern_deleteberintiskmemdevstat_rush_requestsreq_clear_inodedepsccodescgfourteen_loadcmapzs_get_speedsppp_ipcp_scripsec_def_compfc_lmdistancecs4231_sa_hw_ifnch_poolsomaxconnip6_mrouter_verpftm_udp_first_packetipsec_exp_timeoutsystrace_processreadyxyc_remove_iorqip_directedbcastisp_cdfixalignbe_tcvr_writesvr4_emul_pathuihashtblpf_rdrs_inactivescsi_get_xsau_get_portaudiommapdma_cabe_tcvr_idlefdcswintramap_initffs_flushfilesffs_blkprefetherip_allowkernfs_vnodeop_picmp_sysctlsys_lseeksystrace_iomapdevexec_aout_prep_zmagicaudio_check_paramsoclock_capool_cache_getnprocsdes3_decryptllinfo_arpfpu_implodepmap_enter_pdiradd_poolmsdosfs_accessaddupc_intrdvd_read_bcaam7990_copytobuf_contigwsevent_fininfs_connectip6statnfs_doioienab_bissuswordviking_memerrvmebus_translateuvm_pageboot_allocpf_state_tree_RB_REMOVE_COLORmii_phy_updateswwriteasync_daemonmmu_reservemon4mether_crc32_lecgfour_alloc_screennfs_numasyncrn_searchcgtwelve_free_screenipipstatsecureleveldb_consolesvr4_sys_aclwsemul_sun_output_haveescarpt_keepbstp_topology_change_detectionencrtrequestdb_printsympcache_flushsys_seteuidvmeprintmax_protohdruvm_map_checkprotmixer_opendes_is_weak_keyumap_node_hashtblzsops_ttyextent_findesp_sysctleeprom_cabufpagesrandomkqfiltervnddkdrivertbr_dequeuebridge_outputsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopskern_sysctlcgtwo_ioctlnd6_delaypmap_enu4min_pcbinitfdesc_selectnfssvc_addsockcompat_43_sys_recvsbppwritetdb_walkie_hardware_namesfdremoveuvm_tree_RB_NEXTigmp_fasttimoscsi_user_donekillprocp9100_ioctluserconf_cmdbuflinear8_to_linear16_leaudio_init_recorddb_print_loc_and_instpf_reassemblevop_pathconf_vp_offsetscgfour_mmapamd7930_query_encodingsppp_ipcp_downumapfs_mountvigra_putcmapiommu_printauxreg_cauvm_map_entry_poolnull_printcrgetsttywriteunp_bindtcp_delackcsignalreaddisklabeldb_print_cmdfubytewskbd_set_displayvirtual_availtunopentcpstat_udivreplace_endatapi_mode_sensefree_msgmapsdb_break_tablencr53c9x_pollfillmapentrynfsspec_accesstcp_timer_persistssioctlnfssvc_iodrelookupsys_umaskfpu_comparefilt_fileattachsysenttcp_setpersistwsscreen_lookup_syncufs_ihashlookuppmap_extract_pienab_bic_4_4cicmp_rediracceptledattachvop_reclaim_descwsemul_vt100_detachdb_boot_halt_cmdsoftdep_setup_inomapdepbridge_stopip_outputbpf_mtapfdc_resetfindblknamecgsix_ras_do_cursore2fs_i_bswapnfs_reconnectmfs_vnodeop_opv_descpool_initbpfreadpool_putm_copym2bus_mapunion_newuppersysctl_structpf_statusam7990_startxdcmatchpmap_pinitnfs_ngetuvm_useraccsysctl_rdstringuvn_attachlasttimefiforead_filtopscnkqfiltercryptoclosesysctl_disklockpf_state_tree_RB_MINMAXdesiredvnodespmap_redzonemsdosfs_readlinkp9100_setcolordes1_encryptspec_vnodeop_pxygetdisklabelukmatchlookupnchinitexec_mapdb_qualifysnprintfext2fs_readlinksoftdep_setup_blkmapdepaudioprobeether_ioctlsyscallrnd_attachedsppp_state_namepf_normalize_tcpoptunion_getattrip6_forwardingkdb_kbd_trapanon_swap_offhme_meminitarp_allocatedrasops_isgraypflogattachifindex2ifnetcd9660_ioctlbridge_rtagein6_savemkludgein_pcbnotifyallbstp_tcn_timer_expiryfilt_audiowdetachpv_flushcachemouse_copy_worduvm_pglistallocwsdisplay_addscreenincorehzwskbddoioctlprobesetdefrouter_resetunion_islockedstart_cryptocd9660_ihashinsfreefile_poolbe_cacheckaliasamd7930_round_blocksizegetquotattyretypestartuphook_listsvr4_sys_fstatvfssrmmu_vcache_flush_regionrt_timer_queue_changecpu_attachssreadsd_switchfdchwintrsun4_vcache_flush_pagesdclosevop_generic_kqfiltersvr4_sys_creat64pffasttimoinitsiginfosys_getuiddb_set_cmdcgtwelve_mmapuvm_unlock_fpageqberesetexec_setup_stackgetfppager_map_wanted_locknfs_clientduao_createdb_free_watchpointspf_rdrsffs_realloccgnifvlanptcselectpf_natswskbd_load_keymapcs4231_round_blocksizeqe_rintcd9660_bufatoffaudioclosegroupmemberuvmspace_initether_sprintfsttyttymsdosfs_unlocksoftdep_move_dependenciesselwaitppp_bsd_compressktrnameiicmp6_mtudisc_callbacksmodule_ms1sys_forknfs_readdirsppp_ipcp_tlfvop_setextattr_descpfkeyv2_dump_walkerip_setmoptions__qdivrempil_to_vmenull_node_createldcontrolbspec_opencgfourteen_mmapswcr_sessionsfilt_bpfreaddb_watchpoint_freewsdisplay_emulinputuvm_fault_wiresi_freenfs_niothreadsnptyvm_nphyssegshmget_allocate_segmentsvr4_netattachproc_filtopsuvm_lock_fpageqelf32_os_pt_notefiledescopensys_vforkvop_reclaim_vp_offsetsuvm_pager_initCopybufferwinChkNamest_decide_modedvd_read_copyrightdmaprintvmi_list_slockpool_draindb_history_prevsppp_ipcp_TOsvr4_sys_msgsystrap_typesun4_cache_enablesync_vnodeop_psys_mkdiruao_reference_lockedufs_fhtovpcrypto_doneacc_discard_filterswskbd_translaterttrashbridge_brlconfmblowatrasops_rmaskgetnewvnodeufs_inactivepromcnprobend6_mmaxtriesamd7930_start_outputbe_tcvr_read_bit2sys_socketnwindowsdead_vnodeop_opv_descncr5380_wait_req_timoxdc_rqtopbsunos_sysentvop_generic_bwritepf_binats_activesvr4_sys_stat64cgeight_show_screenufsspec_writedead_vnodeop_entrieshme_tintiso_disklabelspooffdfreefifo_badopsuwordwsemul_sun_scrollupipcomp_zeroizesppp_get_ip_addrstty_countsvr4_sys_faclie_setupramdmaattachfindnodemkdirlisthddeflate_globalpf_get_binatraw_disconnectipsp_pending_acquireipsec_ipcomp_default_levelaudio_selectsvr4_delete_socketbrelvpmsdosfs_mountfszstty_attachvigra_getcmapip6_sprintfsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategyuserconf_parseip6_keepfaithsys_msgrcvqec_resetext2fs_alloccheck_inode_unwrittenusercryptocompat_43_sys_getrlimitdb_eregsst_loadfdcopyrmc_get_weightlkmopenemul_findfdesc_getattrqeintrb_to_qled_blinkred_getstatsxd_cdudp_sendspacenfs_mknodSHA1Updatevfs_rootmountalloccd9660_openuvmcnt_dumpnfsrv_wakenfsdpf_frag_tree_RB_REMOVE_COLORxboxmatchip6_mforwardsoftdep_setup_allocindir_metabsdi_sihme_mii_writecmaskext2fs_blkprefmsgmapsdb_pool_print_cmdbstp_stopdb_delete_linesvr4_to_bsd_speedzsops_nullrpc_auth_unixVOP_ISLOCKEDshm_committedsys_kqueueccdgetdisklabelcgfour_burnerauiopuao_referencesunos_sys_execvein6_addrscopesunos_sys_lstatled_cycledb_searchmaxlockdepthpppcloseraw_usrreqsystrace_closepolicyksymsopenoclk_set_secsnblkdevunion_initscancttyinputpf_frag_tree_RB_FINDesp_dma_isintrunion_leasebiodoneah_inputdb_set_breakpointcrp_req_queue_tailmyetheraddrgettdbkernfs_statfsukopenmaxslpext2fs_makeinodeswap_bytes_change_sign16_lest_read_block_limitsviking_mmu_enableufsread_filtopsufs_symlinkcd_scsibus_set_modein_pcbnotifyufs_mkdirmbppioctlgetidprom.mulcgtwomatchin_iawithaddrsystracef_select__anddi3cs4231_setup_outputtbrt_missmsgdofilereadkqueue_selectVOP_BMAPip_dooptionsvn_lockumap_bwritepf_change_icmprip6_ctlinputxd_castty_modem_controlpmap_extract4_4c_mulpar_err_regwsemul_vt100_handle_csiqe_readsbdropaltq_assertmkdir_poolxyc_entoacttcp_debugpmap_protect4_4cqecattachsplassert_checknextralocacc_delete_filterpf_compare_rulescgsix_show_screenzs_abortsetusesppp_ioctlsys_setegidblf_keynoswap_bytes_mtsrn_matchfdesc_readlinkfifo_readam7990_setladrfcd9660_symlinknfs_progppplogcharautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockallsvr4_sys_mmapuvm_faultrandomioctlxyc_rqinitpppwritesoreceivesystrace_newpolicytctrl_intrpool_getuextralocdb_show_radix_noderootfspf_frent_plsunos_sys_setrlimitfpu_initrip6_outputsoftdep_freefileinflateportal_vnodeop_entriesscsibus_cdndflushipsec_last_addedpmap_kenter_pa4_4ccompose_tab_cmprn_insertfilt_kqdetachkernel_segtable_storesbppioctldb_flush_lineipsec_exp_bytesipcomp_sysctlbufqueuesconfig_deferm_tag_initif_attachfpu_sqrtgre_lookupsttyioctldqsynctcp_sack_adjustm_reclaimnameiext2fs_readdirip6_ctloutputpv_syncflags4_4cmfs_reclaimversionzs_breakvpagekqueue_initxysizeuvm_pagezeronfs_readrpcin6_setsockaddrigmp_leavegroupsvr4_sys_getdents64masterpaddrmountlistcgfourteen_scrlistbstp_initializationuserconf_histbufcgtwo_getcmapnfs_mknodrpctunreadconfig_deactivateVOP_REVOKEscsi_probe_bussesclallocipsec_esp_trans_default_levelbiowaitzstty_cafilt_ufsreadxdwriteunixswsccsdb_stop_at_pcwinuf_invalidsvr4_sys_lstat64sw_2_leftoverwsdisplaymmapccpuncr53c9x_readregsobio_cduvm_map_replaceunion_selectrmc_newclasssvr4_to_bsd_sigzskbd_rawaudiocs_canfsrv3_procsfdinitboothowtoarc4randomtcp_delack_ticksttopenether_ipmulticast_minconfig_rootsearchrip6_sendspacescsidebug_lunsuao_dropswapenxioesp_attachslowtraprnd_event_headwsdisplay_switchtoconsolein6_maxmtupfopenSHA1InitRMD160TransforminflateInit2ie_cauvm_map_findspacesystraceioctlwsevent_initcryptoopenuserasymcryptono_asyncflt_regssvr4_jerq_ioctlsdsizefdstrategysys_pwritevesp_dma_intrkqueue_scansys_semgetvop_print_desctcp_closenfsnodehashsd_patternsX_db_search_symbolmatchbynamescsi_initmsdosfs_advlockswcr_iddb_varsst_switchch_switchm_padfallocbufferszskbd_consopsctx_alloc_udivdvma_basesppp_lcp_tlupromvecdatcgfour_free_screendb_breakpoint_freepfctlinputphys_mapuvm_anon_removeufs_lockhme_mcresetsys_accessnsphy_statusgif_ioctluserconf_initintrnameskillpg1ierintmouse_removesunkbd5_keymapdatacpumatch_sun4cnfs_getreqext2fs_mountrootxboxprintregyearcompat_43_sys_sendmsgpf_find_statesetrunnablepool_do_putclock_cdnfs_closedb_check_interruptsd_crazymapnd6_prefix_onlinkgre_ioctlsppp_ipcp_initosversionelf32_read_fromau_get_lr_valueprocfs_getattrnull_node_hashtblfilesys_syncertvtohzip6_mroutervmi_listnewfreefragudp6_usrreqratecheckin_rtchangevfs_syncwaitcansignalunion_startmsdosfs_check_exportsystrace_locklf_setlocknbigpipewsfont_map_unicharnfsv3_procidin_controllmaxuvm_pagecopysw_optionssysctl_quadsys_readvndclearpf_nfrentslevelsoftcs4231_closecompat_10_sys_semsysmbstatttyinfodb_flush_lexp9100_mmapzs_putcnfs_savenickauthttyinmfs_checkexpqe_cagetnulldevticket_nats_inactiveextent_destroydb_lpip6_forward_srcrtnfs_writebpenc_xform_rijndael128fdesc_rootaltq_detachgetcttsetwaterwhichqsdb_last_addrmouse_copy_startcgfourmatchmsgbufenabledbsd_to_svr4_sigsetunp_disconnectzsopenufsfifo_writesys_listensys_mountcgsix_ioctlfifo_nfsv2nodeop_ppgsignalpf_get_sportfirstcshm_delete_mappinglinear16_to_ulinear8_bedb_read_bytestcp_rndiss_inittdb_deletecgthreematchrasops32_initunion_copyfileaudio_silence_copyoutuvm_page_rehashvop_getattr_vp_offsetsvop_islocked_vp_offsetsksymsattachqe_ifmedia_stspf_state_tree_RB_INSERTffs_fsyncfdesc_opencgeight_free_screennfs_sillyrenameau_portofrasops8_putchar12wsdisplay_consinetdomainwsfont_findkernfs_getattrmemcpysunos_sys_statfspmap_is_modified4maltqclosekthread_exitcgfourteen_stdscreensi_getdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrreqpfkeyv2_cleanupspec_writeaudiostartrdqhashipsec_esp_network_default_leveldb_map_equalnbpgin_broadcastfd_getfilencr53c9x_free_ecbptcwritesdioctlrpc_msgdeniedpf_binat_plutsnamefdcstateexit2__hex2asciiwsmux_isset_displayumapfs_startgetcpuinfosbusresetip6_mloopbackext2fs_cgupdaterandomselectdb_aout_sym_initcurpriorityiommu_attachpppasyncctlpufs_lookupscanjet_ctl_writeufs_bmapdoasyncfreesync_vnodeop_opv_descdegetkthread_createsi_findtunclosedb_elf_sym_initam7990_copyfrombuf_contigsvr4_sys_waitcd_scsibus_get_modeffs_fifoop_entrieslogclosecgtwelve_screenlistsppp_increasing_timeoutnbufvop_setextattr_vp_offsetsufs_strategybounds_check_with_labelether_input_mbufbstp_disable_change_detectionif_qflushumapfs_vptofharc4_timeoutext2fs_checkpathbstp_initialize_portsocantrcvmoredevclsfile_filtopsst_cdch_cdmsdosfs_renamesysctl_proc_argsqeinitzskbd_putcdes1_zerokeypipe_wfiltops__lshldi3reginvalturbosparc_cache_enableturbosparc_get_syncfltlematchsd_scsibus_mode_sensezstty_cdpmap_activatevop_create_vp_offsetsbstp_port_state_selectionconfig_make_softcncr53c9x_msgoutunp_discardexec_aout_makecmdsfuiwordip6_outputfd_camagma_hardcgthree_mmapip6_mrouter_getswap_syscall_lockufs_kqfilterscsi_autoconfcheckdirsexecswqeattachkdvma_mapinin6_are_prefix_equalin6_controlleapyearsys_sigsuspendcd9660_unmountcs4231_intrtcp_seq_subtractsvr4_sys_statvfsswcr_authcomputetrapsignalcurproczscloserushjobwskernel_fgunion_vnodeop_pdb_single_step_cmdnd_defrouterblf_decfdcloseexecprocfs_unmountlimcopynfs_vptofhtcp_timer_rexmtvmebus_sccrypto_pool_initializeduvm_swap_markdecryptrt_timer_initnd6_useloopbackxyc_cafuibyterip6stattcp_debxnullfs_vptofhcd_casys_truncateesigcodescsi_xfer_poolnfs_boot_getfhsvr4_sys_pread64mttywritecgfourteen_getcmapsi_dma_intr_timocache_alias_distsppp_pap_opensoacceptcdgetdisklabelvop_bmap_vp_offsetssvr4_sys_ioctldb_call_depthdb_printfbootstrapufs_creatend6_optionscd9660_seekpv_link4mcgsix_mmapmsdosfs_unmountelf32_load_psectionunion_abortopprocfs_stat_genslinputunion_unmount_count_vnodemtty_cdcpumatch_turbosparcdb_add_symbol_tablem_tag_nextch_getelemstatusmax_softdepsmsdosfs_writecompat_43_sys_getdirentriesexec_script_makecmdsignore_bogus_trapsfilt_pipedetachcd9660_rootdb_unaryss_switchselrecordrip_outputsppp_strnlenext2fs_accessmld6_fasttimeokthread_qimaxxdc_piodriverkernfs_writepf_dynaddr_removecg3_videoctrlvop_unlock_vp_offsetsstioctlchioctluserconf_pdevuvm_object_printitmustek_get_statustcp_sack_partialackp9100_alloc_screenzstty_rxsoftmbpoolxdcintrst_write_filemarkstcp_canceltimersticket_rdrs_inactiverip_recvspaceroute_initccdreaddb_store_countsd_scsibus_flushipsp_spd_inplink_rtrequestuvm_vmspace_poolsunos_sys_getrlimitmfs_rootbasefdesc_inactivespec_lookupstackgap_initnfsbootdevnamefifowrite_filtopssysctl_vnodend6_sysctlnmi_hardipsec_common_inputvn_openpf_frag_tree_RB_NEXTnfssvc_sockheadsppp_pap_TOpf_route6.udivnull_node_hashuao_detachmallocsbppselectamap_pp_adjrefrpc_versesp_inputin_pcbrtentrynfs_iodwantbstp_forward_delay_timer_expirysvr4_sys_timescpumatch_vikingknote_dequeueamd7930matchpftm_other_singletcp_outflagskqueue_statsbus_testdmanfs_boot_initpppdealloccd9660_rrip_analyzeoclock_cdkernfs_startnfs_vfsopsienab_bis_4msunos_sys_fstatfsip6_v6onlysys_preadvms1_mmu_enabledb_tok_stringnfsv3_typesys_recvmsgpipe_statskipjack_setkeyumapfs_initvn_writevop_mkdir_vp_offsetsVOP_LINKicmp_inputuvm_km_free_poolpage1vcountms1_cache_enablevm_page_zero_enableinodedep_hashppptioctlin6_delmultistathzpf_test_state_udpenc_xform_cast5bsd_to_svr4_sigactionah4_input_cbmem_access_faultwskbd_cnattachktrcansetvirtual_endledmamatchsys_getloginbuckstring_initipsec_hdrszunion_reclaimicmp6_rediracceptext2fs_vnodeop_opv_descms1_cache_flush_alldetruncdb_elf_symbol_valuesnswitchexitcgthree_cacopyoutpfindesp_caip_ctloutputp9100matchwsevent_readenc_xform_arc4pf_routearp_ifinitdb_write_variableufs_dirbadsleepcd9660_readdirvfs_unmountallpf_match_portccdattachrasops1_putchar16copyrightvigra_mmapsdattachvop_whiteout_desctcp_timer_keepportal_inactivewsemul_vt100_cnattachtcp_mss_updatesvr4_to_bsd_sigactione2fs_cg_bswapdb_show_all_procspower_cdvunmapbufip6_sourcecheck_intervalfb_cookieroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastprocfs_readdirchange_sign16_swap_bytes_bedb_output_positionicmpmaskreplmsdosfs_mknodcd9660_specop_pzs_read_regip6_defmcasthlimsys_munmapsttymatchfilt_solistenvsnprintfpf_map_port_rangewsemuldisplaydevprintsrmmu_cache_flusharplookupunion_inactiveamd7930_halt_outputuvm_map_pageablekernfs_pathconfchainallocpf_change_a6sun4_cache_flushifmedia_baudrateedataxyc_startuvm_pagelookupfree_allocindirsoshutdownuserconf_hist_cmdnfs_writerpctcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tabletctrl_ext_statuseswsemul_vt100_scrolldownwsdisplay_getc_dummybpf_iflistPaste_availip6intrqnd6_rs_inputsystraceselectssstrategypmap_is_referenced_psoabortlinear16_to_linear8_bememerr4mmemerr4_4ccast_encryptunp_inoxy_calogkqfiltersw_cdsvr4_sys_setegidtcx_mmapuvm_tree_RB_INSERTdb_extent_print_cmduprintfsppp_set_ip_addruvm_page_printitamd7930_start_inputmainbus_casoftdep_flushworklistsys_issetugidinitclockscd9660_mmapwsdisplayselectsd_reassign_blockszsstart_txif_detachttcompatsetlflagssetup_allocindir_phase2isp_controlsvr4_sys_auditsysnd6_cache_lladdrifqmaxlencatqsession_poolipsec_get_acquireext2fs_specop_opv_descunp_connectuvm_pagermapinif_detached_startpool_serialopennodevfs_mountedondb_expressionpmap_deactivatefc_lookupsemu_alloclinear8_to_linear16_be_mtscgtwo_cdfifo_selectif_downndqbfilt_rndreadallocsysconsdev_prommodule_swiftVOP_GETATTRsvr4_termios_to_termiofuswordnfs_reclaimpgt_page_allocnfs_advelf32_check_headerbt_setcolortcp6_usrreqmmu_has_holedb_historymodule_cypressnfs_loadattrcachelehwinitnfsm_rpcheadnfsrv_readdirtcp_rndiss_cntpf_rules_activepmap_unwireipaddrip6_auto_linklocalbridgeintr_framecompat_43_sys_getdtablesizeuvm_pageunwiream7990_intrwsmuxdoioctlauth_hash_hmac_md5_96tcx_casvr4_sys_pwrite64ip6_mrtprotocdattachuserconf_devicenonidempotentin_localaddrsys_sigaltstackaltq_extractflownfsrv_fsinfozs_majornfsrv_symlinkDES_versionsl_uncompress_tcpsoisdisconnectingrasops24_makestampBlowfish_initstateauth_hash_key_sha1sttyclosenfs_vgetrttimer_queue_headptsreadbridge_filterrulertredirectuvm_map_printitdb_read_variabledb_regsdb_stack_dumpstty_compute_baudcd_scsibus_setchanttymodemdb_lbuf_endwsdisplay_defaultscreensi7kqueue_poolpf_get_rdrvntblinitallcftables.divcgfour_casvr4_stream_ioctlpmap_prefernfsrttonVOP_REALLOCBLKSregion_lrunfsrv_accesssdebugsvr4_esigcodecgfour_screenlistmsdosfs_sync_vnodesplassert_failtty_initwsdisplay_clearonclosesdzerorefindir_truncudp6_recvspaceuvm_km_freesys_killzswritestart_nfsiouserconf_numberrt_setmetricssys_getegidredclosest_spaceam7990_getvndgetdisklabelhas_iocachest_quirk_patternsdirchkipip_outputpipecloseext2fs_fifoop_entriesVOP_REMOVEcgtwelve_burnersvr4_to_bsd_termiosconsinitext2fs_dirremoveipsp_aux_matchuvm_vnp_uncachesysctl__stringxyopenbus_untmpffs_clusteracctnfs_timerconfig_detachsvr4_sys_pauseifaof_ifpforaddreeprom_updatecryptop_poolfiledesc0rt_timer_queue_destroydma_cdsunos_sys_accessrequest_cleanupsd_cdnfs_createnfs_sndlockportal_setattricmp_mtudiscipport_hifirstautonull_vnodeop_opv_descsys_fstathmestopslclosecgfourteen_ioctlenc_xform_3desdb_symformat_aoutuserconf_enablegetpropintext2fs_vinitdb_endlpcryptodevallowsoftsa6_anysys_getprioritytcx_cdhmeinitsparc_db_command_tablenfs_bioreadumap_bug_bypasssysctl_diskinituvm_km_vallochandle_allocindir_partdonetunselectunion_vn_closeprocfs_inactivesys_unmountiommu_sctbtioctlnfsrv_getattrelf32_probespf_fragcachein6ifa_ifpwithaddramd7930attachvgonelbridgeintrbwtwomatchsofreectrl_eventunion_mkwhiteoutdb_del_symbol_tabledb_add_exprmbpp_attachpmap_removenfs_statfsicmp6_fasttimoext2fs_removesi_vme_dma_startbpf_setfuserconf_historyktrsettracevnodexymatchuvm_page_unbusyipsp_skipcrypto_unmarksppp_print_stringtk_noutext2fs_mountcgfourteen_putcmapmif6tablepmap_collectBlowfish_expand0statecgsix_accessopsdb_symformat_elfcpu_sysctlcd9660_vnodeop_pcd9660_deftstampwskbddocloseip_randomidaudio_rintcd1400_compute_baudtbopennosuidcoredumpsuiwordcddumpbstp_send_config_bpdudb_search_cmdwsdisplay_noemul_casbppattachcs4231_trigger_inputtcp_disconnectvop_open_vp_offsetsuvmspace_execsunos_sys_getdentswsmux_createdeallocate_dependenciessys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnameaudio_cddb_print_llinfoacc_classifywsdisplay_emulbellsadb_exts_allowed_inme_allocfdstartext2fs_bmapuvmexpenc_xform_blfesp_dma_resetsppp_ipcp_opt_namepmap_changeprot_pufs_diremptyesp_output_cbreinsertfinishdupcs4231_query_devinfost_crazymapqsphy_resetmemregattachdeflate_decompresspool_destroylogwakeupshutdownhook_listip_dosourceroutesoread_filtopsdisk_changewsemul_vt100_resetopamap_lookupsdoreallocblksbstp_designated_portred_destroysvr4_readdir64_callbacklerdcsrbpfread_filtopsunion_whiteoutsoinitamd7930_getdevzsc_intr_softcpumatch_unknownnull_vfsopsVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protoext2fs_truncatecd_play_tracksip6_maxfragpacketsdb_errorzskbd_rbuf_lowatsppp_cp_inputzskbd_device_lookuphexatoittydebuglminscsi_probe_bussys_fpathconfdvma_mapoutarpt_prunecnopensoconnect2knote_poolscsi_test_unit_readyfdattachrmc_modclasszs_hwiflownmbclustunion_updatevpvop_reallocblks_vp_offsetssominconnpmap_enk4msegm_freelistledmaintrnchashtbluvm_vnp_syncmclpool_allocatorcgeight_cawsmux_set_displaysvr4_sys_execveinodedep_poolarpt_downunion_openportal_rootwsmoused_wakeupstate_regsbpf_tapdb_lookuprasops15_putchar12wsmousedmii_phy_autonfs_mountrootmax_datalensvr4_sys_getrlimitmsdosfs_initkernfs_printvop_readdir_descesp_cdext2fs_writelf_clearlockch_exchangenfs_udpsockdb_lastsymip_srcrouteip6_accept_rtadvpf_test_otherccdlocklemediachangeportal_statfsvinvalbuflo_microtimebestartsunos_sys_mmapnfs_mkdirsys_ftruncateah6_input_cbsoftdep_fsyncm_splitisp_donencr53c9x_attachkrp_req_queue_tailtcp_timer_initdb_tab_stop_widthdb_putncharsoclk_get_dtnd6_maxnudhinttcp6_inputsosetopttcp_msscs4231_attachcache_purgebeqintbpf_mcopyauth_hash_hmac_sha1_96kern_targetsfork1am7990_ioctldb_activevfs_hang_addrlistst_cach_camrt6statdead_writemagma_caufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriestcp_rndiss_msbsys_chmodccdsizepf_nats_activespifstcintr_rxprelist_removeffs_vgetinitprocbt2pmtsystraceread__umoddi3nfssvc_nfsdmbpp_cdgmt_to_dtsppp_lcp_RCN_rejcgtwelveattachip6_log_intervalvigra_show_screenuvm_page_physdumpVOP_SELECTccdbufferpf_insert_statenfs_readlinkrpcX_db_sym_initmbpp_cavt100_initchartablesext2fs_checkoverlapsolisten_filtopsin6_update_ifamyleintrstat_inode_bitmapvop_bmap_desc_udivreplacebwtwo_accessopsqecprinttcp_sack_optionsd_shutdownmem_noext2fs_buf_allocsoftdep_disk_write_completeipcomp_input_cbdb_prom_cmdcs4231_trigger_outputstwritepfkeyv2_get_proto_algpfkeyv2_releaseRMD160Update_intrevarprequestkernel_mapbwtwo_screenlistzskbd_rbuf_hiwatdumpdevppp_dequeuebwtwoattachsppp_lcp_upcd9660_lockuvm_unloananonietintchange_sign16_swap_bytes_le_mtsvfs_mount_foreach_vnodekqueue_kqfiltersoftdep_typenameskernfs_vfreeamd7930_get_propsimport_lifetimeip6_mrouter_doneaudio_opencgtwelve_ioctlzeroin6_addrmemreg_castrncasecmpin_ifaddrnull_lookupsunkbd_keymapdatand6_optionunion_readlinksppp_chap_initwin2unixfnmax_hdresp_dma_setupnum_inodedepffs_readinet_ntoa4m_freezs_cavop_default_descscsi_inqmatchfdesc_poolvop_strategy_vp_offsetspool_page_allocbstp_become_designated_portfilt_pipewritecompat_43_sys_setreuidin_pcblookupm_tag_delete_chainsvr4_sys_signalpool_head_slockipe4_initbzeropromcnputctickfixintervalpmap_phys_addressufs_closeprocfs_validfilefixjobcprocfs_accesstctrl_process_responsedb_show_all_cmdsscsi_execute_xssparc_noopin6_addmultistat_ino_limit_pushrn_newpairvop_setattr_descdb_find_breakpoint_heremsginfopppfcs__udivdi3sys_obreakblf_setkeyxdc_tickdesirednfsrvcachepf_routablesttystopkernfs_mountsystrace_msg_emulmemregmatchcpu_classbwtwo_stdscreenlastddateromgetcursoraddrzs_set_modeslemediastatusswap_key_cleanupin6mask0bpf_validateunion_mknodvaccessieinituao_set_swslotmbinitchange_sign8p9100_loadcmaphypersparc_mmu_enablewskbd_default_bell_datacbqioctlsbpp_caxdc_submit_iorqamap_allocVOP_LOCKMD5Finalstty_casbppopencgsix_resetwskbd_matchsd_scsibus_opscp_timencr5380_initcgfourteenmatchsbus_attachcd9660_vget_internalsystracef_readlinear16_to_linear8_ledb_page_print_cmdcypress_cache_flush_allipsec_acquire_poollkmioctlvgetzs_conschanvndthrottleamd7930_set_portwinChksumfreeclusterchainmld6_initpftm_tcp_closinghardmemerr4mprocfs_checkiopermdisk_initsvr4_sys_systeminfobeintrnfs_nameicd9660_fifoop_opv_descrip6_ctloutputnfs_getattrcachenetiond6_na_outputext2fs_fhtovpext2fs_createpool_page_free_nointrhmeintrnfsrv_createnfs_realignvfs_opv_init_explicitnsphy_caseminfosysctl_dopoolcd9660_fifoop_pumap_bypasspmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinuvm_map_createvfs_opv_initissignalhypersparc_pure_vcache_flushCopybuffer_sizenetclsktrinitheadercdevvpsvr4_find_socketmbppreadch_get_quirksigmp_joingroupinflateIncompbeeintuiomoveled_cdmsdosfs_startdeviocdb_loop_countmfs_rootsizebpf_reset_dnd6_dad_stopcs4231_readuseloopbackuvm_waitnfsfifo_closenexecsststartbetintpmap_referenceprocess_worklist_itemsys_bindclockattachloioctltty_detachdma_gofindrootfpu_cleanuppmap_bootstrapipsec_auth_default_levelblf_cbc_encryptcputypbigadjkmeminit_nkmempagesnfs_sysctlipsec_policy_poolspec_vnodeop_entriesfdsizeshm_last_freeunion_copyupcnselectfillinusemaprecvitipsec_common_ctlinputtdb_rehashipcomp_outputfilt_sowritecnpollcuvm_kernaccsys_linkadd_to_worklistlog_opensi_optionsnumnfsrvcachegettdbbyaddrfragtbl124portal_vnodeop_puserconf_totdevvop_inactive_vp_offsetsrt_ifmsgrt_tablesqec_putrealitexpireunix2dostimeipstatsrmmu_get_syncfltnfs_initscsibus_cacompat_43_sys_truncatecrfreecnputcin6_gif_inputxyc_perroripsp_delete_acquireip6_lasthdrviking_cache_enablescsi_change_defnfs_bmappool_sethiwatwsemul_vt100_output_c0c1sbus_printmicrotimeppp_deflate_drafttree_lan_extncr5380_wait_phase_timouvm_swap_getaudiosetinfoext2fs_reloadif_detach_rtdeletecs4231_get_portnfsrv_getstreamcsefindelf32_copyargsisocharpf_frag_treeuvm_km_alloc1cdopentcp_usrclosedqec_caiommu_removeskipjack_backwardsphysmempagedep_lookupwskbd_holdscreeninferiorxy_cdclusterallocext2fs_fifoop_pcryptof_readxformswltsleepwskbd_attachin_pcbbindunion_mkshadowisp_sbus_cap9100_screenlistnfs_node_poolrtalloc2endtsleepuvm_pageratopsigactssharesadb_exts_allowed_outdb_set_watchpointbe_tx_harvestnfsrvw_sortbpfattachitimerdecrvnddumpether_outputshmexitmbppopenexport_authauth_hash_md5crypto_kdoneunion_rmdirnfs_removem_copym0vm_physmemprocfs_allocvpprocfs_initiso_shipdirrnd_timeouticmpmaskpipe_ioctlwskbd_enablecd9660_mountrootnetlckbpf_allocbufsmsgbufmappedtctrl_write_datacompat_43_sys_setregidgetphysbufcdsizedb_symbol_valuessppp_lcp_check_and_closedb_evarssppp_ipcp_openufsfifo_closeumap_vfsopswakeupsoftdep_slowdowncgeight_accessopscompat_43_sys_sethostidiommu_cdtcprexmtthreshprocfs_vnodeop_psetquotastat_countprt_getifaslstartdb_malloc_print_cmdenosyscompat_43_sys_creatlockmgrbstp_tickisp_uninitgetdevunituvm_vnodeopsvfsconfbe_tcvr_initsrmmu_vcache_flush_contextVOP_OPENwsdisplay_console_inittedsvr4_term_ioctlvigra_ioctlconsdev_ttybuckstringsvr4_sys_gettimeofdayscsi_interpret_sensepfkey_unregisterext2fs_flushfilesmsdosfs_vnodeop_pnullfs_fhtovpaltq_attachdes_ecb3_encryptunion_revokepower_capromvecufs_readlinkdoscheckpathnfsv2_vnodeop_opv_descpcbmapunion_rootaudio_readnd6_option_initmfs_initminirootuvm_km_alloc_poolpage1ricoh_is410_swprocess_set_pcin6_init_prefix_ltimessoftdep_change_directoryentry_offsetesp_outputprocfs_vnodeop_entriesnchstatsmsgbufpcd9660_fhtovpsys_setgiduserconf_common_attrswapconffd_dev_to_typefilt_ufswritetcx_scrlistrt6_flushttselectpf_rdrs_activeuvm_mlk_callbstp_config_bpdu_generationpgt_page_freemmrwffs_bufatoffah_input_cbfdcattachcpumatch_hypersparcunion_removeuvm_errno2vmerrorsubkey_table_gencompat_43_sys_getsocknamedohooksmustek_compute_sizesnfs_quotactlrasops24_erasecolsif_detached_ioctllocnampstat_ino_limit_hitbridge_rttrimvop_close_descstat_blk_limit_hitbstp_enable_porttun_outputuserconf_showip_mtudisc_timeout_qffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridamd7930_deviceprocfs_openpool_setlowatkmembaserip6_inituvm_aiobuf_poolisofncmpipsec_add_policysttyopencgeight_scrlistsys_sigprocmaskdb_commandnfs_renamerpcsys_shmctle2fs_sb_bswapin6_if_upfilt_pipereadskip_spc_rightcompat_43_sys_gethostidsoreservepidtakendb_formatmfs_priwsmux_displayioctlpf_test6vmeintruvm_mmapxdr_string_decodeufs_quotactlpf_tree_plcgfour_cdviking_get_syncflttcp_newrenosparc_interrupt44cdma_enintraroundin6_pcbnotifyncr5380_scsi_cmdtcx_show_screencrypto_threadst_check_eodgetdevvphme_cddefrouter_selectamap_unrefext2fs_statfsbstp_set_bridge_prioritycompat_43_sys_sigveccrdupemul_svr4amap_wiperangecuio_copybacktickdeltaisodirinocfrootschrtoblklease_checkscsiprintuserconf_pdevnamminphysacctchkfreqah_output_cbfdesc_unmountpmap_rmk4msw_3_leftovercgfour_ioctlcd9660_specop_opv_descrtalloc_nocloneether_addmultinfsrv_rmdirsunos_readdir_callbacksvr4_sys_memcntlvop_mknod_descfdcstartxyc_ticktimetochipip6qffs_vptofhvfs_isbusyifunitcd1400_read_regdvma_endbstp_hello_timer_expirybawritetputcharintstacksi_debugcompat_09_sys_setdomainnamewskbd_detachcsedeletecs4231_set_speedffs_fragacct_umulreplace_endsunos_sys_mknodumap_printsi_obio_intr_oncgthree_stdscreentreesanity_labelsys_fchowndb_breakpoint_cmdwzeronfs_strategyvwaitforiobootpathbe_ifmedia_updmii_phy_tickcs4231_writecd_read_subchannelextendfilelortrequesticmp6_inputprocfs_doctlxyc_ioctlcmdwsemul_vt100_outputuserconf_addnfs_openpftm_tcp_first_packetcreatedeumap_node_createfb_setsizesbreleasedb_history_sizepf_cksum_fixupmsdosfs_islockedpflogoutputmax_linkhdrwsdisplayioctlcryptof_statsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetspmap_is_referenced4_4czs_defspeeduserconf_hist_eocext2fs_getattripsec_adjust_mtusbdroprecorduvm_coredumpip6_sysctlmfs_mountrootsavacctpsusersvr4_sys_fstatsemtotvn_syncer_add_to_worklistvme_camemalliestartbstp_make_forwardingtk_ninsysfilt_opsclusterfreenull_inactiverootdevaudio_fill_silencepf_print_stateufs_ihash_slockm_tag_firstpmap_count_ptesmixer_closecdmatchmustek_trigger_scannerffs_checkoverlappriv_regsdumpsysicmptstampreplif_detached_watchdogext2fs_fsyncnfs_tickskernfs_lookupdoforcesys_fsyncfree_allocdirectuserconf_add_readifconfunion_freevpamap_wipeoutuser_configcast_setkeydb_map_currenthme_mediastatustcp_outputtcp_rndiss_nextnsphyattachwsdisplay_emul_attachpfdatatopacketfdesc_readupdate_ledsext2fs_updatebpp_cascanjet_ctl_readuvm_swap_initcryptnfs_accesstcp_timer_2msltbr_setffs_reload_vnodemsdosfs_setattrVOP_RMDIRdb_delete_breakpointticket_rdrs_activepool_allocator_freefilt_proceopnotsuppfifo_lookupxdopenffs_reallocblksnfs_removeitrootvprandomcloseunion_vfsopsaltq_etherclassifytimerblurbbstp_record_config_informationuserconf_maxlocnamespool_reclaimxdc_cdvflushcddetacharptimernfsrv_dorecruaddm_copymallocdirect_poolam7990_initmouse_copy_extend_chardb_free_breakpointssa_hw_ifif_upwsfont_getflgchkdquotlesetauinfsnodehashtblcpumodcache_alias_bitsslopencgsix_ras_erasecolsVOP_BWRITErt_timer_queue_createmsdosfs_ioctltdb_soft_timeoutsys_openseginvalrasops_pmaskinet6domainfdesc_setattrpgdeletesvr4_sys_hrtsystregionpf_matchsunos_sys_openuvm_pageidlezeroemulinstrdb_symtabs_divreplace_endraw_attach_umuldb_boot_sync_cmdnfree_msgmapsether_ip6multicast_maxpipe_poolxyreadhme_mii_statchguao_initunion_closevop_abortop_descnull_bwritefpu_executeifa_ifwithroutepmap_changeprot4mpipeinitspec_kqfilterdvma_malloc_spacepmap_page_protect_pnfs_renametcp_notifycd9660_tstamp_conv7hme_carandomattachqec_translatesys_sstkdb_print_positionnfs_lookupdb_radixgetblkmouse_pastenfs_readsppp_flushdead_vnodeop_pmouse_copy_endmaxsmapaltq_inputmfs_vfsopssoconnectwskbd_repeatnfs_writeswap_encrypt_initializedcryptof_selectnobufferscompat_43_sys_sethostnameromhalt__lshrdi3rtrequest1db_find_watchpoint_umulreplacektremulpf_pool_limitsxdc_xdresetnfsd_waitingtcp_identtcp_rst_ppslimrtrequestcgtwo_alloc_screenifinitcompat_10_sys_msgsyscd_load_tocunpst_recvspaceshminfoquotaoff_vnoderpc_callzlib_versionlebufmatchfree_inodedepraw_inputcd9660_reclaimtcx_accessopsnfs_nhinitfilt_logrdetachpfattachnd6_ifattachunpdg_recvspacepipe_closelogselectaudio_draincd9660_inactivedesireddquotsoftdep_mountmsdosfs_rmdirmsdosfs_fsynccfdataportal_printffsbetickufs_checkpathesp_enablesppp_paramsspifppcintrpfxlist_onlink_checkdb_elf_lookupipsp_print_tdbzsstartinittodrm_tag_findxydkdriverblf_encadler32umap_reverse_findidvputtcbhashsizecd9660_setattrdk_establishcache_printufs_quota_initz_freekqread_filtopsvndlockaudio_closecryptowritebioopssltioctlstrcatpf_cache_treepf_dynaddr_copyoutipprintfsmsdosfs_statfslboltpipe_initsi_vme_dma_eoprasops24_eraserowsssclosesyncerprocufs_ihashinsin_setpeeraddrwindow_inflatedb_readlinewsdisplay_delscreenether_ifdetachumapfs_roottcx_promvop_fsync_vp_offsetsuserconf_histcurrndstatsxdgetdisklabelst_touch_tapenfs_bwritemsdosfs_inactivehmeioctlpanicstrwsdisplay_kbdinputaudioioctlext2fs_sync_vnodeprocfs_dofpregspppintrunpdg_sendspacesession0viscpyzskbd_get_ledssystrace_answermem_pagexyc_cdespstatsppp_ipcp_tlssw_1_leftoversys_msgsndsbus_translatecopyinpmap_kremove4_4ccgthree_scrlistsppp_up_eventcd9660_defattrrtalloc1rmc_dequeue_nextqestopuao_swhash_elt_poolufs_ihashgetdes_set_odd_parityencode_comp_tsigacts0ncr53c9x_dequeuefindblkmajorpager_mapgif_softcntohlwsemul_sun_controlbmsafemap_lookupsorflushvigra_burnerttioctlarpintrqnull_vnodeop_pttycharsslpquevprintfsi_vme_intr_offtdb_hashstatssyncdelaysparc_led_blinkffs_mountext2fs_specop_entriesicmp6errppslimobio_scanpool_inactive_timelinear8_to_linear16_beencattachconfig_process_deferred_childrenwsdisplaywritekvm_setcachepool_cache_reclaimin6_setmaxmtupf_state_tree_RB_REMOVEmsdosfs_rootesp_write_regunion_writeprocfs_ioctlm_tag_getnfsrv_commitsb_lockfdesc_mountnull_getattrcrypto_unregisterpf_state_tree_RB_INSERT_COLORsuid_clearvigra_alloc_screenacctresumettwritechange_sign16_lesvr4_sys_sigsuspendcompat_43_sys_recvfromswapdev_vpvlan_set_promiscrasops1_putchar8wsemul_sun_attachbootpath_storeah_initdead_readufs_pathconffile_pooldb_boot_reboot_cmdvop_symlink_vp_offsetsunputcendeeprom_matchwskbd_isset_displayVOP_CREATEprobe_switchxywritefbwscons_console_initpf_expire_toacctsuspendvop_readlink_descuvm_map_referencespec_ebadfsvr4_sys_lstatvigramatchnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closerasops15_makestampin_pcbhashlookuphypersparc_cache_enableipcomp4_inputbwtwo_ioctlnfsrv_initcd9660_vnodeop_opv_descVOP_ABORTOPbpp_cdsw_camfs_vnodeop_pchange_sign16_swap_bytes_leswap_encryptcgeight_ioctlwsemul_sun_resetopqeresetsys_acceptuvm_map_entry_kmem_poolccdclosenfsrv_setattrtcp_rst_ppslim_countmagma_softsys_futimesccdinitsdgetdisklabelunion_newsizeinternal_commandxyc_rqtopbcgtwo_scrlistin_losingfddumpsppp_ipcp_tluledma_resetVOP_SYMLINKcompat_43_sys_sigblockgeteblkmmu_pageinwsscreen_detachred_addqscsibusmatchcrypto_kregistervn_ioctlufsspec_readdb_show_calloutprocfs_readlinkpipespaceip6_sendredirectsvfs_getuserstrshmforkcgtwelve_promcgfourteen_free_screencast_decryptkernfs_vnodeop_opv_descddb_sysctlkernfs_badopitimerfixip_stripoptionsspifstcintr_rxexceptionsunos_sys_ustatnd6_timer_chp9100attachnfs_mountpvpooltcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1sppp_lcp_tlfbdevvpiewatchdogfreefrag_poolifa_ifwithdstaddrsvr4_sys_waitsysnullfs_vgetdb_watchpoint_allockernel_regtable_storein6_nigroupsuswintrrasops1_copycolsauth_hash_sha1uihashpf_frag_tree_RB_REMOVEtcp_keepintvlvop_reallocblks_descvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchhandle_workitem_freefraguvm_km_valloc_prefer_waitunion_removed_upperprocfs_pathconfkernfs_linkqeioctlffs_allocsegm_lrurompropdb_prevbe_mcresetsvr4_stream_ti_ioctlsi_obio_dma_eopipsec_exp_first_useplimit_poolip6_defhlimcd_scsibus_load_unloadgre_outputbstp_timer_stopunp_connect2systrace_findpf_testrn_walktreepool_prime_pagetcx_burnerstclosechcloseproc_waitingsys_chownuvm_pagewirevop_lease_vp_offsetsunion_printin6_joingroupsys_munlocksunos_sys_mctluvm_anfreedofilereadvipip_sysctlvn_statfilezskbd_resetip6_mrouter_settablefullbewatchdogtcp_maxidlepppallocmclpoolbsd_to_svr4_sigaltstackststrategycttyioctlmbpp_mstohzffs_vnodeop_pprocess_write_fpregssys_lstatfilt_rndwritenfs_clearcommitpppopeniso_uiodiripe4_inputimport_addresscttyopenamd7930_query_devinfocd_atapibus_opsspifattachinet6ctlerrmapsunos_sys_sysconfdisknamesdumploRMD160Updatemsdosfs_mountzstty_unitipsp_kernnullcnpollcexport_credentialsuvm_km_initxddumpffs_sbupdatencr5380_pio_outudp_sysctlsystracef_ioctlsadb_exts_required_outvmmapbsydb_aout_search_symbolxyc_startbufuserconf_histlendb_list_breakpointsnfs_getcacheblksppp_inputvop_mkdir_descledma_carpc_msgacceptedsunos_sys_mountcgfour_accessopsncr53c9x_resetcgsix_ras_copycolsvmspace0svr4_sigcodecgfourteen_screenliststmatchchmatchscsi_decode_sensettywaitscanjet_specialuvm_map_setupprocfs_validfpregsnfsspec_readnullfs_mountetextzsttyifa_ifwithnetmemchrqsphy_statusfdesc_printncr53c9x_scsi_resetfpu_shrvt100_selectattributeproc_pooludp6_inputttcompatsys_writeswap_key_deletemap_forwmergedb_get_valuebstp_received_config_bpdusb_maxemul_flags_translatepftm_other_multiplecnstopwsdisplay_maxscreenidxextent_print_allihashtblnfsrv_writegathersys_dup2nfs_asynciosppp_pickdb_inst_countdb_read_linewsdisplay_switch1pmap_kremove_psys_readlinkbstp_disable_port__ashrdi3scsibuszerorefunion_vn_createwsdisplay_burnip6_auto_flowlabelmfs_initpfkeyv2_expireeeprom_cdfdesc_badoplf_splitifafreeVOP_STRATEGYtzsunos_sys_statrip_sendspaceamap_addtcp_freeqcgsixmatchdvd_authsppp_pap_scrtdb_firstusetcxattachcdreadrasops15_initspec_inactivesvr4_sys_shmsysacc_add_filtersys_sendtospifstcintr_mxicmperrppslimgeneric_filtopsknote_dropin6_selectsrclebufprintiommu_enterzskbd_initshmget_existingin6_pcbsetportnfsrv_nullalldevssunos_sys_auditsysicmp_do_errorvmcmd_map_readvnmbpp_startamap_extendsigpropvmapbufvndencryptdehashtblsocketopsdeviombpp_sendtcx_intrX_db_sym_numargszs_maskintrnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readimport_authunp_markdes_key_schedicmp_mtudisc_timeoutzs_loadchannelregsskip_char_rightttyread_filtopsuvm_mapmodule_ms2drain_outputvop_lookup_descdb_map_addrfb_pfour_get_videogetinoquotafifo_ebadfscanjet_trigger_scannerscsi_do_ioctlwtab_alloccd_resettimedeltagreattachX_db_forallstty_cdsvr4_sys_sigpendingsystrace_detachudpstatpf_test_state_tcpsetrootzscninitcd_read_toccgtwelve_resetcdioctlsystrace_policyifmedia_addacctpskipjack_zerokeysvr4_sys_breakmttyclosesppp_pap_initsppp_chap_inputlogopensppp_phase_networkbreadnxboxattachtcbtable__xordi3cgtwo_show_screenfrag6_draindosdiremptyigmp_slowtimoifpromiscidleinitiate_write_inodeblocksys_getsocknamecd9660_lookupnfs_getauthvop_fsync_descvigra_screenlistmask_rnheadumap_renamenfsd_head_flagsi_headfdesc_writebridgeattachuvm_swpkeyscreatedufs_rootptyttylesetutptcp_sysctlVOP_SETATTRsigactsinitsunos_sys_creatvfs_findnameexec_elf32_fixuppf_dynaddr_setuprt_newaddrmsgvop_generic_lockuvmfault_anongethandle_allocdirect_partdoneconsttyuvm_pagealloc_stratpf_test_udppv_changepte4_4cfdcloseusermountext2fs_dirrewrite__ucmpdi2bridge_ioctlvn_closefilevfs_free_netcredpool_cache_do_invalidateip_mtudiscmld6_start_listeningcgsix_alloc_screenufs_whiteoutpidhashtblwsemul_sun_opstcp_drainsvr4_sys_putmsgsi_dma_pollm_pullupsvr4_sys_preadbpendtsleepenterpgrppagedep_in_progresscrypto_freesessionMPFailisp_resetcnbellpause_timerm_copydataintrhandzskbd_txsoftprocfs_vnodeop_opv_descwsscreen_attach_syncpmap_zero_page_pxdc_rqinituvm_cnt_headcpu_cafilt_signalsigactsfreettymallocsd_scsibus_get_optparmswsdisplaykqfiltermmioctldb_nextsendsigcgtwelve_darkcmapbpf_ifnameeintstackcs4231_halt_inputvfs_busylkm_listmouse_copy_extend_afterfilt_ufsdetachvlan_ether_delmultilf_getlockieresetsolistenwskbd_compose_valueip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputsvr4_to_bsd_sigaltstackffs_vtblsystrace_findpidipmobile_sysctluserconf_morekqueue_ioctlportal_reclaimsys_wait4rip6_recvspaceamap_share_protectfs_sysctlfilt_sordetachpsignalwsdisplay_console_confnfs_getattrsi_dma_freeamap_pp_establiship_mobile_allowpf_compare_binatscgsixattachzscnprobeuvm_anon_initffs_reclaimfdesc_initdqfreelisthmeresetzs_set_speedsysctl_sysvipcqzeropmap_virtual_spacesvr4_sys_fchroottcp_quenchnumemptybufsbwtwo_cdupdatepriptcwakeupkernfs_vfsopsulinear8_to_linear16_be_mtswskbd_cnbellnfs_printruntimettcompatgetflagsvt100_decmodeqe_eintuvm_doswapencryptumapfs_quotactlfilt_soreadzeropagenfsrvw_coalesceipsec_def_encpool_logsizeip4_input6pdevinit__iordi3dmamatchpftm_intervalinetctlerrmapffs_specop_opv_descresetpriorityau_set_portenoioctlwsemul_sun_output_lowcharscgthree_accessopssigacts_poolexecsigsmachclk_freqzs_modempfkeyv2_getconfig_initgif_outputencstarticmp6_redirect_inputkrpc_portmappmap_enu4_4cst_interpret_sensesppp_down_eventmixer_ioctlscsistrategynd6_ra_inputin6addr_loopbackttypendvprintin6addr_linklocal_allroutersuvm_swap_freepagesreserve_spisvr4_sys_accessqsphymatchin_revarpinputstrlcpycompat_43_sys_sigsetmaskX_db_symbol_valuesphys_availmustek_set_paramsext2fs_advlockknote_fdclosevop_lease_descsppp_keepalivepipe_rfiltopsin6_cksumsunos_sys_execvstrncmppf_state_plvfs_opv_numopsdes1_decryptvfs_shutdowngetsockfuwordsvr4_sys_timemouse_hidein_interfacesnull_strategyxdmatchllinfo_nd6uvm_iopreemptzstty_stsoftmfs_printunixdomaindb_next_free_breakpointeeprom_uioprocfs_docpuinfouvm_tree_RB_REMOVEscsibusattachetheripstatsystrace_replaceaudiowritecs4231_getdevulminmsginitdb_last_symtabproc0paddrrn_addmaskrombootbstp_set_port_prioritysunos_sys_wait4bpf_bufsizeselscannfsrv_noop_randseedsig_filtopspmap_kenter_pa4mwskbdopenttclospmap_protect4mcs4231_matchpfkeyv2_acquireipsec_soft_allocationssparc_led_tobridge_addrulesppp_lcp_opt_namest_mount_tapenet_sysctlvop_getextattr_vp_offsetssystracef_writewskbd_do_ioctldead_ioctlpppasyncrelinqfill_eprocsysctl_iflistrasops_alloc_mattrvwakeupsystracef_kqfilterssattachsunos_sys_sigvecsl_compress_tcpunion_strategyvgonetcp6_ctlinputdb_stack_trace_cmdcypress_get_asyncfltsbus_cacgthree_setcolorufsspec_closetcxmatchnd6_prefix_offlinkuvm_anon_dropswapigmp_inputvop_ioctl_vp_offsetskmemusagenfsm_mbuftouioswcr_sesnumlf_getblockxddkdriverwsemul_sun_console_emuldatatcp_rttdfltcleanerprocbwtwo_scrlistcs4231_round_buffersizegetcacheinfo_obpsbappendstreamm_tag_copy_chainpmap_copy_page_punion_check_pfdformatsppp_ipcp_RCRsowrite_filtopsstrncpycseadddb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leupdatefatsvfs_getvfsffs_sync_vnodencr53c9x_sensepv_link4_4cproc_stopprocfs_closedb_history_lastsysctl_locksi_obio_dma_stopnpmemarraudioread_filtopshtonluvm_km_kmemallocsvr4_sys_pgrpsysin6_mask2lenvndioctlrmc_initsvr4_sys_mknodmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactionzscnputcdeupdatpow_w__negdi2in6_purgeaddrtunioctlcpu_modelsystraceclosepftm_tcp_closedsvr4_sys_getmsgtbreaduvm_tree_RB_FINDkernfs_unmountcttyreadcd9660_unlocksppp_to_eventuserconf_cmdswsdisplaycloserpc_replylkmclosedb_aout_forallmbppwritengreumapfs_fhtovpschedclockbpfioctlconfig_attachstty_paramipsp_addressmbpp_rwtdb_timeoutsysctl_filesys_semopdisk_unbusysvr4_sys_xstatsoisconnectedsystrace_msg_resultamap_clean_worksin_gif_inputcs4231_deviceetherip_sysctlVOP_PATHCONFumap_inactivedk_mountrootdb_run_modepf_nat_plstatfs_to_ostatfswsscreen_detach_syncauth_hash_key_md5_remreplace_endmfs_strategyppp_restartvattr_nullsys_getsockopthme_tcvr_bb_readbmustek_specialrasops24_putchar16frag6_nfragpacketstdb_initvlan_unconfigkernfs_xwritedb_linewildcardlehwresetin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlpmap_statshypersparc_cache_flush_allcpu_matchVOP_READLINKpftm_timeoutsfoundfpufdesc_vnodeop_opv_descdb_ed_stylesvr4_sys_utimesufs_seekshm_find_segment_by_shmidmii_submatchktrpsiguvmexp_printwsdisplay_unset_cons_kbdmsdosfs_pathconfxdc_errortimeout_wheelbpf_m_xhalffdioctlaverunnablecd9660_getattrttyfreettysleepunp_disposechquirksscsi_inquireufs_getattrBlowfish_encipherVOP_GETEXTATTRvfs_exportlebuffer_cdsvr4_sock_ioctlfsrtonameuvm_km_pgremovesoftdep_disk_io_initiationex_region_plfscalenewallocindirbridge_hashwsemul_sun_translatezsenqueue_txip_optcopymclpool_allocvfs_registerpmap_rmu4_4csys_dupmcllowatmii_printunion_symlinkbpfilterattachpmap_cache_enablesd_atapibus_opsenc_xform_skipjacktimeout_todoswcr_initdb_lccd1400_write_regrasops8_putchar8cpumatch_mswsemul_vt100_scrollupsppp_cisco_inputpmap_clear_reference4mprocfs_doregspanicsppp_ipcp_tldmsdosfs_lockseltruewsdisplay_console_devicebstp_topology_change_acknowledgedbpf_m_xwordautoconf_nzssoftdep_initializeipsp_skipcrypto_markbridgectlunp_shutdownstackgap_alloccpu_confext2fs_sysctlmark_ecngif_startcluster_callbackkthread_run_deferred_queueintr_fasttrapvop_lock_vp_offsetslastdaycheck_execdb_max_linetcp_initdeferred_config_queueipport_lastautonbridgesvr4_setcontextwsmux_detach_scmtty_attachnum_on_worklistcd9660_fifoop_entriespppgetmdb_last_commandfuswintrsunos_exec_aout_makecmdswinSlotCntvn_kqfiltersunos_sys_vhangupext2fs_syncproc_waiting_timeoutcryptoreadwcopycrypto_registercache_purgevfsmsqid_n2opostsigsys_pathconfrasops24_putcharin_addmultisppp_lcp_RCN_nakmaxrasops_reconfigbridge_ifdetachmmu_3lsppp_outputipsp_acquire_sascsi_probedevpmap_page_protect4_4cesp_devtcp_templatenfs_commitnbpfiltermsdosfs_readdb_object_print_cmdam7990_zerobuf_contigtctrl_cdbstp_transmit_configzstty_softintesp6_inputbcopyprocfs_validregsticket_binats_activencr5380_wait_nrq_timoaltq_lookupkqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerfb_burnerSHA1Update_intcuio_applydefrouter_addreqin6_clearscopesppp_nullfifo_vnodeop_entriespmap_pa_existsespdma_resetaudio_free_ringffs_setblockipsec_expire_acquirewsscreen_switchwaitspec_selectinflateResetmemcmpwskbd_init_keymap_uremmsdosfs_createcd9660_startdb_output_linekernfs_rootauxreg_cdpool_allocator_kmemdb_examinecfroots_sizedb_end_linetickadjvop_rmdir_vp_offsetspf_rule_plsbreservevrecyclembpp_timeouthandle_workitem_freefilein_pcbnotifymissextent_printaudio_careserve_dumppagesblf_ecb_decryptcrcopydb_symformatsys_revokeip6_setpktoptionsstat_direct_blk_ptrssysctl_stringsys_rebootcompat_43_sys_lseeksvr4_sys_killunion_unmountbufpoolswitchexitsunos_sys_otimesfdopenMCFailcpu_forkcompat_43_sys_getpagesizeaudioopendb_print_ifattylistflush_inodedep_depsuvm_vslockcast5_setkeyxformswNXFORMSWdeflateReset__bin2bcdttyoutputmodule_vikingpftm_udp_multiplepmap_kremove4mcd9660_tstamp_conv17wskbd_casemundo_clearcryptodev_cbmbpp_hztomsfdcmatchclockintrrn_mkfreelistsvr4_sys_open64vop_bwrite_descvndreadVOP_READpfclosein6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimenfs_sndunlocksys_setuidtimeroksi_obio_dma_setupcgtwo_free_screenscanjet_attachstart_updatecgfourteen_caufs_quota_free_blocks2senditbridge_spansppp_lcp_tldcluster_writecompat_43_sys_waitrnd_event_tailcgfour_stdscreenwsemul_sun_selectattributeuvm_setpagesizenfsrv_zapsockipsec_update_policyfpu_ftodtcp_xmit_timerst_rewindin6_recoverscopesunos_emul_pathsvr4_netopenmustek_attachmfs_badopnfs_nullskipjack_encrypttty_attachnsphy_serviceunion_advlockfirstchildcompat_43_sys_fstatpf_cache_plpmap_enter4mtimer_cdch_positionbridge_ifenqueueticknull_openmclpool_warnmsgdb_termpflog_packetmem_access_fault4mmmclosescsi_preventnumfreepagescd9660_accessmttyttybe_tcvr_read_bit1ffs_statfsxdr_inaddr_encodepmap_rmu4mzsnull_rxintrijndael_set_keyudp_recvspaceproc_root_targetsmttyopenuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputsppp_qflushbridge_rtfindufs_dirremovenumvndcinitif_attachsetuppipe_writevop_symlink_descstat_sync_limit_hitsbappendrmc_queue_packetsi_vme_dma_stopcgthree_screenlistm_copybackcgeight_alloc_screennextgennumberipcomp_enableuvm_swap_puticmpbmcastechogre_allowfifo_advlockesp_zeroizeevcnt_attachdb_continue_cmdnullfs_quotactlsoftdep_errorprocess_write_regsconfig_scantun_ioctlnuidhash_maxam7990_shutdownbpfselectsppp_cp_type_namefdfinishprom_inSrc_nameripsrcshminitiso_nchstatsnfsm_srvwccxyc_chainscsidebug_targetsnlineswkqueue_initializeddb_restart_at_pcdb_sstep_printpf_test_icmpether_ifattachfdcstatustunwriteinflateSyncsvr4_sys_sigactionxyioctlbridge_rtlookupsignal_initptyioctlxyc_cmdffs_updateumapfs_statfsdb_print_formatstatus_ifpnfs_checkexpmagma_cdzs_to_tiocmclear_inodedepsunix2dosfnspec_advlockfragtblraw_sendspacenulloppf_find_fragmentam7990_meminitsttyreadkernfs_inactiveintrcntip6_ecn_ingresssystrace_insert_processsackhl_poolencioctlsppp_dotted_quadextralocunsleepX_db_lookupkernel_segmap_storeget_buffer_statusblf_encrypttdb_allocipintrsppp_ipcp_closedes3_encryptmaxdmappfkeyv2_flush_walkerext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolbridge_blocknonipau_check_portsq_to_bpfkeyv2_initsoftdep_process_worklistmountrootwsemul_sun_output_normalnfsrv_setcreddb_inputchardb_boot_cmdsip_initreaddeprocess_read_fpregscd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpf_cent_pllodirtypagesfindwin95sys_nanosleepVOP_WRITEtcp_update_sack_listunion_setattrcompat_43_sys_getkerninfoip6_flow_seqputtdbuvm_loansppp_ipcp_upfdesc_ioctlifa_ifwithaddrpf_match_uidstty_startxbox_fix_rangesvr4_sys_getdentsp9100_free_screenstat_indir_blk_ptrsdb_write_cmdcgthree_alloc_screenwsmoused_releasehme_readsys_getfsstatbpfopencdstrategyrasops32_putcharbstp_set_path_costnfsrvhashtblvlan_configkmemstatsnd6_slowtimo_chuvm_km_valloc_alignipsp_reffreedb_max_widthnull_vnodeop_entriesmntvnode_slockfilt_audiordetachstreadnv2tov_typenfsd_headmouse_copy_selectionwsdisplay_noemul_attachipsec_policy_headsppp_pap_tluVOP_RENAMEoclk_set_dtcdclosecast5_zerokeysys_fchdircgtwelve_cafbwscons_initsunos_sys_exportfsbppopenalleventsrandompidportal_getattrfilt_ttyrdetachsys_ktracearp_inuseinet6swrouteswdosdirtemplateslattachmainbus_cdspec_nfsv2nodeop_entriesdb_uvmexp_print_cmdspifstcintr_txsys_mincoreipcomp4_input_cbunion_dircacherasops8_putcharlastsecondsaudioactivateffs_vnodeop_entrieswskbdselecttcp_maxpersistidlesvr4_readdir_callbackspec_ioctlnewblk_lookupufs_initsync_vnodeop_entriesproc_reparentbstp_designated_for_some_portuvm_exitcompat_43_sys_sendfc_bmapcallspr_rmpageffs_initbridge_filtersppp_chap_tludvmamap_extentnfssvc_sockhead_flagcluster_wbuildumapfs_vgetvigra_cauvm_initvigra_cdsys_ioctlnfs_renameitsys_xfspioctlsunkbd_keydesc_svif_free_sadlktrsyscalldb_dotquotaon_vnodefilt_bpfrdetachwsdisplay_emul_cast_loadquirksicmp6_initrasops15_putchar16filt_ttywriteaudioamd_cdin_setsockaddrptcclosepmap_is_modified4_4czs_write_csrunion_createkernfs_openrandom_stateeintrcntnfs_advlockbpf_moveinacct_procostypevndbuf_poollastpiduvm_page_physloadaudiogetinfodb_aout_sym_numargsptswriteipintrqprocfs_mountipcpermccd_softcsoftdep_workitem_pendingvlan_ioctlmaxproczskbd_cnpollcip_slowtimopmap_clear_modify4msi_obio_intr_offpagedep_hashtblnfs_setattrbstp_hold_timer_expiryip6_nexthdr__bss_startzskbd_bellstopqsync_vnodespifmatchbeattachpv_syncflags4mcgsix_screenlistauxio_regshm_nusedrpc_mismatchrijndael128_encryptVOP_KQFILTERpf_calc_skip_stepssys_msyncvop_rmdir_descallocdirect_mergedeflate_compresswskbdreadsbappendrecordsd_capf_change_apsoftdep_fsync_mountdevinitmsgbufconfig_activatememsetsema_initcuio_copydataptsstopufs_getlbnsnullfs_syncpmap_clear_modify_pprocfs_reclaimphysionfs_realign_testin6_selecthlimdb_symbol_is_ambiguousaudiocs_cdxyc_resetmii_phy_delete_medianfs_cltpsockcrypto_kdispatchicmp_mtudisc_clonesppp_print_byteskernfs_vnodeop_entriescgsix_caclass_cmpnullfs_rootsodisconnectsys_setgroupsmainpmap_rmk_pnfs_vfs_initprocess_sstepbppioctlisp_attachkill_user_windowspf_remove_fragmentrasops_init_devcmapfdesc_vnodeop_pipsec_acquire_headktrgeniosys_swaponip_flushrasops_mapcharnfsspec_closeuvm_unmap_removetickdelayzsreadfd_typesdb_hangmanicmp_erroruvm_swap_markbaddes_set_keykqueueopsaudio_pintpf_addrcpyoldmon_w_tracevholdqestartdb_help_cmdsbppmatchsystrace_wakeupm_adjloadfpstatemld6_stop_listeningppsratechecksys_ptracescsi_free_xskmemlimitcompat_43_sys_setrlimitncr5380_cmd_timeoutamap_copyunion_fsyncdvma_mapin_spacedevinsysctl_kmemlocksirsystrace_unlocklf_findoverlapcs4231_set_portovbcopysvr4_sys_statlf_wakelockdoclusterrazdb_sym_numargsvmel_cadumpconfskipjack_forwardspipe_selectsys_shmatpf_match_addrfilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badopoclockattachsparc_interrupt4mcalcrusys_unlinkblf_cbc_decryptdb_cmd_listrt_setgateipc_n2opf_dynaddr_updatesetpte4mdqrefsema_gettcp_ack_on_pushkernfs_reclaimzsaddrext2fs_rmdirsysctl_intkqueue_closeredioctlpf_sport_plwsdisplaystopstrlcatifnet_addrsunion_statfsau_set_gainifv_softcdisk_unlockpf_test_tcpufs_ihashremzskbd_enablecttywriteoclk_get_secssvr4_elf_probesdmatchpt_softcpagetables_endproc0ccdopenufs_renamesppp_lcp_initext2gennumbersvr4_sys_mmap64cryptoselectsoo_readhme_reset_rxtbattachbreadaufs_openwsmuxdoclosebstp_set_port_statem_catidle_uzsstoprtinitprocfs_freevpncr53c9x_variant_nameszskbd_stsoftcluster_collectbufscpcbuvm_swap_inittcp_nowdb_trace_until_matching_cmddes1_setkeyunp_gcsys_clock_gettimecsefreeip6_hdrnestlimitunion_unlockpool_catchup_uremreplaceswift_hotfixfrag6_initbuf_replacevnodemsdosfs_vnodeop_opv_desclba2msftimeout_set__subdi3tctrl_read_datawsdisplay_resetprocfs_docmdlinentohsgetptep4mcgfour_scrlistinet_ntoadb_boot_poweroff_cmdcgsix_ras_eraserowsext2fs_mkdirmii_pollstatext2fs_direnterpfkey_registerst_erasefdesc_lookupdupfdopenchange_sign16_benfsrvlruheadifmedia_list_addpidhashvfs_mountrootbe_cdsppp_lcp_TOuvm_totalencdebugsvr4_sys_fpathconfcs4231_halt_outputnullfs_statfsdb_unread_charcgtwelvematchtimestat_worklist_pushvme_cdstart_initelf32_olf_check_headerbe_tcvr_write_bitsvr4_sys_sigprocmaskkernfs_allocvppmap_copy_page4mtcp_mssdfltbt_putcmapuvm_swap_freetcp_rndiss_sboxsbus_establishcgsix_setcolorzs_iflushrnd_wseldb_look_charin_pcbdetachmsdosfs_vfsopsienab_bic_4mcd_sizettycheckoutqpmap_zero_page4_4cicmp6_mtudisc_callback_registerdb_set_variablernd_event_spacecn_tabin6_ifdetachdb_search_symbolvndstartip_forwardppp_compressorsextent_createxdstrategybstp_timer_startbpf_freeddisklistswap_bytes_change_sign16_beallocindir_poolsys_fstatfssvr4_trappmap_clear_reference4_4cidpromm_injectdb_aout_lookupbusprintnd6_setdefaultifaceffs_isfreeblockccdioctluvm_map_lookup_entryhztoBlowfish_expandstatevop_pathconf_descm_pullup2emul_sunoszscngetcdead_strategymtty_matchprocfs_domemktrcswspec_fsyncip6_optlenportal_unmountuvm_map_deallocateicmp_reflectpmap_dumpsizemii_phy_activateext2fs_reclaimsvr4_add_socketffs_ballocsys_getgroupssvr4_stream_getmakememarrpfkeyv2_createip6_raw_ctloutputsoftdep_setup_allocdirectkernel_textufs_startxyc_errorcs4231_set_paramsumap_getattrlkminitbwtwo_show_screenkernfs_get_rrootdevkinfo_vdebugnsphy_resetzstty_stintufs_bmaparrayfragtbl8nfsv2_typepfioctluvn_sync_locksysctl_initcgeightmatchxyc_piodriverufs_quota_alloc_blocks2fc_fileextendsexport_lifetimefilt_sigattachcgsix_free_screenVOP_FSYNCffs_sysctlipport_hilastautoarpinit_donespec_closecd9660_closectx_freezskbd_ioctlncr5380_pio_insys_shutdowncngetcam7990_resetesp_dma_stopprom_vstartgetcacheinfo_sun4crnd_statespf_binatsm_gethdrsunkbd5_keydesc_svvmeintszs_shutdownbridge_inputconfig_rootfoundzstty_diagzs_getcputcunion_linksysctl_rdstructtrapregion_lockedschedcpusemaredopentprintf_closesbappendcontrolwsdisplay_screenstatenfs_lookitupsi_cdesp_switchsoftdep_flushfilespf_frag_tree_RB_INSERT_COLORipv4_inputm_getclrpool_headcompat_43_sys_quotaptsopenncr53c9x_watchfpu_mulncr53c9x_msginvigra_intripforwardingif_indexdb_lexaudio_calc_blksizebufhashtblarc4random_statefpu_addprtactiveaudio_mmapksym_upcaseufs_makeinoderasops_copyrowsip6_process_hopoptsufsfifo_readunion_accesssystrace_lckwsdisplay_set_cons_kbdpfkeyv2_sendmessagefilt_ttyreadsys_getpgidfifo_writecache_lookupaudio_clearkfsheadred_allocin6_purgeifdb_aout_line_at_pcfree_msghdrsdb_boot_crash_cmdsystrace_forkle_cdnewdirremrijndael_encryptstackdumpbwtwo_burnerrasops_do_cursorfbnodepv_unlink4mwsemul_vt100_handle_dcsin6_ifawithifpncr53c9x_donesunos_sys_sigreturndumpsizewskbd_set_console_displaypppoutputccdstrategytunattachpppstartextent_freeuvm_aiodone_daemonaddupc_tasksched_syncsc_err1newblk_hashtdb_add_inpsetsigvecmountnfssys_sendmsgbridge_rtdaddrsppp_isemptyvn_marktextam7990_readpf_print_hoststrcmpwskbd_rem_muxsys_quotactlvop_close_vp_offsetsrndread_filtopsbstp_enable_change_detectionisp_asynctcp_mtudisc_increaseunion_vnodeop_entriesulmaxin6_pcbconnectdehashpmap_page_protect4mout_fdchook_disestablishbpf_catchpacketstrayintrffs_isblocksystr_proc_pldb_stack_trace_printcgfourattachcgthree_ioctluvm_swap_allocpagesuvm_aobj_poolmouse_copy_extenddb_examine_cmdicmp6_reflectsetrunqueueudv_attachsettimertable_initpppdumpbkernfs_initfdesc_allocvpvop_access_descqe_tintmii_phy_auto_timeoutnetisrdb_clear_breakpointsxdc_perrorcgeight_stdscreenttyrubrevarpwhoamivop_generic_islockedbufcachepercentwsscreen_attachmfs_ioctlm_pulldowncttyselectdayyrpmap_initufs_rmdircryptodevkey_cbminip6_initconfig_detach_children_timeout_lockrawcbtcpcb_poolz_errmsgsppp_chap_openBlowfish_stream2wordcgsix_scrlistswallow_zsintrsipip_allowsys_polluvm_map_clip_endufs_makedirentrymodule_sun4ckcur_mulreplacenfsrv_getcachekernfs_setattrhme_putvnode_hold_listpmap_enter4_4clastdosdatefdhashtbltadpole_powerdownssopenufs_linksys_mkfifodb_cmd_searchcgeight_screenlistifa_ifwithafhandle_written_mkdirzskbd_set_ledstimerreg_4min6_leavegroupsoo_selectiminsddumpsppp_cp_sendsys_chflagsbestopdelaysdstartpower_regch_get_paramsskipjack_decryptddb_regsbstp_received_tcn_bpduvt100_outputpf_fragqueuesoft01intrpmap_clear_reference_pext2fs_vnodeop_pzskbd_accessopsuvm_pageoutncr53c9x_timeoutpffindtypepdevnameszshwiflowinodedep_in_progressqsyncfifo_opencd9660_vptofhmii_phy_downuvmspace_forkraw_initsemundo_adjustknote_enqueueswap_bytesvigraattachmodule_turbosparcudpcksumtcp_sendspaceisp_startdb_maxoffmmuregionsffs_oldfscompatnfs_rmdirrijndael_decryptin6_matchlenstat_dir_entrysys_madvisetctrl_matchscsibusdetachxdr_string_encodedisk_attachwskbd_displayioctldb_cmd_loop_donexdattacharptfreevlan_ether_addmultisppp_pap_inputipq_lockeddb_show_arptabbstp_root_bridgefifo_vnodeop_pvop_write_descpftm_fragvop_read_vp_offsetsmfs_startdead_printmii_media_tablewscol_whiteswap_bytes_mtstcp_rndiss_encryptxycloseflush_pagedep_depsttyprintfccdinterleavesigcodeespdmaintrdb_elf_search_symbolipip_inputpfkeyv2_parsemessagedb_delete_watchpointbuf_undirtysysctl_tstringrmc_dropalldma_setupnfs_unmountnfsrttmsqidsdb_watchpoints_insertednfs_fsinfofilt_ttywdetachxdsizeuvm_tree_RB_INSERT_COLORvop_unlock_descpool_allocator_nointrsys_sysarchBlowfish_deciphermustek_readrrootdevigmp_initpmap_zero_page4mcgsix_ras_initmii_phy_add_mediaqec_fix_rangeputphysbufsprintfnfsv2_vnodeop_entriesvop_remove_vp_offsetsMD5Initqsclockregcryptodesc_poolbwtwo_mmapffs_vfsopssysctl_mallocfpu_ftoifrag6_slowtimocgtwo_putcmapwant_reschedppp_deflatemsdosfs_mkdirkthread_create_deferredrasops8_initnfs_xdrneg1xycmatchmbpp_recvexport_keymtty_modem_controlscsibusactivatezsparamnd6_timertcp_do_ecnportal_symlinkvop_open_descmsghdrssemexitqsphy_service__cmpdi2svr4_sys_ulimitcd_patternszstty_rbuf_hiwatraw_detachaudiodetachnfsrv3_accesscompat_43_sys_stataudio_writexdc_ioctlcmdlebufattachdomainnamelenpftm_other_first_packetcd1400_write_ccrnfs_sendip_rtaddrfiledesc_initcgtwelve_alloc_screennull_unlockvrelecallromprtrealloccheck_consolehme_mii_readamap_freebstp_ifupdstatusin6_domifattachwsdisplay_cnputcswreadcgfour_setcolornd6_prefix_lookupcddonesync_inactivespec_printlocleanpages.uremtimermatchext2fs_lookupmsdosfs_opendvma_cachealignext2fs_linkvop_generic_revokecpu_switchfifo_printfilt_sigdetachtcp_do_sackvigra_setcolorext2fs_renameesp6_input_cbipsec_def_authunion_renamemii_activatettywflushcd9660_rrip_offsetwskbd_default_keyrepeat_dataclosefvop_rename_descsoftdep_sync_metadatapmap_releasemii_ticknfs_mount_disklessngifip6_dad_countuvm_pager_dropclusternfs_fhtovpfilt_generic_detachprocfs_symlinkpool_print1exec_aout_prep_omagicsppp_auth_sendnfsrv_fhtovpdb_breakpoint_listunion_readdir.remksymsreadcd_get_parmspftm_tcp_fin_waitnd6_ifptomacsppp_chap_TOamap_unaddcd9660_printnull_islockedshmsegsnfilesindirdep_poolipcompstatcd9660_islocked__bcd2bincgtwoattachsvr4_sys_setrlimitin6if_do_dadrevarpwhoarewecryptodev_keypipe_kqfilterext2fs_openportal_vnodeop_opv_descacct_threadscanjet_readsoftdep_setup_directory_addmsdosfs_vnodeop_entriescgtwelve_accessopsst_mode_sensefreeblks_poolstopprofclockdb_hangstat_blk_limit_pushbstp_etheraddrnullioctlcryptof_closeipsp_ref_matchportal_linkisohashparsediskncr53c9x_schedbstp_timer_expiredntunbstp_transmit_tcnbreadamap_lookupnetaddr_matchnfsm_srvpostopattrrt_timer_remove_allwskbddevprintksymsclosesbpp_cdsoftdep_setup_allocindir_pagewsdisplay_closescreenexport_identitypf_compare_rdrssvr4_sys_creattctrl_catcp_usrreqdb_playscompat_10_sys_shmsysuvm_swap_needdecryptmfs_vnodeop_entriesnfs_getnickauthsd_interpret_senseudp_usrreqifmedia_initrmc_delay_actionext2fs_vfsopsext2fs_inactivedead_bmapdb_guessespf_send_icmpesp4_input_cbbpf_dtabsoo_kqfilterfpu_explodecpu_startupfifo_pathconfquotaonttcompatsetflagsamap_refcompat_43_sys_lstatam7990_putfilt_fifordetachdb_command_loopxbox_cafilt_fiforeadfdexpandtickssrandommsdosfs_closehme_eintncr5380_intrcbqclosepf_addr_plext2fs_setattrxdr_inaddr_decodesysctl_clockratevn_rdwrnd6_need_cacheip6intrsys_msgctlsync_crashsystrace_msg_askprocfs_badopsvr4_sys_sysarchpf_state_tree_RB_NEXTuvm_pagedeactivatevop_write_vp_offsetssunos_sys_quotactlufs_unlocksvr4_sendsigtcp_ctloutputmono_timeMD5Updateifmedia_setblktochrvop_create_descpf_purge_expired_statespmap_createuvm_map_extractnfs_readdirrpcnfs_msgnd6_prelist_addufs_removepftm_udp_singlecd9660_readlinkboottimeaudioamd_cacgthree_intrwsdisplay_set_console_kbdVOP_ADVLOCKdb_watchpoint_cmdqe_cdfrag6_inputsunos_sys_fchrootunpst_sendspacenfsrv_mknodptcreadrasops8_makestamptcp_rscalettwakeupuvmspace_freepmap_enk4_4cext2fs_inode_poolipsec_common_input_cbswbufffs_ino_poolvmes_camii_phy_statusmsgpfkey_initwsdisplay_internal_ioctlVOP_PRINTfdsharenfsrv_removebufinverse_regioncdstartsnapshotbstp_topology_change_timer_expiryclockfreqsppp_pap_tldfilt_generic_readwriteuserconf_disablevlan_ether_purgemultiunion_ioctlvrefspechash_slockiematchlewrcsripforward_rtbsd_to_svr4_speeddb_elf_forallvt100_ansimoderasops_lmaskfifo_nfsv2nodeop_opv_descdb_set_temp_breakpointsys_nosysallproccdevswzskbd_cngetcnfsm_uiotombuffb_pfour_set_videofree_diraddsys_mlockallvndsizegallant12x22pmap_rmk4_4cwskbdcloseuvm_sysctlwskernel_bgstatintrgetsnsrmmu_get_asyncfltsys_fchflagsdisksortrt_timer_countpowerhook_disestablish__builtin_saveregscryptodev_opfilt_audiowritefpu_stofhme_rintuvm_pager_putmfs_mountzs_cdmmumodhypersparc_get_syncfltip6_ecn_egressin6_gif_outputin_canforwardvlan_inputrasops_unpack_attrremove_selectionwsdisplay_shutdownhooksrmmu_cache_flush_allvop_select_vp_offsetsxycattachsrmmu_vcache_flush_segmentrasops_copycolspmap_destroynfsfifo_writehme_mediachangeetherbroadcastaddrpowerhook_listam7990_configprocfs_getcpuinfstrsunos_sys_unmountfdcpseudointrkernfs_freevpvfs_getnewfsidvndunlockudp6_ctlinputsemid_n2oitimerrounduk_cascsi_print_sensemmopenwskbd_update_layoutffs_inode_freepf_normalize_tcprtioctlipsec_acquire_pool_initializedwsdisplay_noemul_matchprofprocsip6_inputtbr_getpf_purge_timeoutpagemoveroute_srcspeedup_synceraudio_blk_msigmp_sendpktesp4_inputpfkey_sendupcgeight_cdsunos_sys_fcntlifmedia_baudrate_descriptionsv_putcsystrace_msg_childipcomp_attachm_getptrviking_cache_flushufsvnode_filtopsunion_newlowerccdmakedisklabelreadbuffersqecmatchuvm_fault_unwiresppp_cp_change_stateuserconf_common_attr_valext2fs_vnodeop_entriesipseczeroessys_getitimerhme_tcvr_bb_writebdonicefdesc_targetssubytemerge_inode_listsetherip_inputcpu_configureip6_freemoptionszscnpollcptcopenaudio_alloc_ringmodule_sun4wsdisplay_common_attachuvm_swpkeysdeletedzs_attachrn_refinesmfs_statfshmac_opad_buffersockargswsdisplay_getactivescreenvmes_scanvop_generic_abortopstattachchattachsetregshandle_written_filepagenfs_rcvunlocksobindvmcmd_map_zerodb_read_charzstty_matchnfs_asyncdaemonvfsinitarcbroadcastaddrcnclosetimer_canfsm_adjdb_tok_numberrasops24_initsddonereplacemultcp_do_rfc1323ip_fragsfilt_fifowdetachsvr4_sys_lxstatmii_phy_setmedialo0ifphostidpool_chkaudio_ioctluvm_pagermapoutcheckreplaywindow32ipqmaxlenktrsysretnam2blkext2fs_vptofhnfs_linktadpole_set_videounion_diruncacheip_maxqueuesysctl_ttyamd7930_halt_inputamd7930_set_paramsin_socktrimdeadproc_slocksys___semctlmmusegmentssys_mprotectrtallocsunkbd_keydesc_usnfsrv_updatecachemsdosfs_reallocblksvop_readlink_vp_offsetszs_def_cflagbridge_rtflushdequeue_randomnesssyncer_maxdelaypf_normalize_initwsdisplay_getscreencs4231_allocdeadprocstart_reaperfdesc_pathconfuvmspace_unsharesys_fcntlisp_prtukioctlunion_lockpf_change_areq_clear_removevfs_free_addrlistsys_setrlimitsys_sigpendingsvr4_termio_to_termiosuvm_map_cleanicmp_redirtimeoutccdiodonesppp_chap_scrttyclosepool_allocator_drainulinear8_to_linear16_ledisk_resetstatmfs_inactivemtty_paramcgtwo_stdscreenicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdip6_forwarddb_fncallme_freenumcachenfsrv_linklkm_nofuncintr_establishcpu_initclockswskbdioctlmii_downkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysbe_ifmedia_stssppp_close_eventaudiokqfilterwsdisplay_switch3sppp_dequeuettyoutipc_o2nDebuggerdevice_lookupinodedep_hashtblnfsrv_statfssystraceopencdminphysnumcleanpagesschedhzrip6_inputlkmdispatchfd_motor_offuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baselooutputwsemul_sun_outputrijndael128_zerokeysoisdisconnectedcpu_coredumpdvd_read_disckeyuvm_aio_aiodonecrp_req_queuesystrace_attachsvr4_sys_sysconfigss_set_windowcrypto_freereqclrbitsdb_boot_dump_cmdvndshutdownvop_select_descmii_phy_statusnfs_repheadzs_hwflagsfdwritele_cascsidebug_levelcrypto_newsessiondevcttykernfs_accessp9100_accessopsbwtwo_free_screengre_sysctlsoclosemfs_bmapnfsrv_pathconfwakeup_nsys_connectbuf_daemonsys_nfssvcvmeintr_establishskpcsvr4_sys_contextunion_vnodeop_opv_descdb_leroute6_inputcgfourteen_burnervlan_startcompat_43_sys_mmapvop_read_desccnreadzstty_rbuf_lowatcluster_newbufsys_socketpairbwtwo_cafdcretryudp6_sendspacedead_selectdounmountuvm_swap_allocwskbd_pickfreess_identify_scannerdb_elf_line_at_pchmeattachpool_cache_destroyprom_vendchkdqchgttspeedtabulinear8_to_linear16_le_mtsledma_cdkqueue_readcd_scsibus_setvolpool_page_alloc_nointrcgfourteen_cdpmap_copy_page4_4ccd9660_mountkernfs_epochst_mode_selectnfsrv_renameuserconf_maxdevpv_sizeah_zeroizewskbd_activatewsdisplay_cons_pollmodewsemul_sun_output_controlnd6_purgedb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdiszerodevcgtwo_cacgtwelve_initcmapcpu_spinupauth_hash_hmac_ripemd_160_96vop_advlock_vp_offsetsscanjet_set_paramssys_fhstatsparc_ist_unmountnullmodemmemreg_cdsunos_sys_ptraceif_attachdomain1raw_recvspaceccdunlockdiskerrptyattachcd_cdwsdisplay_screentype_pickcompat_09_sys_getdomainnamewsdisplay_addscreen_printdb_machine_commands_installsunos_sys_ioctlsun4_vcache_flush_regionsys_preaduk_switchkmem_mapcd9660_check_exportqsphyattachcpumatch_sun4soqinsquediskstatsauxregbiscdes_ecb_encryptswap_key_prepareudp_inputieattachvigra_loadcmap_immediateihashrn_search_mresettodrpmap_protect_pufs_readdirsys_flockarc4random_initializedspifsoftintrmrh_listuvm_unloanpagelkpvspec_badopcgtwelve_cdmbppclosemsdosfs_linknode_has_propertymustek_minphysigmpstatsppp_proto_namerwindow_savevn_initialize_syncerdufs_selectcd9660_quotactlpmap_dumpmmuicmp_sendwrite_user_windowsrasops1_erasecolshme_reset_txunion_allocvpvop_bwrite_vp_offsetsbsdi_stringsopenpromclosekrpc_callsowakeupinsidecgfourteen_resetsystrace_make_msgdb_putstringsvr4_fil_ioctltcp_clean_sackreportdb_strcpy_edatamttyreadmouse_copy_linesigactsunsharetimeout_hardclock_updatespppattachrijndael128_decryptttkqfilterwaittimem_tag_deletecd9660_ihashremip_fragmentsys_statfsSHA1Finalrawin6pcbtablescanjet_compute_sizespool_cache_invalidatep9100_burnerkprintfdevice_unrefcgfourteen_setcolorscsi_startvnode_poolin_cksumdeflateInit2vnode_free_listfdcioptcp_savetikernfs_readdiruvm_pagereallocncr53c9x_reselectbsd_to_svr4_termiosuvm_fault_unwire_lockedpmap_extract4mipsp_process_doneaudioprintpool_printit_endgetpropdes_check_keysogetoptsoftdep_freequeueuvm_unmaparc4maybeinitfdprintzs_write_datadb_deletewatch_cmdsoftdep_load_inodeblockwsemul_vt100_attacharp_intimerpollscandomaininitvflushbufip6_forward_rtslioctlsppp_lcp_openwskbd_get_mapentryinitiate_write_filepagevndclosenfsrv_slpderefsbcreatecontrolsys_mlockpf_cachequeueinitfpstatefpu_xtofdvd_read_structzs_get_chan_addrpowerdownif_mark_unignoreportal_vfsopscompat_43_sys_getpeernamencr5380_abortvdevgonehtonswrite_all_windowsdb_show_callout_bucketpf_get_natbucketkqueue_writesys_syncnfs_readdirplusrpcaudio_selwakeupfddkdriveripsp_process_packetsunos_sys_rebootie_mapnfs_pathconfmb_mappgt_allocatorfpu_newnannfsstatsenodevffs_mountfsin_delayed_cksumsrmmu_pcache_flush_linein6_is_addr_deprecatednfs_rcvlockwsemul_vt100_edzsioctlpf_ip2keyicmperrppslim_lastttvtimeoutrtstatncr53c9x_intrbdwritespeclisthncr5380_reset_scsibusvndattachsppp_open_eventVOP_INACTIVEswap_decryptnullfs_unmountwsemul_vt100_translatesoftdep_deallocate_dependenciessunkbd_keydesctabfd_do_ejectprocfs_lookupsys_getsiddb_trace_until_call_cmdRMD160Initss_gen_quirkscompat_43_sys_sigstackrasops15_putchar8umap_vnodeop_entriesfileheadvndsetcrednextvnodeidsys_swapctlrasops1_do_cursorbd_reqsvr4_sys_pwritest_patternsch_patternsspifstcintrin_selectsrcmsgscpu_exitwskbd_muxopsfdgetdisklabelhmestartunp_attachch_moveimport_credentialssys_renamernd_rselcgfour_show_screenpnozz_cafrag6_nfragsip6_log_timepf_flush_fragmentsxdcattachcd1400_enable_transmitterufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnms1_cache_flushsys_shmgetlebuffer_casbflushipsec_require_pfsswapdevwsdisplayttyrominterpretvn_readah_massage_headerspfs_vlockbwriteleavepgrpqsphy_cdcd_scsibus_set_pa_immeduvmpageropsuvm_page_initstatminaudioselectcast5_decryptsi_vme_intr_onwsfont_locktcp_timer_funcsipqent_poolif_attachdomainswap_keyicmp_ratelimitdb_aout_symbol_valuesinvalhashsegm_lockedieintripe4_attachtdb_soft_firstusepf_rules_inactivesosenddosetrlimittree_ext_gwyrn_initxycintrloopattachukcloselkmexistsnfs_hashlockzs_matchled_scRMD160Finaldb_listwatch_cmdnfsm_reqhsl_softcchainlengthprocess_read_regsau_get_gainesp_dma_gopagedep_poolrn_lookupuvm_map_reserveallocate_copybuffernum_dirremvlan_input_taguserconf_show_attrsys_execvetcx_stdscreenencoutputfdallocwsdisplayreadmmu_reservemon4_4cscsi_done_remqueespmatchnfsspec_writechkvnlockhw_sysctldb_siftingdb_look_tokenconsintrnumvnodescryptof_ioctluvm_pagefreecompat_43_sys_acceptpf_frag_tree_RB_INSERTie_cdcd_scsibus_opsportal_startcgsix_burnerext2fs_inode_allocswcr_encdecpmemarrwsdisplay_switch2zskbd_belldb_examine_formatin6_ifindex2scopeidin6_pcbbindcluster_rbuildreaperpf_nats_inactivecompat_09_sys_unamecoredumpfilt_kqueuemalloc_roundupnfsrv_readled_capipe_readaudiostartpifioctlsys_utimesdb_symformatssun4_vcache_flush_contextlkmenodevpmap_is_referenced4mwscol_blacknd6_storelladdrsunkbd_keydesc_sv_nodeadrip_initsocreatesystracef_statcgeightattachureadcbppwriteufs_setattrrijndael128_setkeylogpridoclusterreadregion_freelisthandle_workitem_removecast5_encryptsys_exitsystracef_close_uremreplace_endnfs_decode_argsgrepmap_kenter_pa_pm_applymodule_unknownswcr_processcryptof_writepppasyncstartamd7930_trapsadb_exts_required_indb_watchpoint_listeeprom_givealtq_disablecd_playsys_clock_getrespmap_is_modified_pbridge_rtupdatespec_bmapmustek_rewind_scannerpool_cache_destruct_object_remreplacesvr4_sys_utimefd_motor_onbstp_acknowledge_topology_changend6_umaxtriesfindzsienab_bicnd6_debugfpu_itofstdumpzskbd_rbuf_size_divwindow_deflatedb_delete_temp_breakpointsunkbd5_keydesctabunion_bmapget_random_bytesmagma_attachSHA1Transformesymcrypto_invokeosreleasevndiodoneVOP_RECLAIMturbosparc_hotfixticket_binats_inactivetctrl_setup_bitportipcomp6_inputgre_inputpflogioctlspec_nfsv2nodeop_pnull_reclaimhmematchpgrp0pf_state_tree_RB_FINDuserconf_changecd_scsibus_getvolgetpropstringmakefstypedb_paniccddkdriveruvm_anon_addsys_omsyncvigra_free_screenwsemul_sun_resetuserconf_helpufs_advlockicmp_initmouse_movereluvm_growcsecreatevfinddevam7990_tintfd_cdsavefpstatenfs_falsepf_rdr_plcgthree_free_screendopowerhooksah6_inputumapfs_syncpf_test_state_icmpether_delmultivfs_op_initdb_history_currpppinputpf_match_gidrpc_auth_kerbexec_sigcode_mapsys_gettimeofdaynbootpathipsec_soft_timeoutipsec_policy_pool_initializedviking_pcache_flush_linevcleansystracewritecgtwo_mmaprasops8_putchar16splassert_ctlpf_free_fragmentcgthree_cdsys_fhopendos2unixfnscsibussubmatchumap_strategycgtwelve_show_screencdzerorefuvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsystrace_getcwdsys_fchmodvop_strategy_descmtty_startpmap_clear_modify4_4cuvm_unmap_detachvop_islocked_descamd7930_get_portuserconf_common_devsema_releasestartipe4_zeroizemclpool_releaseskip_spc_leftst_identify_drivevn_isdisksys_selectnaltqswsvr4_sys_llseekcryptoattachvnode_free_list_slockxdreadmsdosfs_selectzombproclogreaddead_locktcp_issfc_largedistancezstty_rbuf_sizesrmmu_vcache_flush_pageclock_caregssys_setitimerisofntransnd_prefixclear_removewsemul_vt100_resetext2fs_specop_pvfs_unregisterseminitvndstrategyvt100_setnrcswap_key_createsppp_ipcp_RCN_nakselwakeupzstty_rxintffs_reloaddb_set_watchpointscnwritecompat_43_sys_killpguipc_usrreqzstty_txsoftnd6_na_inputdb_next_free_watchpointvflush_vnodefilt_rndrdetachscsi_scsi_cmdin_gif_outputah4_ctlinputrip6_usrreqin6mask96sloutputcoldah_outputdb_clear_watchpointsbutton_eventunp_scanexec_aout_prep_nmagicunion_mkdirsbappendaddresp4_ctlinputwsemul_sun_initufs_islockedcypress_get_syncfltffs_unmountfifo_inactivesvr4_sys_fstat64sys_pwriteisohashtblppp_timeoutsppp_ipcp_RCN_rejmmu_install_tablesuvmspace_allocrevarpinputcd_pausesoftdep_setup_directory_changehashinitttstarttunctloldpvecnfs_removerpcipsec_keep_invalidsystrace_debuguao_detach_lockedmagma_matchsystrace_prepreplprocfs_printqec_cdsvr4_sys_execvsdopentcp_tracemii_phy_resetip_getmoptionsin6mask32__moddi3disk_countnfsrvw_procrastinatedead_openmsgpooldb_list_watchpointsuserconf_attricmp6_redirect_outputvop_revoke_vp_offsetsva_nullroute_cbreadeppf_print_flagstcp_slowtimoqematchcd_play_msfdqreletcp_newtcpcbcgsix_intrsys_fhstatfszssoftprocfs_vfsopself32_load_fileamd7930_commit_settingsbstp_ioctlsys_getpeernamepfkeyv2_sendccdintrfdc_debugchange_sign16_be_mtsportal_pathconfdb_eqnamefdc_cascsi_strvisbpfwritedoingcachesys_getrusagerasops_initipcomp_output_cbcryptoioctllevelhardss_quirk_patternsnd6_prunesl_uncompress_tcp_corem_getbsd_to_svr4_sigffs_truncatemii_attachnfs_replyttylclosemd_diskconfxdc_resetpool_allocator_alloctcx_ioctlchar_typeeeprom_vancr53c9x_debugpagedep_hashvn_closeamd7930_closeexport_addressin6_createmkludgediradd_inode_writtendoclusterwritesvr4_sys_rdebugwsdisplay_cfg_ioctlcachestatsffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreemachclk_per_ticksvr4_sys_alarmcompat_25_sys_getfsstatsoftdep_setup_freeblockspflogrtrequestdb_show_regsetherip_outputportal_lookupuvm_km_free_wakeuprootvnodeifmedia_ioctlzs_read_csricmperrpps_countuserconf_modify__one_cmpldi2atapi_mode_selectnewblk_poolcd9660_ihashgetnfsrv_writemii_phy_detachbstp_root_selectionwskbd_add_muxunion_readprocfs_statfsmbtypes__muldi3cgsix_cddb_qualify_ambiguous_namesip_mtudisc_timeoutprocfs_rootvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesbufinitsvr4_getcontextskip_char_leftcpu_exec_aout_makecmdsscsi_quirk_patternsuserconf_linessunos_sys_sigpendingnfs_truedeflateInitlimit0tcp_sack_outputuniqdosnamedb_recoverpmap_writetextext2fs_mknodvttoif_tabdb_delete_cmdfifo_nfsv2nodeop_entriesbgetvppgrp_pooltcx_resettbconfucred_poolvmel_scanswift_get_syncfltnfs_startdes3_setkeyarp_maxtriesnslcd9660_bmapbstp_record_config_timeout_valuesacct_processportal_openufs_dirbadentrycgfourteen_show_screenrasops24_putchar8logioctlstrlendb_machine_initrasops15_putcharcs4231_query_encodingvop_abortop_vp_offsetsnfsv2_vnodeop_pfifo_kqfilterwsfont_initwsdisplayparampool_page_freeespattachah4_inputcopystrbridge_broadcastfpu_ftossys_pipesunos_sys_setpgrparp_rtrequestext2fs_reload_vnodesppp_lcp_RCRelf32_check_brandnfs_getset_niothreadsudp_initbstp_configuration_updatevmes_cdbt_getcmapproc_trampolinesys_rmdircompat_43_sys_gethostnamecd9660_vfsopsinflateInitallocbufsocantsendmoreproc_zapvop_revoke_descmainbus_modelcdactivateether_inputuvm_vsunlockzsnull_txintlockstatusquotaoffarpioctlffs_fifoop_pkernel_pagtable_storepf_ncachekernfs_readfs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimodb_load_countudbtableumap_mapidschange_sign16_le_mtsufs_printfb_unblankfatentryzskbd_cdzskbd_cavn_selecttctrl_attachfdctimeoutncr53c9x_abort.umulmf6ctabledrop_earlysys_statdqgetpftm_icmp_error_replyin_baddynamiclineswmsdosfs_symlinksys_symlinkicmp6_sysctlsvr4_sys_vhangupcgfourteenattachclfreeconfig_found_smnfsrv_readdirplusrpc_autherrfdreleasedb_line_at_pcuvm_swapout_threadsknote_attachmax_keylensppp_lcp_tlstbinputgre_wccpspec_nfsv2nodeop_opv_desc__assertdb_put_valuewsdisplay_emul_matchin6_prefixlen2maskesp_input_cbcompat_43_sys_recvmsgLfsbailcgtwelve_scrlistcn_devvpudp6_outputxbox_cdmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsetsffs_mountroottprintfuvm_map_pageable_allesp_initdofilewriteipqfdesc_symlinkmfs_doiomsdosfs_strategyumap_vnodeop_ptimeout_deldma_resetwsemul_vt100_elspec_strategyxdc_startuvm_pglistfreenfs_attrtimeonfs_bufqpv_changepte4mnextsiblingext2fs_readbstp_supersedes_port_infosl_compress_setupsoo_statwskbd_cnpollcpppreadrusage_pooldisk_detachsw_0_leftoverkvm_iocachepftm_icmp_first_packetnull_bypasssi_obio_dma_startscsi_sizedb_deleteisp_initbeioctlcrypto_driverscompat_43_sys_ftruncateiftovt_tabtcp_backoffbold8x16sppp_pap_my_TOsys_chrootprocfs_bmapexport_sazssoftpendingicmp6_redirtimeoutbridge_initenc_xform_dessoisconnectingpf_test_state_otherwsdisplay_pollcvop_link_desc_divreplaceaobj_pagerstopenchopenuvm_tree_RB_REMOVE_COLORpromcninitmld6_inputacct_startsvr4_sys_xmknodmbppselectcs4231_commit_settingsvop_link_vp_offsetsbwtwo_alloc_screendt_to_gmtsoftdep_worklist_busyip_pcboptsfc_purgevop_getextattr_descfb_pfour_idifmedia_delete_instancebe_readsoftdep_update_inodeblocksys_acctss_cazs_write_regccddumpicmp6statdb_single_stepqcopywsdisplaydevprintinflateEndccdwritewsevent_pollmap_backmergesys_profilvmcmd_map_pagedvnnfsm_disctin6_pcbhashlookupsystrace_exitwsdisplay_cdsvr4_sys_fcntlbpf_detachdVOP_UNLOCK_uvm_tree_sanityvop_readdir_vp_offsetsip_ecn_egressbridge_send_icmp_errether_ipmulticast_maxticket_rules_activemouse_copy_extend_worduvm_init_limitsin_pcbconnectdevoutVOP_IOCTLwant_aststatvarsafeprinumccdaudio_init_playcgeight_mmapsys_rforklenocarrierdma_isintrp9100_stdscreenswift_cache_enableprocfs_linkunion_pathconfuao_swap_offmachineVOP_CLOSEuvm_anallocin_pcbdisconnectiommu_cacgeight_burneruvm_vnp_terminatepool_cache_putbridge_fragmentxdc_cmdz_allocwtab_destroysys_getpidnd6_defifindexunp_dropptscloseuvm_map_advicetcp_mtudiscsvr4_sys_opentimeout_startuppppattachsi_carn_addroutesdactivatenfsrv_errmapread_dsfielddb_print_sadb_elf_sym_numargswsscrollbackchkiqchgbstp_message_age_timer_expirypf_compare_natsshmsegdvd_read_manufactconfig_activate_childrenzsnull_softintkrp_req_queuenullfs_startremrunqueuexyc_xyresetsoo_closesystrace_redirecttcp_recvspaceah_sysctluvm_metersubnetsarelocalportal_readdirnfs_requestlinear8_to_linear16_le_mtsoldmon_w_cmdnd6_lookupviking_hotfixpager_map_wantedbridge_bifconfsys_getppidspif_cdmii_anarnullfs_initVOP_READDIRdomainsspif_caireplacesys___sysctlaudio_calcwaterledmatcheeprom_attachin4_cksumextent_alloc_subregiondb_putcharisp_intrneedbufferwsemul_pickin6_ifattachsoftdep_worklist_reqppppktinqewatchdogtcp_rst_ppslim_lastwsdisplaystartsi_vme_dma_setupahstattickfixfdesc_syncsvr4_sys_utssyscd9660_initccdstartipsec_soft_bytesnselcollemul_elf32numdirtypagesm_tag_unlinkmountroot_hook_establishbufhashmsdosfs_lookupspec_pathconfxdc_startbufhook_establishqe_ifmedia_updzstty_txinttcptv_keep_initaddrmasksys_chdirsvr4_sys_fstatvfs64ktrsetchildrendb_unread_tokenext2fs_diremptymotion_eventssstartsppp_chap_tlduserconf_cntpflogifmouse_zaxisumapfs_unmountsppp_lcp_closeext2fs_inode_freedb_find_variableip6_rr_prunebematchsbcompressclk_wenabledirrem_poolmsf2lband6_outputlogsoftcsys_adjtimewrite_dsfieldssminphysvop_kqfilter_vp_offsetspf_rulesnative_to_svr4_errnoamap_splitrefktropscryptof_kqfilternclruheadvndwriterasops_alloc_cattruvm_aio_biodonern_initheadumap_vnodeop_opv_descvop_generic_unlockesp_glueuvmspace_sharert_timer_addroute_usrreqdeextendnull_locku0sbus_matchrasops_erasecolsnfs_readlinktcp_dropicmpstatsppp_detachnv3tov_typeumap_node_hashfdreadm_prependvop_advlock_descnfsrv_readlinkcompat_25_sys_statfscd9660_pathconfin_pcbrehashin_arpinputxdc_cascanjet_set_windowsbppcloseufs_accessin6_embedscopeif_alloc_sadlgetcacheinfo_sun4unix2winfnncr53c9x_get_ecbtcx_free_screengifattachfpu_divwsfont_unlockoclockmatchreassignbufcd9660_selectip_freemoptionsnetconms1_get_syncfltcgfourteen_accessopssohasoutofbandvop_ioctl_descddb_initswift_mmu_enablend6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_descmsdosfs_fhtovpnfs_inactivepim6_inputipsp_spd_lookupether_crc32_behandle_written_inodeblockpgfinddvma_freevop_lock_descbeinitrqinitsvr4_ustatrasops_cmapswcr_compdeccd9660_ihash_slockpf_test_fragmentrasops1_putcharip4_inputtcp_inputsysctl_dumpentrydkcksumpmap_mapwsdisplay_cnattachumap_reclaimpfkeyv2_policynd6_gctimerncr53c9x_initcd_switchiptimerip_inputaudiowrite_filtops_mulreplace_endnd6_setmtunfsrv_cleancachedb_last_non_spacemii_detachudp_ctlinputpool_sethardlimitn6expireip_freefvnd_softckernel_regmap_storezsharddb_show_cmdsudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnd6_ns_inputdeflateEndprocfs_dostatusdevice_refffs_syncuvm_map_submapcnioctlnfsm_srvfattrvndopenufs_vinitpf_send_resetvmel_cdeintrnamespool_primepgrphashtblsystraceattachsddkdriverktrwritesys_getpeereidinodedep_lookupifmedia_matchstatclockgetnewbufdvd_read_physicaluvm_mlk_hintsppp_lcp_scruserconf_argbufsunos_sys_unamess_patternsMD5Update_intm_tag_copyqe_mcresetst_readsbus_cda2intdb_value_of_nameprobegetmsdosfs_getattrprocfs_setattrdb_find_breakpointcounterreg_4mm_devgetwritedisklabelgettdbbysrcmsdosfs_printkernel_pmap_storesttyattachwsemul_vt100_opsxyc_submit_iorqstartprofclockcs4231_freeleattachnsphymatchprocinitrmc_update_class_utilmsdosfs_readdirdead_ebadfsun4_vcache_flush_segmentobio_cambpp_matchnfs_symlinkpf_frag_plopenpromioctlsoo_ioctlred_getqsvr4_sysentamd7930swintrnumdquotforkstatin6mask64db_lbuf_startqec_getsoftclockaudio_initbufsvigra_accessopsmfs_openportal_badopreaddir_with_callbackupdate_modifierdb_breakpoints_insertedswdevtblf_decryptdisk_lockah_attachieioctlsppp_chap_closesbwaitufs_reclaimnswitchdiffsdwriteauxio_regvalprocfs_donoteshm_deallocate_segmentmemnamefpu_ftoxfilt_logreadsysctl_rdquaduvm_vnp_setsizevmcmdset_extendsys_lkmnosysip6_use_deprecatedimport_keynfs_setattrrpcuserconf_hist_intextent_alloc_regionsys_mknodaltqopenraiseext2fs_mountfskill_vmcmdssvr4_ttold_ioctlesp_dma_isactiveufs_mknodsbinsertoobknotelf_advlockfreeah_enabletcpdropoldhalfopencgfourteen_alloc_screennfsrv_rcvfdesc_linkprotection_codessunos_sys_ostimeswstrategyuserconf_pnumget_sa_requirekernfs_symlinkscsibusprintbstp_make_blockingsys_getpgrpccddevsdqhashtblaudio_defaultvigra_scrlistwsemul_vt100_console_emuldatasonewconnufs_direnternfs_reqqpffindprotozsops_kbdcluster_readuvm_swap_initcrypt_alltcp_saveti6wsemul_vt100_initnchrdevsppp_phase_namenfsrv_lookupshm_find_segment_by_keyqsphy_cashmmaxpgs