,``@00ھ04 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx $$$$$$$h44,44444444   444p4p44444p4,4 D74@4K4Y4 Hd4q4\4`44`4l44444 4 l 4 444 ?g   @@?gmRb!v@``w/mnt^`dd@@<@`bT ?gm   @@?gmRb!v@``@@<@`bT U?gwH0($\RU6A ?gn?g05?g05gIA?gn ?gq:i?gq:iJ&AT?g ?gׄ?gׄP`*:V(A?gn ?g$[܀?g$[܀XA?gn ?gn ?gn A?gn ?gn ?gn #RA?gn ?gn ?gn jKA?gn ?gĴ?gĴyC?gnI?gnI?gnI!? 2A?gnI?gnI?gnI oA?gnI?gt8ـ?gt8ـ;3A?g?g?gHDzA?gnI?gu?guA?gnI?gnI ?gnI 3TA?gnI?g'V?g'V}YA?gn߀?gn߀?gnI rA?gnI ?gn?gn$C?gn?gu,?gu,p|A?gn?gn?gny=jA?gn?gn?gne9,?goÀ?gp*T?g05 (0hpxX pW[??gsN?gsI?gsIF?gs?gsW?gsWX`hpxP)?gs?gs?gsbv?gs?gs?gsh#=?gs$s?gs+?gs+8;6?gs0G?gs5?gt(9ee-H?gs:i?gtw?gt(@ -o?gt ?gt ?gt ;8>?gu,?gu,?gu,/tmpyJ&?gv?guI ?guI HB Am?g2?gI ?gN?a?gN?gN?gI#!?gI?gI?gIa?gI ?gI ?gIMS!?g?g?gIH]a?gC?gC?gI'!?g ?g ?gI\a?gׄ?gׄ?gI'!?gG?gG?gIy>7a?gt?gt?gIE!?g8?g8?gI=a?ge?ge?gI|2!?g /?g /?gIK&a?g!`?g!`?gI`!?g#*?g#*?gIOEa?g$s?g$s?gIS^!?g&6?g&6?gI0"a?g'c?g'c?gIW!?g)'?g)'?gI8Ka?g+?g+?gI !?g,?g,?gI >za?g.}?g.}?gI >!?g0G?g0G?gI `a?g2b?g2b?gI In!?g3B?g3B?gI č a?g5 R?g5 R?gI e!?g6?g6?gI BWa?g8ـ?g8ـ?gI ~!!?g9?g9?gI $la?g?g?gI zh!?gÀ?gÀ?gIFa?g,?g,?gIR!?g?g?gI(Ha?g?g?gz9 /0!?g h?g h?gz9a?g S+?g S+?gz9 8!?g X?g X?gz9LJa?gN?gN?gz9 'Dp!?g߀?g߀?gz9") a?g?g?gz9 l={!?gf?gf?gz9@-ra?gܓ?gܓ?gz9 (E!?gW?gW?gz9uH/a?gp?gp?gz9 3!?g9?g9?gz9a?g?g?gz9 >@!?g4΀?g4΀?gz9 a?g?g?gz9 ,a?g!?g!?gp &_!?g#F?g#F?gp&\KAa?g&%?g&%?gp '@!?g'c?g'c?gp'Oa?g)'?g)'?gp (<$!?g,?g,?gp(3Wa?g-D?g-D?gp )!?g/?g/?gp)'a?g2?g2?gp *^;!?g3%?g3%?gp*?Aa?g5?g5?gp ++i !?g7n?g7n?gp+.a?g98p?g98p?gp ,O;!?g:i?g:i?gp,Z=a?g?g?gp -9$!?gbZ?gbZ?gp- a?g,?g,?gp .۴!?g?g?gp. a?g'?g'?gp /J!?gр?gр?gp/a?g ?g ?gk 0ƣ!?g X?g X?gk 0a?g ?g ?gk 1 8!?gI?gI?gk 1 5a?gI ?gI ?gk 25!?gz9?gz9?gk 2-a?gC?gC?gk 3!?g ?g ?gk 3BsGa?gׄ?gׄ?gk 4!?g?g?gk 4x?a?gt?gt?gk 5~p!?g8?g8?gk 5YCa?ge?ge?gk 6.R$!?g(?g(?gk 6a?g!`?g!`?gk 7"P!?g#*?g#*?gk 7F ga?g$s?g$s?gk 8!?g&%?g&%?gk 8Wa?g'c?g'c?gk 9l!?g)'?g)'?gk 9{ ~a?g+?g+?gk : &!?g-L?g-L?gk :*a?g/q?g/q?gk ;!q!?g0G?g0G?gk ;0G4a?g2b?g2b?gk <'A6!?g3%?g3%?gk <$a?g5?g5?gk =L> !?g6?g6?gk =Ia?g8ـ?g8ـ?gk >#!?g:i?g:i?gk >@&a?g?g?gk ?IF!?gbZ?gbZ?gk ?v a?g?g?ge:a!?g]J?g]J?gend9a?g'?g'?gehß!?gр?gр?gen#8a?g ?g ?geY4*!?g X?g X?genea?gN?gN?ge3v|!?gI?gI?genulm a?gI ?gI ?ge!?g?g?gen͞a?gܓ?gܓ?geю!?gW?gW?gen 5>a?gp?gp?ge.–!?gG?gG?genNKɖa?gk ?gk ?ge6a¡!?g4΀?g4΀?gena?g?g?ge S!?g U?g U?gen4va?g"?g"?ge e!?g#F?g#F?gen Da?g% ?g% ?ge *!?g'V?g'V?gen a?g) ?g) ?ge !?g*T?g*T?gen ԁAFa?g,?g,?ge hFK!?g.}?g.}?gen R֮a?g/?g/?ge %y!?g1xˀ?g1xˀ?gn ||a?g3B?g3B?ge,!?g5 R?g5 R?gn C9a?g6?g6?ge !?g8ـ?g8ـ?gnq(a?g9?g9?g!`R2?!?g?g?g!n< a?gÀ?gÀ?g!` $RL!?g?g?g!na?g]J?g]J?g!`<^ !?g'?g'?g!na?gX;?gX;?g!`U1!?g !?g !?g!nia?g ?g ?g!`gQ]!?g ?g ?g!n`&a?gI?gI?g!`mރ!?gI ?gI ?g!n$O~a?g?g?g!`l/!?gC?gC?g!nda?g ?g ?g!`X!?gׄ?gׄ?g!n;]a?gG?gG?g!`1g!?gk ?gk ?g!n/(sa?g4΀?g4΀?g!`!?ge?ge?g!nSa?g /?g /?g!`N!?g!?g!?g!n D a?g#F?g#F?g!`8-e!?g% ?g% ?g!n_"a?g'V?g'V?g!`!?g) ?g) ?g!naa?g*T?g*T?g!N!?g,?g,?g!n Ja?g-D?g-D?g! !?g/?g/?g!n&\}a?g1xˀ?g1xˀ?g!fB.!?g3B?g3B?g!n( a?g4s?g4s?g$[܀$P>!?g6=?g6=?g$sna?g8C?g8C?g$[܀[!?g9?g9?g$sn,a?g;3?g;3?g$[܀(!?g1-?g1-?g$sn~qa?g?g?g$s G*!?g]J?g]J?g$sn@Ua?g'?g'?g$sGO2!?gX;?gX;?g$snǡa?g !?g !?g$sg{!?g ?g ?g$sna?g ?g ?g$s،!?g沀?g沀?g$sngTa?gv?gv?g$sl!?gz9?gz9?g$snrpIa?gC?gC?g$s!?gu*?gu*?g$snjza?g>?g>?g$s9!?g?g?g$snŐ2 a?gt?gt?g$s!?g8?g8?g$sn,g;ga?ge?ge?g$s\!?g(?g(?g$snXj)ha?g!`?g!`?g$s *!?g#*?g#*?g$snၝa?g$s?g$s?g$snH!?g&%?g&%?g$sn~=a?g'c?g'c?g$sθ:!?g)'?g)'?g$snnBa?g+?g+?g$s֐!?g-L?g-L?g$sn23ha?g.}?g.}?g'c!?g0G?g0G?g'cnOa?g2b?g2b?g'cd!?g3%?g3%?g'cnfUsa?g5 R?g5 R?g'cnK!?g6?g6?g'cn.a?g8ـ?g8ـ?g'c6@!?g:i?g:i?g'cnǕa?g?g?g'cvV!?gÀ?gÀ?g'cnx@[a?g?g?g'cA!?g]J?g]J?g'cn"x a?g'?g'?g'cEn!?gX;?gX;?g'cn4]a?g !?g !?g'c͌^!?g ?g ?g'cn<a?g ?g ?g'c9!?g沀?g沀?g'cnao7a?gv?gv?g'cMB!!?gz9?gz9?g'cnUa?gC?gC?g'c !?g ?g ?g'cna?g>?g>?g'c3V!?g?g?g'cnUG0a?gt?gt?g'c{!?g8?g8?g'cnK#a?ge?ge?g'c;%{!?g(?g(?g'cnya?g!`?g!`?g'c!?g#*?g#*?g'cnRca?g$s?g$s?g'cb\k!?g&6?g&6?g'cn9-0a?g(?g(?g*T ,+!?g*Q?g*Q?g*Tn B<a?g+?g+?g*T!~-!?g-L?g-L?g*Tn!Վ a?g/q?g/q?g*T"]Z!?g05?g05?g*Tn"h֦a?g2?g2?g*T#v4!?g4s?g4s?g*Tn#~ya?g5?g5?g*T$K-!?g7n?g7n?g*Tn$Nvya?g98p?g98p?g*T%ˆ!?g;3?g;3?g*Tn%5{a?g1-?g1-?g*T&j !?g?g?g*Tn&ӌуa?gĴ?gĴ?g*T'.!?g?g?g*Tn'aa?g?g?g*T(0EȆ!?g h?g h?g*Tn(g(a?g S+?g S+?g*T)ȻRd!?g ?g ?g*Tn)_a?g沀?g沀?g*T*NdN!?gv?gv?g*Tn*\a?g?g?g*T+^9d!?gf?gf?g*Tn+a?gu*?gu*?g*T,i!?g>?g>?g*Tn,a?g?g?g*T-F!?gt?gt?g*Tn-1a?g8?g8?g*T. !?ge?ge?g*Tn.bEoa?g(?g(?g*T/q\!?g!`?g!`?g*Tn/XQa?g#*?g#*?g-D"!?g$s?g$s?g-Dn2ǣa?g&6?g&6?g-DR!?g(?g(?g-DnVQa?g)'?g)'?g-D{!?g+?g+?g-Dna?g-L?g-L?g-DN!?g/q?g/q?g-DnnCa?g05?g05?g-DT!?g2?g2?g-Dn&,a?g4s?g4s?g-DS!?g6=?g6=?g-Dnfa?g7n?g7n?g-D)j !?g98p?g98p?g-Dnfa?g;3?g;3?g-DSF!?g1-?g1-?g-Dn;$a?g?g?g-Dv!?gĴ?gĴ?g-Dn31ya?gw?gw?g-D!?gX;?gX;?g-Dnȑa?g !?g !?g-D@!?g ?g ?g-Dn3 a?g ?g ?g-DG'%!?gI?gI?g-Dnl!a?gI ?gI ?g-DRF!?gz9?gz9?g-Dnǡ!a?gC?gC?g-Dhg!?g ?g ?g-Dnנa?gׄ?gׄ?g-D4!?gG?gG?g-Dna?gk ?gk ?g-D!?g4΀?g4΀?g-Dn|a?ge?ge?g050!?g /?g /?g05n0}a?g!?g!?g0512FZ!?g#F?g#F?g05n1Na?g% ?g% ?g052Z}6!?g&6?g&6?g05n2y<a?g(?g(?g053:ud!?g*Q?g*Q?g05n3Ka?g,?g,?g054UM8!?g-L?g-L?g05n46퐅a?g/q?g/q?g055@!?g05?g05?g05n5VKa?g2?g2?g056+!?g4s?g4s?g05n6װQa?g5?g5?g057S!?g7n?g7n?g05n7!sda?g98p?g98p?g058y!?g;3?g;3?g05n8LHa?g?g?g0599!?gbZ?gbZ?g05n9a?g,?g,?g05:/!?g?g?g05n:0d;a?g?g?g05;[ S!?g h?g h?g05n; }a?g ?g ?g05<!?g X?g X?g05n<*Ha?gN?gN?g05=ܧO!?g߀?g߀?g05n=ta?gI ?gI ?g05>|ً!?g?g?g05n>ΐ}a?gܓ?gܓ?g05?oó!?gW?gW?g05n?wa?gp?gp?g3%7U;!?gG?gG?g3%n;pa?gk ?gk ?g3%I=!?g4΀?g4΀?g3%n7a?g?g?g3%J!?g U?g U?g3%n 8=a?g!?g!?g3%M!?g#F?g#F?g3%nOna?g% ?g% ?g3%])j!?g'V?g'V?g3%nEsa?g) ?g) ?g3%}!?g*Q?g*Q?g3%n``a?g,?g,?g3%!?g-D?g-D?g3%n^w a?g/?g/?g3%_e!?g1xˀ?g1xˀ?g3%n!e6a?g2?g2?g3%Ol!?g4s?g4s?g3%n%6a?g6=?g6=?g3%!?g8C?g8C?g3%nјta?g9?g9?g3%yJ!?g?g?g3%nzea?g1-?g1-?g3%B!?g?g?g3%nxBa?gĴ?gĴ?g3%NA!?gw?gw?g3%nqa?g?g?g3%HL!?g h?g h?g3%n2a?g S+?g S+?g3%Y!?g ?g ?g3%na?g沀?g沀?g3%!?gv?gv?g3%nda?g?g?g6B!?gf?gf?g6-a?gu*?gu*?g6X(Ϣ!?g>?g>?g6Ֆ9a?g?g?g63!?gt?gt?g6Nca?g8?g8?g6n"!?ge?ge?g6M[0a?g(?g(?g6t!?g!`?g!`?g6:> a?g#*?g#*?g6>%!?g$s?g$s?g6a?g&6?g&6?g6c^!?g(?g(?g6 a?g)'?g)'?g6ʏ!?g+?g+?g63a?g-L?g-L?g6A*!?g/q?g/q?g6fa?g05?g05?g6 !?g2?g2?g6 a?g4s?g4s?g6 i 6!?g6=?g6=?g6 [3sa?g8C?g8C?g6 3Vi!?g9?g9?g6 Qa?g?g?g6 d!?gbZ?gbZ?g7n a?g,?g,?g6 x=!?gw?gw?g7n ?~a?gX;?gX;?g6!?g !?g !?g7n``ma?g X?g X?g6&F!?gN?gN?g7nw8_a?g߀?g߀?g9g!?gz9?gz9?g9a?gC?gC?g9gF!?g ?g ?g9?a?gp?gp?g9E!?g9?g9?g9Ta?g?g?g9SB!?ge?ge?g9>a?g /?g /?g9!?g!?g!?g9Oa?g#F?g#F?g9{!?g&%?g&%?g:iȸ a?g'c?g'c?g9NR\!?g)'?g)'?g:i=a?g,?g,?g9m],!?g-D?g-D?g:iYa?g/?g/?g9!?g2b?g2b?g:ia?g3%?g3%?g9RG!?g5?g5?g:i,a?g8C?g8C?g9b&!?g9?g9?g:iA a?g?g?g9G!?gbZ?gbZ?g:i' a?g,?g,?g9N!?g?g?g:iDa?gX;?gX;?g9.4p!?g !?g !?g:iN`\a?g ?g ?g9!?gN?gN?g:iΔa?g߀?g߀?g9)!?g?g?g:i a?gf?gf?g1- % H!?g ?g ?gÀ ݴa?gׄ?gׄ?g1-!}fE!?gG?gG?gÀ!COha?g?g?g1-"N6>!?ge?ge?gÀ"xia?g(?g(?g1-#Zg!?g!?g!?gÀ#a?g#F?g#F?g1-$f!?g% ?g% ?gÀ$e(a?g'c?g'c?g1-%H!?g)'?g)'?gÀ%Pa?g+?g+?g1-&FF!?g-D?g-D?gÀ& a?g/?g/?g1-'5l!?g1xˀ?g1xˀ?gÀ'yvQa?g3%?g3%?g1-(TT!?g5?g5?gÀ(oiEa?g7n?g7n?g1-)3xC!?g9?g9?gÀ)%a?g;3?g;3?g1-*"!?g1-?g1-?gÀ*a?g?g?g1-+h^!?gĴ?gĴ?gÀ+a?gw?gw?g1-,qx/!?gX;?gX;?gÀ,$\da?g h?g h?gÀ-*!?g S+?g S+?gÀ-ug]a?g ?g ?gÀ.V<ϣ!?g沀?g沀?gÀ.z&a?gv?gv?gÀ/] !?g?g?gÀ/"qNa?gf?gf?gĴ0%"!?gu*?gu*?gĴ0a?g>?g>?gĴ1&"!?gp?gp?gĴ1Ia?g9?g9?gĴ2%!?g?g?gĴ2EUa?ge?ge?gĴ31!?g(?g(?gĴ3l| a?g U?g U?gĴ4o !?g"?g"?gĴ47a?g$[܀?g$[܀?gĴ5h!?g&%?g&%?gĴ5w:=a?g'c?g'c?gĴ6v?x!?g) ?g) ?gĴ6Ra?g*T?g*T?gĴ7!?g,?g,?gĴ7J0a?g.}?g.}?gĴ8{y!?g/?g/?gĴ8?a?g1xˀ?g1xˀ?gĴ9%F!?g3B?g3B?gĴ9@a?g5 R?g5 R?gĴ:9Y!?g6?g6?gĴ:+.a?g8ـ?g8ـ?gĴ;[!?g9?g9?gĴ;a?g?g?gĴ<!?gÀ?gÀ?gĴ<י a?g?g?gĴ= |!?g?g?gĴ=,a?g?g?gĴ>f0!?g h?g h?gĴ>Xa?g S+?g S+?gĴ?&h!?g ?g ?gĴ?oa?g沀?g沀?g@3S!?g߀?g߀?g@#oa?g?g?gA?g>?g,:Xa?g?g?g,I!?gt?gt?g,:Ta?g4΀?g4΀?g,bz!?g?g?gĴj20a?g U?g U?gĴ9H!?g#*?g#*?gĴj{ca?g$s?g$s?g "R!?g&6?g&6?g ya?g) ?g) ?g Ȍ!?g*T?g*T?g 0a?g,?g,?g @J~!?g/q?g/q?g ױpa?g05?g05?g @?!?g2?g2?g )a?g5 R?g5 R?g Kf!?g6=?g6=?g Ña?g8ـ?g8ـ?g k$q!?g:i?g:i?g = a?g1-?g1-?g q-E!?g?g?g 8Ta?g]J?g]J?g {_!?gX;?gX;?g ӛa?g ?g ?g }8!?g X?g X?g @a?g沀?g沀?g  9B!?gv?gv?g oa?g?g?g  :!?gܓ?gܓ?g 6a?gW?gW?g  %!?g?g?g ća?gt?gt?g  !?g8?g8?g ra?g?g?g  A!?g U?g U?g ;WDa?g"?g"?g 7!?g$s?g$s?g :a?g&6?g&6?g 6a!?g(?g(?g mYa?g*T?g*T?g $!?g,?g,?g Z=a?g.}?g.}?g 8$!?g0G?g0G?g $UKa?g2?g2?g !?g4s?g4s?g  a?g6=?g6=?g 04!?g8ـ?g8ـ?g +sa?g;3?g;3?g !?g1-?g1-?g ;a?g?g?g q幣!?gĴ?gĴ?g ؊>a?gw?gw?g S?F\!?gX;?gX;?g oIa?g !?g !?g 0t7!?g ?g ?g 5a?g ?g ?g OQ!?gI?gI?g j 'a?gv?gv?g QO!?gz9?gz9?g a?gC?gC?g T)!?g ?g ?g VNa?gׄ?gׄ?g 2 ou!?gG?gG?g ka?gk ?gk ?g 6!?g4΀?g4΀?g i0a?g?g?g !?g U?g U?g ~P a?g"?g"?g c!?g#F?g#F?g ̓a?g% ?g% ?g M!?g'V?g'V?g U3Ga?g) ?g) ?gv O!?g*T?g*T?gv rma?g,?g,?gv!%!?g.}?g.}?gv !-Na?g0G?g0G?gv"u!:Q!?g2b?g2b?gv "9ܿa?g3%?g3%?gv#T!?g5?g5?gv #Mӻa?g6?g6?gv$N[!?g8ـ?g8ـ?gv $Y\J|a?g:i?g:i?gv%5kE!?g?g?gv %0qa?gbZ?gbZ?gv&P-!?g,?g,?gv &a?g?g?gv'ap!?g?g?gv '= a?g h?g h?gv(ލ F!?g S+?g S+?gv (ߒKa?g ?g ?gv)!?gN?gN?gv )gHa?g߀?g߀?gv*!!?g?g?gv *՞ua?gf?gf?gv+0mI{!?gu*?gu*?gv + Na?g>?g>?gv,!?g?g?gv ,O1a?g9?g9?gv-xTu!?g?g?gv -F,a?ge?ge?gv.iP!?g(?g(?gv .,a?g!`?g!`?gv/7_!?g#*?g#*?gv /6Xa?g$[܀?g$[܀?gf0W}~e!?g&%?g&%?gf 0} a?g'c?g'c?gf1+lI!?g)'?g)'?gf 1a?g+?g+?gf2 :!?g-L?g-L?gf 2L<`a?g.}?g.}?gf3!?g0G?g0G?gf 3>a?g2b?g2b?gf43 Px!?g3%?g3%?gf 4Eٻ"a?g5?g5?gf5;eX{!?g7n?g7n?gf 5kGa?g98p?g98p?gf6IJ!?g:i?g:i?gf 6tz3!a?g?g?gf7 D!?gbZ?gbZ?gf 7Iaa?g,?g,?gf8!?g?g?gf 8na?g?g?gf9 !?g h?g h?gf 9A6za?g S+?g S+?gf:*!?g ?g ?gC :a?gN?gN?gf;!?g߀?g߀?gC ;a?g?g?gf<S!?gf?gf?gC <NXa?gu*?gu*?gf=?!?g>?g>?gC =d a?g?g?gf>?5!?g9?g9?gC >?a?g?g?gf?Jsg!?ge?ge?gC ?zva?g(?g(?gĴ.a?g!`?g!`?gĴ]za?g#*?g#*?gĴHt!?g$s?g$s?gĴ6(b!?g&6?g&6?gĴ6mG!?g'c?g'c?gĴ63Aba?g)'?g)'?gĴa?g+?g+?gĴQka?g-L?g-L?gĴ[!!?g/q?g/q?gĴ6 Ա!?g05?g05?gĴ6'!?g2?g2?gĴ6NSa?g4s?g4s?gĴxa?g6=?g6=?gĴ޾=a?g7n?g7n?gĴ:sE.!?g98p?g98p?gĴ6!?g;3?g;3?gĴ6!?g1-?g1-?gĴ6F!y>a?g?g?gĴ+a&9a?gĴ?gĴ?gĴxa?gw?gw?gĴ@a!?gX;?gX;?gĴ6g !?g h?g h?gĴ6G0!?g S+?g S+?gĴ6+EFa?g ?g ?gĴz_"a?g沀?g沀?gĴף&a?gv?gv?gĴSn!?gz9?gz9?gĴ67q!?gC?gC?gĴ6!?g ?g ?gĴ6oa?g>?g>?gĴva?g?g?gĴC$ua?gt?gt?gĴ, 6!?g8?g8?gĴ6' !?ge?ge?gĴ6t4<!?g /?g /?gĴ6Yuca?g!?g!?gĴ B4a?g#*?g#*?gĴja?g$s?g$s?gĴ+NE!?g&6?g&6?gĴ6=x!?g(?g(?gĴ6݉!?g*Q?g*Q?gĴ6ߏa?g,?g,?gĴra?g-D?g-D?gĴn&a?g/?g/?gĴZ!?g1xˀ?g1xˀ?gĴ6?!?g2?g2?gĴ6uw!?g4s?g4s?gĴ6Ia?g6=?g6=?gĴW Na?g8C?g8C?gĴa?g9?g9?gĴ"!?g?g?gĴ6!?gÀ?gÀ?gĴ6ё,!?g?g?gĴ6Ёa?gĴ?gĴ?gĴGXda?gw?gw?gĴC0a?gX;?gX;?gĴ6!?g !?g !?gĴ6M!?g ?g ?gĴ695!?g ?g ?gĴ6a?gI?gI?gĴ /oa?gv?gv?gĴ!a?gz9?gz9?gĴ"@!?gC?gC?gĴ6 y|!?g ?g ?gĴ6!N!?gׄ?gׄ?g]J6"IFa?gG?gG?g]J0ja?gk ?gk ?g]J1jQa?g4΀?g4΀?g]J2PdC!?g?g?g]J60K!?g /?g /?g]J61SI!?g!?g!?g]J62rKa?g#F?g#F?g]J@la?g% ?g% ?g]JA@a?g'V?g'V?g]JB. !?g) ?g) ?g]J6@32r!?g*T?g*T?g]J6A$B !?g,?g,?g]J6Bia?g.}?g.}?g]JP!8)a?g/?g/?g]JQ[a?g1xˀ?g1xˀ?g]JRب:!?g3B?g3B?g]J6P!?g5 R?g5 R?g]J6Q\!?g6?g6?g]J6Ra?g8ـ?g8ـ?g]J`.qa?g:i?g:i?g]Jaea?g?g?g]Jb!?gbZ?gbZ?g]J6`;T@!?g,?g,?g]J6ax!?g]J?g]J?g]J6ba?g'?g'?g]Jp`JYa?gр?gр?g]Jq!{a?g ?g ?g]Jr5Z!?g X?g X?g]J6p!?gN?gN?g]J6q]D!?g߀?g߀?g]J6rF*F!?g?g?g]Jy˰<!?gf?gf?g]Jyu2\!?gu*?gu*?g]Jy!V!?gW?gW?g]Jy!!?gp?gp?g]Jyt!?g9?g9?g]JyҨ!?g?g?g]J|2!?ge?ge?g]Jx=!?g(?g(?g'p=a?g!`?g!`?g2 ;!?g#*?g#*?g2*Eqa?g$s?g$s?g2 t"!?g&6?g&6?g2*́a?g'c?g'c?g2 C!?g)'?g)'?g3B*Aۮa?g+?g+?g2 &}!?g-L?g-L?g3B*a?g/q?g/q?g2 p!?g05?g05?g3B*]a?g2?g2?g2 MB!?g4s?g4s?g3B*ƍHa?g6=?g6=?g2 L}!?g8C?g8C?g3B*Da?g98p?g98p?g2 !?g;3?g;3?g3B*sK}a?g1-?g1-?g2 !><!?g?g?g3B*Ia?gĴ?gĴ?g2 d*!?gw?gw?g3B* ]a?gX;?gX;?g2 !?g !?g !?g3B* :ǃa?g ?g ?g2 9!?g ?g ?g3B* 2a?gI?gI?g2 ?g>?g6=*C"a?g?g?g8ـ ~!?gt?gt?g8ـ* G a?g8?g8?g8ـ !&h !?ge?ge?g8ـ*!{A{a?g /?g /?g8ـ "4G!?g!?g!?g8ـ*"pa?g#*?g#*?g8ـ #"!?g$s?g$s?g8ـ*#?a?g&6?g&6?g8ـ $(A!?g(?g(?g8ـ*$a?g*Q?g*Q?g8ـ %&?g>?g*0ta?g?g?g 1f6$/!?g9?g9?g*18 a?g?g?g 2}5!?ge?ge?g*2| a?g(?g(?g 3!?g!`?g!`?g*3# a?g#*?g#*?g 4V{!?g$s?g$s?g*4 ' a?g&6?g&6?g 5<!?g(?g(?g*5Xʻa?g*Q?g*Q?g 6!?g,?g,?g*6G Qa?g-D?g-D?g 7C<!?g/q?g/q?g*7 a?g05?g05?g 8?g!?g2?g2?g*8JoWa?g4s?g4s?g 9X!?g6=?g6=?g*9 a?g8C?g8C?g :DQo!?g9?g9?g*:_a?g?g?g ;o6M3!?gÀ?gÀ?g*;QWa?g?g?g <!?g]J?g]J?g*<Pa?g'?g'?g =S!?gX;?gX;?g*= 4a?g !?g !?g >}Gd!?g ?g ?g*>!!a?g ?g ?g ?.m+!?gI?gI?g*?f a?gI ?gI ?gmm !?g?g?g{Z|a?gu*?gu*?gOE!?gׄ?gׄ?g{LTra?g9?g9?gԒ!?g?g?g{Va?ge?ge?g<-!?g /?g /?g{ Ra?g!?g!?g1!?g#F?g#F?g{r% a?g&%?g&%?g(!?g'c?g'c?g{Hb6a?g)'?g)'?g-!?g,?g,?g{qa?g-D?g-D?g_D!?g/?g/?g{Z&a?g1xˀ?g1xˀ?g!?g4s?g4s?g{5a?g6=?g6=?g /!?g8C?g8C?g{ a?g:i?g:i?g [!?g?g?g{ նa?gbZ?gbZ?g 5c!?gĴ?gĴ?g{ _"ta?g?g?g zg!?g !?g !?g{ 5ra?g ?g ?g wĨ!?g ?g ?g{ a?g߀?g߀?g^t:!?g?g?g{UHa?gf?gf?g\=!?g ?g ?g{˧ a?gׄ?gׄ?g5!?gG?gG?gw{Aa?g?g?gz-!?ge?ge?gw{ܧa?g(?g(?g/!?g!?g!?gw{[Jja?g#F?g#F?gԨ!?g% ?g% ?gw{R Pca?g'c?g'c?g !?g*Q?g*Q?gw{~@a?g,?g,?g!?g-D?g-D?gw{^a?g0G?g0G?gK!?g2b?g2b?gw{Юa?g3%?g3%?gEu!?g6=?g6=?gw{7a?g8C?g8C?g09!?g9?g9?gw{zr/a?g?g?g!?gbZ?gbZ?gw{/7<a?gĴ?gĴ?gf!?gw?gw?gw{Et>a?gр?gр?g2P!?g ?g ?gw{uwa?g X?g X?g !?g沀?g沀?gw{Ea?gv?gv?gu~!?g?g?gw{m5a?gu*?gu*?g iN!?gׄ?gׄ?gw{a?gG?gG?g 8X!?gk ?gk ?gw{ʔa?g4΀?g4΀?gр 2!?g?g?g h{ Pa?g U?g U?gр!^!?g"?g"?g h{!Py,a?g$[܀?g$[܀?gр"d,h!?g&%?g&%?g h{"Pa?g'V?g'V?gр#h!?g) ?g) ?g h{#j/Ga?g*T?g*T?gр$R|!?g,?g,?g h{$=bca?g.}?g.}?gр%tϧ!?g0G?g0G?g h{%,Zdfa?g1xˀ?g1xˀ?gр&B!?g3B?g3B?g h{&a?g5 R?g5 R?gр'܉^!?g6?g6?g h{'?ta?g8ـ?g8ـ?gр( riY!?g:i?g:i?g h{(Baa?g?g?gр)B!?gÀ?gÀ?g h{)Ja?g?g?gр*г!?g]J?g]J?g h{*72^a?g'?g'?gр+|e!?g ?g ?g X{>WXa?gI?gI?g X?`!?gI ?gI ?g X{?])!?g?g?gрn@!?gܓ?gܓ?gр|V!?gW?gW?gрz6]!?g?g?gрB!!?gt?gt?g h aR!?g8?g8?g hFG!?g?g?gh!?g U?g U?g UoI!?g"?g"?g"o~B!?g$s?g$s?g$so>!?g&6?g&6?g&6oyI!?g(?g(?g(iL[!?g*T?g*T?g*Ti/d~!?g,?g,?g,i`D!?g.}?g.}?g.}i^!?g0G?g0G?g0Gi^<f!?g2?g2?g2iYL!?g4s?g4s?g4sie!?g6=?g6=?g6=i9a!?g8ـ?g8ـ?g8ـi P!?g:i?g:i?g:ii !?g?g?g3`!?g?g?gPׇH!?gĴ?gĴ?gĴP9? !?gw?gw?gwP֣^!?gр?gр?gрP'}!?g ?g ?g Oct?I!?g X?g X?g XO5`!?g沀?g沀?g沀OG!?gv?gv?gvO_@!?gz9?gz9?gz9QMSx!?gܓ?gܓ?gܓQ !?gW?gW?gWN5x!?gp?gp?gpNe!?gt?gt?gtN.K!?g8?g8?g8N׼!?ge?ge?geNȊ!?g /?g /?g /N ȏ!?g"?g"?g"NKw!?g$[܀?g$[܀?g$[܀N?!?g&%?g&%?g&%NXU3!?g(?g(?g(Nh+Y!?g*Q?g*Q?g*QN m!?g,?g,?g,N @v!?g.}?g.}?g.}N ;@f!?g0G?g0G?g0GN!?g2b?g2b?g2bN9 "!?g4s?g4s?g4sN+2J!?g6=?g6=?g6=N8'!?g8C?g8C?g8CN!?g:i?g:i?g:iN !?g?g?gN8ű!?gbZ?gbZ?gbZN9t!?gĴ?gĴ?gĴN}"!?gw?gw?gwN:!?gX;?gX;?gX;N ji!?g ?g ?g N ^G*!?g X?g X?g XN 71!?gN?gN?gNN~p!?gv?gv?gvNI!+!?gz9?gz9?gz9NM!?gC?gC?gCN+!?g ?g ?g Nl>!?g?g?gN!?gt?gt?gtN]!?g8?g8?g8N1!?ge?ge?geN-n9@!?g(?g(?g(N-,!?g!`?g!`?g!`N Hd!?g#*?g#*?g#*N J!?g$s?g$s?g$sN j)!?g&6?g&6?g&6N$!?g(?g(?g(Nnd!?g)'?g)'?g)'Nhdj!?g+?g+?g+N !?g-L?g-L?g-LN8!?g/q?g/q?g/qNj{!?g05?g05?g05Nct!?g2?g2?g2NF}!?g3%?g3%?g3%N0^b!?g5?g5?g5N`q0!?g7n?g7n?g7nN p!?g98p?g98p?g98pN ""S!?g;3?g;3?g;3N C~!?g1-?g1-?g1-;V!?g?g?g >!?g,?g,?g,Ъ!?g?g?gy֍A!?g?g?g6oϗ!?g h?g h?g h[!?g S+?g S+?g S+8O^!?g ?g ?g ^!?g沀?g沀?g沀b!?gv?gv?gv{#T!?g?g?g/$m!?gf?gf?gf.;!?gu*?gu*?gu*|#"!?g>?g>?g>j!!?g?g?g%!?gt?gt?gt1(!?g8?g8?g8W!?ge?ge?ge@|!?g(?g(?g(@!?g!`?g!`?g!`F7!?g#*?g#*?g#*[;!?g$s?g$s?g$s י!?g&6?g&6?g&6 i !?g(?g(?g( !?g*Q?g*Q?g*Q s!?g,?g,?g, w!?g-L?g-L?g-L T!?g/q?g/q?g/q -!?g05?g05?g05 :y!?g2?g2?g2 4/!?g4s?g4s?g4s g!?g6=?g6=?g6=xDA!?g8C?g8C?g8CW!?g98p?g98p?g98p'!?g;3?g;3?g;3NlOs!?g1-?g1-?g1-n}!?g?g?gn!?gĴ?gĴ?gĴ3;!?gw?gw?gwUњ!?gX;?gX;?gX;Hwn!?g h?g h?g hY!?g S+?g S+?g S+K-!?g ?g ?g 1}sb!?g沀?g沀?g沀rQ!?gv?gv?gvu $o!?gz9?gz9?gz9̌!?gC?gC?gC׸!?g ?g ?g ]!?gׄ?gׄ?gׄf!?gG?gG?gGpHA!?gk ?gk ?gk G!?g8?g8?g8,!?ge?ge?ge+!?g /?g /?g /rz!?g!?g!?g!==!?g#F?g#F?g#F%3A!?g% ?g% ?g% r\!?g'V?g'V?g'V![q!?g) ?g) ?g)  !?g*T?g*T?g*TP!?g,?g,?g,~!?g.}?g.}?g.}[ !?g/?g/?g/!?g1xˀ?g1xˀ?g1xˀP!?g3B?g3B?g3BJЗ !?g5 R?g5 R?g5 RPI0.!?g6?g6?g6vJ!?g8ـ?g8ـ?g8ـ `!?g:i?g:i?g:i T!?g?g?g!r!?gÀ?gÀ?gÀ!祧\!?g?g?g"S!?g]J?g]J?g]J"C!?g'?g'?g'#&r!?gр?gр?gр#0 !?g ?g ?g $x!?g X?g X?g X$*g!?gN?gN?gN%!?g߀?g߀?g߀%Z!?g?g?g&K!?g?g?g&Sz!?gܓ?gܓ?gܓ'[]!?gW?gW?gW'"+!?gp?gp?gp(M]!?g9?g9?g9(3K*!?g?g?g)XU!?ge?ge?ge)!?g(?g(?g(*\!?g!`?g!`?g!`*k!?g"?g"?g"+2\!?g$[܀?g$[܀?g$[܀+!?g&%?g&%?g&%,R!?g'c?g'c?g'c,d!?g)'?g)'?g)'-:n!?g+?g+?g+-ؔ!?g-L?g-L?g-L.E!?g.}?g.}?g.}.2!?g0G?g0G?g0G/o'!?g2b?g2b?g2b/=!?g3%?g3%?g3%EǿN!?g5?g5?g5Ey{W!?g7n?g7n?g7nEr!?g98p?g98p?g98pE5Ǝ!?g;3?g;3?g;3bSn!?g?g?g؄!?gbZ?gbZ?gbZ ћ$!?g,?g,?g,jj!?g?g?gQ!?g?g?g2;!?g !?g !?g !z;Ũ!?g X?g X?g XOD!?gN?gN?gNip !?g߀?g߀?g߀7ҹ!?gz9?gz9?gz9f!?gC?gC?gC!?g ?g ?g !?gp?gp?gpj!?g9?g9?g9~>87!?g?g?g !?ge?ge?ge HI%!?g /?g /?g / ? n!?g!?g!?g! .l!?g$[܀?g$[܀?g$[܀ Ky!?g&%?g&%?g&%Um"!?g'c?g'c?g'c!?g*Q?g*Q?g*Qۢ!?g,?g,?g,T!?g-D?g-D?g-D{!?g0G?g0G?g0Gh!?g2b?g2b?g2b*!?g3%?g3%?g3%4!?g6=?g6=?g6=eY!?g8C?g8C?g8C+!?g9?g9?g91!?g?g?gy•!?gbZ?gbZ?gbZ{ys!?g,?g,?g,&6?!?g?g?g Þ!?gX;?gX;?gX;!?g !?g !?g !=F!?g ?g ?g P!?gN?gN?gN 1!?g߀?g߀?g߀!f!?g?g?g"F!?gC?gC?gC#p{ !?g ?g ?g $:_!?gׄ?gׄ?gׄ%,!?g9?g9?g9&f!?g?g?g'o6!?ge?ge?ge( {!?g(?g(?g()ޣ!?g!?g!?g!*7 W!?g#F?g#F?g#F+ܰ!?g&%?g&%?g&%,Q6_!?g'c?g'c?g'c-Hz!?g)'?g)'?g)'.+!?g,?g,?g,/T٪k!?g-D?g-D?g-D0KMzl!?g/?g/?g/1^!?g1xˀ?g1xˀ?g1xˀ2.Vc!?g3%?g3%?g3%3w'!?g5?g5?g54r!?g7n?g7n?g7n5Yt'!?g9?g9?g96cm!?g?g?g74M!?gÀ?gÀ?gÀ8vh!?gI ?gI ?gI ?:!?g?g?g]JW+׵!?gܓ?gܓ?g sBu!?gW?gW?ge SHWTBu!?gp?gp?g( mBu!?g9?g9?g!` `u5Bu!?gk ?gk ?g#* ${Bu!?g4΀?g4΀?g$s Bu!?g?g?g&6 BBu!?g U?g U?g) mBua?g"?g"?g]J `X!?g$[܀?g$[܀?g]J[K9a?g&%?g&%?g]J r !?g'c?g'c?g]J'rdDa?g) ?g) ?g]J  !?g*T?g*T?g]JMp)a?g,?g,?g]J @*O!?g.}?g.}?g]JKa?g0G?g0G?g]J !?g2b?g2b?g]JSaa?g3%?g3%?g]J Q[!?g5?g5?g]Ja?g7n?g7n?g]J  (!?g8ـ?g8ـ?g]Jd8{a?g:i?g:i?g]J I!?g?g?g]Jo!?gbZ?gbZ?gbZwBb!?g,?g,?g,w~f!?g?g?gw$!?g?g?gwoQm$!?g h?g h?g hwʂU!?g ?g ?g 2:W?gׄ?gׄ?gׄss0P:?gG?gG?gGss1b]4?g*T?g*T?g*Taudio0yQ?g,?g,?g,mixer0l?g.}?g.}?g.}sound0+ ?g0G?g0G?g0Gaudioctl0!H)m?g?g?gĴFtTm"?g?g?g]J,?g'c?g?gPX`h@nB?g X?g?g ("rV?g?g?g/tmp/disktab.shadowA?g?g?g/tmp/fstab.shadowK a?g!`?g!?g!/tmp/resolv.conf.shadowl ?g$[܀?g$[܀?g$[܀/tmp/hosts#?g'V?g'V?g'V3P ?gĴ?g ?g沀0B?gu*?gk ?gk tum?ge?g S+?g S+HPX`hpx4tlā/dPTUx, [ vֶ4= Ie?'EDdcjv0C @ݱE7,UҠoz R0jR, 80Nojwϫ7"Iv jVߥA2=<zkF0?eMípaۤ# l2D:|ҊB^Ya,SqK!˝i.H98R!]^; +&^D@|ex~65+|}s9}%lDXp m{g2nQA\Y=B0 g\/g;9NP&5ljyKU$B$QM'!gh^i9ߪ:f2Dw@.":ޤ5/_ +K.8c Glٗ((/*u B; Ť@2   # "p  " &   #   "p@"@ "p  & ! f!ԐX'@? gXbbخ" 'X\"@ '\Вb@ ?XXj"\j?00"D?00B F?0 ?0 `j d#\@28< @'8$@` Ā` j"Hj"Pj0 @ d,@%%@ g"  ( j"Hj"P jX@ d,@k%%@\@GȒ##\`@ކjb BXjp d0 ¡,@;`@L%%@@j   j@&"㿘!:\" $" 㿘V@/h 㿘gb8 2   @u    @ ?CAjb@eo  9 +j-j8@JN  "  &!D?D? g $b8 ?"b8@ "0d @eeb b@e7 8㿐g"p      @     @0 ?vtj b@e   $  '7a@+ cj b@e    X $ Tbp bp@I  4A6 j b@d   7 'a@?j b@dڐ  D 4bp, $ (bpbp @L6   j b@d  D 4bp $ bp0  D4bp $bp㿘@5'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'8'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@'@''@''@'@''@'@'@'@'  f!Ԡ ''|-I+:)j|'k5 `7k 0* @€    b"@O @A@gÔ??* & @ @2`@@ |k` @d+ ? '' '| ''|'0@": :" `-kk`8@岐 ``@d  @  㿘 ek`x@椐#@  㿘@r  @c 1'k n L  o  @ = 2*`"@  2  k @2    &*@&`@j  @ఒఠ 2L@o1㿘@)*************************x************ȝ0/J#g!g%g9g-g;g+ %):'k*7k $%* @€ $b$" $ $"$b '" % 'b`X k`@ @"@J@f֔؀?Ӑ? `!*@` & b k@ca@3@  2@ka0@c8  !@Y@@ `R' @@J  @i@ @@c@`=`< @ @2 @@@@ 2-`%a@@ !"耢  @k@@cAh`@T D 2 aka@@c3D` @@c``@  @`  @u 4?a` $ b @0@@  㿐@  @6  @# ` T@! 㿘 % X  b`?  #g@͔    2b@ 㿘 kN  nka@  gN  ogg "b "" % %  @w , ` @m*  $X @bQ $@ , `$@  @` , 2*@, $@㿘g"` % X` g"` @v ., ' D"耢 @"!x g"`@ ! T@a!!㿐@6?kk!@C 0!@C㿘 :  @Ԑ   ; @̑>`    ; @Õ;`㿐k  @Bߐ!g"   " ҒG   @ @C@Dc  @C@0 ` @ @C@DO @C@0` @ @C@C  @C@0 k!В@B 'kB'k Dk ?k !@Br gb )k  "' kB'􀢠kB k  Bk"  k?!@BHk@BD"k"@B@ T㿐g"쀢`k"(@'kk"0X@B,gg"䀢` k"h$'@'@Nkk"xX@Bg"`"kk@B "k@B"` !xg"䀢`k"$k"ئ"@tkk"X@A`n T ` ``" 2'@  ?k'#H ‰ F?@P`k# ` @6 `@B@CW` ` `@B@/` ` @6 `@B@B #\`@B@/Ր#\`  @  @B|@By` #` @Bt@/`#`#l#d#h@Aya!a㿘@ݝ k@`p!`?@@  @  ? 㿘 @A@E:" `  @ ek#cP@⹖  㿘 #"k ec`@⬐#@  㿘!g # D?#%\F!T@"&;? 4& 0& (&  8@/B  ̘ d & < (#  ; @ԑ<  @; d$"@& @/- ,?& Ȑ&& &$ k#T@  Z@  ZkDc@  㿘+g $c{$ O?c 8;#S@2H? L (&B? $*& 4 * &@BR (   $@BI4 ?@BC`@.ې$&  & "@ &c& & &&$ k#T@  Z@  ZkDc@(  㿘@==l=l0*(@H lbp@] @R Z @K  o#`ll"b@>  @h4!  la@\ 'DD <@-&Do* &   * &*& 'Dl@="D  6 l!l.  @="D . l@=ߐ"@h4@h2p @4`  %0.l@\֐"@h"` H"%l#:;l@$И@Ӑ&@bb `b@\`@ 2@:" `l"@\@ @g@g@@cU @l@\#*  `:  a0" ` o@> l# @\ o#`H@\ l"p@\y @  a l@Ӑ#(` f!Դ'l  T #0@=U Do>c *    %lll#HcP8@=A  %!|` D#3l!| `-l+l)l@`  2 HcP#X@=$ ,@`  뀌@`ll#P#X@l#xl l#`@=   4'̒@&l#@@4 q#0 `@2@4  q#8 `@&@4 q#@ `@@4 q#H `@@( 4 q#X `@@4 @"q#h `@@q@#p  4 q#x `@@! 4 q# `@ݐ@ @ 4 q# `@Ґ@  4 q# `@ǐ@4 q# `@@" 4 q# `@@$ 4 q# `@@( 4 q# `@@4  4 q# `@@ q#Ȓ @@  4 q#В `@x@  4 q#ؒ `@m@  4 q# `@b@ "  4 q# `@W@ q@F# q# @I@  4 r `@>@  4 r  `@3@ @ 4 r  `@(@  4 r  `@@  4 r `@@  4 r ( `@@ "  4 r 0 `@@ r@ 8(2 #4 r @ `@@ #!"r"  4 r#4 rr@ِ H4 @Ր P 4 r@А X4 r@ː `4 r h `@Ő@4 r p `@@4  4 r x `@@4  r `@@$ 4 r `@@4 @r `@@4 r `@}@" r@j m"x`"x%r` @@ d@e@c` @ 2`@O D@K m"x"x`2 rr `Ȭ d,`` " ` @%@=`  @^@2 2 ` @3 @3` @ ؀!r@3 Ȑ @3  r@k Ё㿘!o# q@2"$#o"#㿘!o#  o#r@2 $#@f#@`H rr@2Ր r @2ђ $#@2ː #@$#㿘 ?  1or#@В &#o1r ! # M.# -*  ^* ? *4* ^*@**#@ f! `'H'" '% `'H@T?2 e"  f a + g% !:"@Ζ  'r"a@QB  @H*` r@aH*`@ rH* @'H ra @Đ `@< ra0@Q `h@1 `r@Q1!@` `H H` HHH''@ OH +rS =H 7H 1HJ@? eaD   `  H@@@W@'HaP@  Hl`'r@P!X@/H 'H   @7 rap@P    `g@Ϫ r@P! r@ ! 㿘 #"r ea@#@q 㿘@2wwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwwww8+])o'o%o!o#r5 `/o97 -* b@€  %#$  $  $( $#0@@Sbp??,#0* @ &!$ᨀ "  . " `. @r@bx@- @ @(@@?@7L rb@Oސ <  "@@@  @@  `@@@Ȑ0o#0 faԢ 'o@7  rU"o#$`o<  or@O"H #(`0 !€ o<  o@ߡ r#"r@Ԯ$o# ` o@0m o:" `2 ro#,€ r"@O a԰ a r@"㿘 #"r eb@#@I 㿘@OH~|~|~|~|~|~|}~|~|~|~|~|~|~|~||~|~|~|}~|~|~|~|}4~|~|~|~|~|~|~|~|~|~|~|}`}p}}~|~|~|~|~|~|~|~\~|~~|}~|}~|~l}l 㿀''/;^# &)y+y!:%/y7s-'x5sp9x 8k* ct@€c  @  $c_'c  @  V$cc  @ w  'K$c!x G%!xa| C%a|c  @ d :$cc  @ [ 1$c".' *$t &%tc  @ G $c"@J "J `" @ 7"  / %ܐ $@ )@Q?? `ac*@`&  $c  !xa|  쀢c "y@ cy @` "  `@! 6c!sa@N= ?`^\*` € @ @p @) @' @ @` @ ጐ@ m' @ @M t@   e#H@ 0 e* cH:@@ O'? y@ y#@Ԑሰs`@o! s`a@Mܐ @ 3y- , `m@ %sa@MƐ ?  @ r  ``@#yሒ#@#@!@ a y!@'@㿘@% sa(@= @햔!&&& `&$@5 㿐x#ؠ ` s@Mΐ!@!y!s@Mɐ!!s@MŐ!s@M!  !W&&6@ iao6a   e`f@|  x:"  sh" x#܀`   aD + 3` @;   aD + 3` @ ; s "8@.N 2H'  @: 6 s"`' `m@< 6s@h!@4 s"h@] 0% !' `m@!  s@M! !`2  e`g@  s"p@ 0 㿘:"   s0 s0s@M"0s@M"0 s@M#(0s@M#P0@L!㿘!`sx#܀`  * 2`   :  @@s # @-  @걖  y a@1c y!sa@L a !Wa s x@ z*  bxs@L#x#`t"؀   !W !s2  2   #@ T*  8ሒ#Ȱ (s@L!2 y!x` `s@` yt` @L9 y!|`x#e`r@N t`8@L( #e`e@B  t`P@L t @Lf& 㿘`( 2 @"&`&`( @!@ !Ԁ@ tJ `h@͠ *J㿘N`t` t` @Ύ`N` t` @΅`t @`8 t &"* t`@u`(`@p`(t@k``,t@f``0t@a``4ta@\`8ta@Wt`<a@R`Hta@Js``Jta(@@s``Lta8@6s``NtaH@,s``PtaX@"s``Ttah@ `\`'t,x@ ,` L  &")@9t7t5t/t-t+t@ 7t@= @!@`@ ` a *@@ܒ ` @֒ `  2` ` ,`@< @Ɛ`@a`@ ¢` @@E` cH*`P`K  p. `@ / : ` c H*`@ R`* : tt H P_ X* €' tXB`('`tXB  D' tXB'`tXBD' tXB`8'`tXB  ' tXB'`{' tXB`($?@-J' tXB  ' tXB??M$' tXB`(?@-$' tXB  ' tXB??'' tXB`(?@,' tXB  ' tXB??@,' 6tXB tP  /  t#\aa@̭ 0?: t#l #\#`#d#haȘ@̛a  t  &b* @ta@̎0 a@̉  ts  @2ts a   @' t b@kb @e .ltb(@[h `8`"d  @,ktb0@M @(5`8  ?`&  @& * *@^0?`&  @&  * &@M `8  @,;??tb@@ `8@(  ?`&  @ * ** &@) ?`&  @ ) )* &@ ?`&  * &@  㿐!tb`@ݐ` * &" tbh@Ґttbx@̐t`b@Ɣ tb @`tb@˼`X`tb@˵`X tb@ˮ`X tb@˧ ?`&  * & @`(t@˔b`,t@ˏb`0t@ˊc`8t@˅c `4t@ˀc8`<t@{cH`Ht@vc``Jt@qcp`Lt@lc`Nt@gc`Ptc@b`Ttc@]u`@Y`\`    ,``"`&  4 `'u, @> $, `u@5`  u x#`uu`8 p#\@$` @ . >t``@@桐 f!Դ &'@#?u@ ` ?s@Ős!@Hw~ u@i"P@|@)Bu  u`@u`@ސ@k-s/s+yQ)u !@"@ @ ג@!!a @J@)3"` e@F#H e` ? "`@   " ? e"`? $`@  $` 2` n N@  ㈐@h 2X@G@(ΐ㈰  u@X"㿀uubu''"'@ ' u"@\% &@X  @R uu@G͐"K Ș@Ґ' @L  @I  @F !: #u@魐 @x &" u"@M@_ @G"@R '@R@NK  ` `:`@  @  @  @ 䀠 `?㿘u@4bL  㿘1u@%"L  ", @L   㻈 f!'&`  &`b@F ,Ő "@2 : u"@G_`,uc@ 2uus  c@)  &r# &"`<@@ "`@ t⠢`@*@@ې 'u#@G&l6`c@@K :u'쀤3L /-u)u'u#ux@7H  '@.#X  '@%`  'ch@F`L .&`Xc@  u $L  `\@,`$ 9 `L `c@쀢 ? u#@F 6`6`us ؒc@Ր u `c@̐ u`@-ǔ c@ u@= '쀊a"&`(u#@F˪`c@ v@'  'u#@Fq`&`,`@ v@  'u#@F\`&`8` @ v@  'u#@FG`&`0`0@k v@  'u#@F2y`w&`4`@@V v@Ӑ  'u#@Fd`b&`<`P@A v@  'u#@FO`L6`H`X@+ v@  'u#@E9`66`J`h@ v@  'u#@Eܒ#` 6`L`x@ v@|  'u#@Eƒ ` 6`N`@ v@f  'u#@E`&`P`@Ԑ 2 @Q  'u#@E`&`T vL  v*`: ` vȐ 6`* ٦@@#  'v @En`&@Šΐ@  'v!@E[`$:,  &b `P@  @ "`@" `@*@L? eaD   `   @ِ'$@ : '쀢 v!0@E',  "^#Yv@ Q$v @EH`e@@'e'>, v @D5`R@ -$v @Dݒ$`A@@'@'쀤, v @D˒`.@q 4$@: 6`!`@D`#@M @u@@԰`?  v@!v @D`㿘 (  v! , 2 0v! 2 4v!@D   2 Hv!@D~   H 2 8v!@Du  8 2 < ,@x 0& 8 < 2  8@p 4& < v"@D]  @" ( v@DT"  v"P@DL  @" ( v@DC"h `v"@D<   \)@ /v-v+v  a @D(= @"e 8 ,`:`@D @"\ 8 ,`:`@Dc82  "    v@D #p  <@,`v#@C:`  < v,`#@C:` 2    ,`w @C:` @  4, #wa  " @C̐`@ `% fԠX'!@n!@i'XDP'H'L7'@V! w@ߐ pp f!Ԣ'%swؒ` @D@! e,@w`@ߐ#w`@ڐ#w`@Ր#@֐?wa @͐#wah@Ȑ#wa@Ð#waؔ@ž#wb c@Ź#wwbH@ų#wb@ů#ww#b@ũ@  (   @*`2 D|<,HX,dL@8ЀЀЀhЀЀЀPЀ\X(((((((((((((((((((((((((((8Hh(x(((((((((@@@@@@@@@@@@@@@@@d@@@@@@@@@@@@@@@@@@@@@@@@@@@@@d㶸 f!Ժ('@!  `  @В  x @ʒ   x @Ē  xx`p@Ê x`@ Ӑ$@  @ @ @q  "x`@p x"x"@ @῔! ܀ 2xx@А `8$  7$ d'$ , 4 , x@!`' r'r 2x 7rx@䫐!X@ቔ!(5 exH@U$@d? x  ?`$ H* &H@4  q/(/)x"@S x@M @*`:` p>* k@€ x h@ x!@D@@!`@ 3@ 0@+@*! `@(!`xِ!@!@@ @! 2xҐ!@!@@@! 2ux!@!@e`r@ x@ \x@A"!@֐@Ҕ!`@ Ő@ ’@@뼔! `@ດ!`3xk!@ఐ!@ଐ@@렔! 2xd!@!@$ @@뇔! 2xK!@@}!`@ p@ m@Ӓ@g! `@e!`x` x e"0@+cx@ L@ I@f@ g "x@ <x  L@x @ x@}"h xL xx"pxb@D x! '@Đ!! @@E"@@8@ x!`>`@ B@! 4)x%x#x`  b X*`@ R``y*: `  b X*`@ R` n "@c 2L "İ L`  b X*`@ R` y2 y!> x@@#( @ x@֐#@3x xxx#`cp@ xL #xxb@/ x#@?’xX @ǐx@ꊔ! ` @  x@⟐#x!@{!@w!@s@ `@ cx@⅐#x!`x@|"x`@ @M! yx@i"x! x@?#(x@;!xp#Ѐ `?"#x#x#x@ G#x@$!@ !@ xyL@@ 4 x f! y@ޙ (㻐 f!Ԯ'  y e 0@ϒc $ * :?    ,  ey#``@ pԐ `G  `C ey#`@{:Ԡ -y` +y   , @`2  "    a//% e)y'y(@Y p@`ඒ N,  ` @ @D!   6 ,     6 & &&& & @ &.  . ($&  . 6@ < " {&$&@4.   +  ". +      "  +  2  `+ . @ W  2N& ϐ@֔ y!X@O a&&@ W 28&@  21&p#Ѐ`" 2@  2"&@  2&@  2&p" &̐ @? @ y@x!㿘yy!a@ 2Jy e!@c07*   &  ey#a(@j`0&    ` ey#b@\a0 `   *  '`d*@  ey#@Gb 0@ 㿈yy"Pbh@є 2Jy e!@ac0.    ' ' '' &   ey#a(@`0     ey#b@a0@  w    `  " ` `       eyb#@ۘ , &" &@ D@ < 2T$ N$@ y@3"$ $@  #p#Ѐ`"'   2! @ ~ @    2 @   $$ $ $  pc̐ @u? @㿘yy#c(@ 2Jy e!@c0r *!?  k" `  " "``""` &"`"`"`"` `0P   . ey#a(@4`;` `  `  ey#b@!a(`  y e#`@Hc` pc̀p#Ȁ      ` &" " " " ` .@ @G&@㿐!.z@a   ' $* z@Y z  @T 0z  @O @ (z@K P ,z@G h 0z@C  8z@?  4z@;  <z@7 z@3  Hz@/  z@+!>zaX#\zz!P@  # ecH> 㿐@ pb#pcȀp#̘ `@@   * @  8? @ ?   + @@  @  #@n    "&@+  "@ @    +  +   `+ &@@F㿐zz!`a@ 2Jy ej!贆   . ey#a(@`0o `   ey#b@a0cz@a@k!@@ ` ` #\  #`@zz@ƒ??y e/!2@z e)"X 9 `   # @  ez#@bh0'" &@"@ @ &@ ` < z e"@גc0`pc̐  $@@? @㿐@  @pp#Ȗc  @ # `@@FC@"@㿘o z"*c8' ex h@Ԑc8$@ 2c8 ` ,c8 X ?4  " X* $ X @{a ! c8@; ?L ", L8`?8@ݥ Lc8`2Lc8@E$Lc8 ?c8㻈 f 8\ !Ԧ `'@-z eb/@}А$@B  ` /X ?4  "X* $X @{  հ?@ ?L@ O ,@O ?O@NO ? *`O `vt r`(?L@`  b X*`@ R`?` k"P*` € 8 (,@  ($ ( (@,@O + -   !:'$" @" "4?J` $" -? z' B# '@Đ 'z # 7ā@' B'-:  + -"'`@?> 'z#B 8' z#Bz# zB#7ƅB' B' @ْ"8@Ғ" @̐"z"@ f! z@#㻈 f!Ը'@  0@Dǐ @`@ s e#H z-`,`@@   `l?l""@2 2``a`a(@Iz@F#P  !    Ŧ/z - e`'%"$* @%㈠/$@ O X` ?"` X* $ X@y # O` ڐ?*  *  @ @ @DU&{`@ -`(2 @@DC ! z@S# f!Ԕ!X'@ػz@Ӑ# ' ;{9{7{5{/ e z '*`$ ` "Iy@Β X    `$  , @Ð 2  )@`@^H # e){`$%{, @ @PcH  , cH` ?"`cH* $cH@y2   {{6  ` 2 y e!@+c f" &@y ec@!!@J! f@ ){'{%z# e ,#\#` !Ú ?〤?X@c ,& ,){'{%z# e 0#\#` !0@ ?ˀ?X@~c 0& 0){'{%z# e 8#\#` !h ??X@~Ӓc 8& 8){'{%z# e 4#\#` !Ж{ ??X@~c 4& 4){'{ >c̀ <"@  e{#@wb <" 4 (@$  4@  #\#`J ?j?2  <z e"X@~c <#pΔc̀ˀ @$ @{&@@"Xc̀8$c& <){'{%z# e H#\#` "ؖ ? X@; @8 @5 @2!@/!(@,!P@)!㿘'x   "@צ @@ $p@ @   " @@`$ <㿘   `" `2 @G ` ``   f!Ԯp' @ߪ t   , @ " "@ "    `d#b@  N r ؖbИ@Ē$@ / "`N@`r2G ؖ.@$@`.@@?,{ X@ x@b  )  " '"`t   @*  ` a*@ @#\#\@  `@ 2@@t  @Ɛ"㿐.` zaX#! e-y+z)'% ` #\`   #` @z#% 2pbX@z# ` #Ȁ #@#( ` p#̀ #@ ` `#@p ` $` 㿐.` %z%#``2   < z e7"  "N$ " @&E$ e#@fa P `#\``  #`=? ?y e!@z|c&  z e"X@zsc "  e#@7`  pc̖  e#@*` $ 㿐.` -+)y% e'z`#\#`Жa ??!@z; X@z5` 2$`@w"$` 㿐.` ` 7, J y e!@zcC 5) e/z-+ @@#\#`HX??X@: @#@ @ b@̐ #@yݒ# @,  㿐.` cP#X)y# e%z   #\#`t ??!@yc  24 X@yc  㿐.`  ` `( ' d*` #c   , @@ 2 ,` '@А#В !,` y e!@y~c +)'z% e ` #\#`` (' ?ꀤ?X@yg ` ,`  㿘. `E A ? = ;.#! /@ @=@ *&@x`p@   e @y8c@`p    y e!@y'c `@| 2N@  @=&@ 㿘 2 @@ 2  2@ `?@8@? `@2 @! #ex`p@ `r@2 6 &@`e@+ 6&@a@2 &㿘  !a@2耢 2 y eg!?* : `3dk#\*` €2( eU!& (,& ,0& 04& 48& 8<Q& <`2`( eB!& (`,& ,`0& 0`4& 4`8& 8`<>& <2( e/!`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@  e"@x\c0 e"H@xVc㿘 " " " "   <& 㿘@1tt` 9#h?" :@ :! 9 9? $#h"""#!"X |r#cl|"Г( € ""bP$#h @{!  $#h:" @@ #hR"T`N @k K#h  "ؔ "bP$#h&@X!  $#h:" @@` #h $|#h+"T`' @D $#h  "ؔ "bP$#h @1! $#h:" @@9  #h#( 9 "P"t#h ?1"L @ :" "L0@@  #h@a 6 a:" "PH@@  #h < "Pc`@?Ґ #h@ ??$#h$|2 #ha@   #h $l  @Β ?2 $l2 $l:" `2$l l`2$|!  `"x 9 9 ""cts#"`i|"*` €c?!  a"x 9"#Z"b`a @>c? !""`"b`! !l  9"` 9>"#?;"c! !"x  : a@ 0@%"x?""`% 91 9>$"`"`  : a@ 0@"` ! $"`! ?"` &#&#" 9"c"`% 9 $t 㿀 9ch   ""X"a"b #  9#l`# 9"`' : ?`" * " @p " @_c@ # 9c| h!@!  :!<    :40  :@bP$c| :!` ! 9"Ā`# @6n @h# @6^ "  9#l`2 ! :" @vM#" @ͩ"b!?$h  :!"ᘀ`" 9cp "cp" b""X"`' : ?`" * " @p  $" !"bbc@ @g ;"bX"@#    p@|  @`#"@  #"p 9cp#\#`#d#h"`?bX@ @, $bX?c f 9#l Ԁ`' 9ct   ?#! 9#h@? 4#h$t @_ X㿘 9#l 9"cx 1 9#h  @Ԓ    #h@#   :" h@> ?㿘 9#l``@=ِ ?"` "`"`@=̐ ? 㿘 9#t 3 9#l  9ch@l `  ""!!"`""ch@Z  "a $#t: 9" #p@= 0 9#pa(@= 㿘 9#t  9ch @   9"a"x6$#t$#t 9#l @ & : !ch  @; .  > b ch@ $  $#t export PATH=/sbin:/bin:/usr/bin:/usr/sbin:/ umask 022 set -o emacs # emacs-style command line editing rootdisk=`dmesg|sed -n -e '/OpenBSD /h' -e '//!H' -e '${ g p }'|sed -n -e '/^root on \([0-9a-z]*\).*/{ s//\/dev\/\1/ p }'` if [ "X${DONEPROFILE}" = "X" ]; then DONEPROFILE=YES mount -u ${rootdisk:-/dev/rd0a} / echo 'erase ^?, werase ^W, kill ^U, intr ^C, status ^T' stty newcrt werase ^W intr ^C kill ^U erase ^? status ^T _forceloop="" while [ "X$_forceloop" = X"" ]; do echo -n '(I)nstall' [ -f upgrade ] && echo -n ', (U)pgrade' echo -n ' or (S)hell? ' read _forceloop case "$_forceloop" in i*|I*) /install ;; u*|U*) /upgrade ;; s*|S*) ;; *) _forceloop="" ;; esac done fi #!/bin/sh MODE=upgrade . install.sub resp= while [ -z "$resp" ]; do ask "Root filesystem?" "$ROOTDEV" resp=${resp##*/} if [ ! -b /dev/$resp ]; then echo "Sorry, ${resp} is not a block device." resp= fi done ROOTDEV=$resp echo -n "Checking root filesystem (fsck -fp /dev/${ROOTDEV}) ... " if ! fsck -fp /dev/$ROOTDEV > /dev/null 2>&1; then echo "FAILED.\nYou must fsck ${ROOTDEV} manually." exit fi echo "OK." echo -n "Mounting root filesystem..." if ! mount -o ro /dev/$ROOTDEV /mnt; then echo "ERROR: can't mount root filesystem!" exit fi echo "done." for _file in fstab hosts myname; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /mnt/etc/${_file}!" exit fi cp /mnt/etc/$_file /tmp/$_file done hostname $(< /tmp/myname) ask "Enable network using configuration stored on root filesystem?" y case $resp in y*|Y*) enable_network ;; esac manual_net_cfg cat << __EOT The fstab is configured as follows: $(< /tmp/fstab) For the ${MODE}, filesystems in the fstab will be automatically mounted if the 'noauto' option is absent, and /sbin/mount_ is found, and the fstype is not nfs. Non-ffs filesystems will be mounted read-only. You can edit the fstab now, before it is used, but the edited fstab will only be used during the upgrade. It will not be copied back to disk. __EOT edit_tmp_file fstab munge_fstab check_fs if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit fi mount_fs for _dir in /mnt/usr/include /mnt/usr/libdata/perl5/site_perl/*-openbsd; do [[ -d $_dir ]] || continue ( cd $_dir if [[ -d ssl && -L openssl ]]; then rm openssl mv ssl openssl ln -s openssl ssl fi ) done install_sets finish_up } donetconfig() { local _dn _ns _dr [[ -n $DIDNET ]] && return DIDNET=y configure_all_interfaces if [ -f /tmp/resolv.conf.shadow ]; then mv /tmp/resolv.conf.shadow /tmp/resolv.conf _ns=$(sed -ne '/^nameserver /s///p' /tmp/resolv.conf) _dn=$(sed -n \ -e '/^domain[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '/^search[[:space:]][[:space:]]*/{s///;s/\([^[:space:]]*\).*$/\1/;h;}' \ -e '${g;p;}' /tmp/resolv.conf) fi ask "DNS domain name? (e.g. 'bar.com')" "${_dn:=$(get_fqdn)}" hostname "$(hostname -s).$resp" ask "DNS nameserver? (IP address or 'none')" "${_ns:=none}" if [[ $resp != none ]]; then echo "lookup file bind" > /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >> /tmp/resolv.conf done ask "Use the nameserver now?" y case $resp in y*|Y*) cp /tmp/resolv.conf /tmp/resolv.conf.shadow ;; esac fi _dr=$(route -n show | sed -ne '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while : ; do ask_until "Default route? (IP address, 'dhcp' or 'none')" "$_dr" case $resp in none|dhcp) break ;; esac route delete default > /dev/null 2>&1 route -n add -host default "$resp" && { echo "$resp" > /tmp/mygate ; break ; } route -n add -host default $_dr > /dev/null 2>&2 done edit_tmp_file hosts manual_net_cfg } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } set_machdep_apertureallowed() { [ "$MDXAPERTURE" ] || return ask "Do you expect to run the X Window System?" y case $resp in y*|Y*) sed -e "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf > /tmp/sysctl.conf ;; esac } finish_up() { local _dev _mp _fstype _rest set_timezone if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && \ /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done /var/run/dmesg.boot DKDEVS=`get_dkdevs` CDDEVS=`get_cddevs` IFDEVS=`get_ifdevs` DEVSMADE= THESETS="bsd bsd.rd $MDSETS" DEFAULTSETS="bsd" for _set in base etc misc comp man game xbase xshare xfont xserv site ; do [[ $MODE == upgrade && $_set == etc ]] && continue THESETS="$THESETS ${_set}${VERSION}.tgz" isin $_set xbase xshare xfont xserv site && continue DEFAULTSETS="$DEFAULTSETS ${_set}${VERSION}.tgz" done if [ -z "$EDITOR" ] ; then EDITOR=ed [ -x /usr/bin/vi ] && EDITOR=vi export EDITOR fi [[ -f /etc/fstab ]] && umount -av 1>/dev/null 2>&1 umount -v /mnt 1>/dev/null 2>&1 welcome if [[ $MODE == install && ! -f /etc/fstab ]]; then cat << __EOT You will now initialize the disk(s) that OpenBSD will use. To enable all available security features you should configure the disk(s) to allow the creation of separate filesystems for /, /tmp, /var, /usr, and /home. __EOT fi set -- $DKDEVS [[ $# -gt 1 ]] && _defdsk=done ask_which "disk" "is the root disk" "$DKDEVS" "$_defdsk" [[ $resp == done ]] && exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b ! . .. 0 1 2 3 4 5 6 7 8! 9" 10# 11$ 12% 13& 14' 15( 16) 17* 18+ 19, 20- 21. 22/ 230 241 252 263 274 285 296 307 318 329 33: 34; 35< 36= 37> 38?39@ 40A 41B 42C 43D 44E 45F 46G 47H 48I 49J 50K 51L 52M 53N 54O 55P 56Q 57R 58S 59T 60U 61V 62W63#!/bin/sh FILESYSTEMS=/tmp/filesystems SWAPLIST=/tmp/swaplist MODE=install . install.sub if [ ! -f /etc/fstab ]; then [ -f /etc/disktab.shadow ] && cp /etc/disktab.shadow /tmp/disktab.shadow DISK= _DKDEVS=$DKDEVS while : ; do _DKDEVS=`rmel "$DISK" $_DKDEVS` if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab cat /dev/null >$FILESYSTEMS cat /dev/null >$SWAPLIST else ask_which "disk" "do you wish to initialize?" "$_DKDEVS" done "No more disks to initialize" [[ $resp == done ]] && break fi DISK=$resp rm -f /tmp/*.$DISK md_prep_disklabel $DISK unset _partitions _psizes _mount_points _i=0 disklabel $DISK 2>&1 | sed -ne '/^ *[a-p]: /p' >/tmp/disklabel.$DISK while read _dev _size _offset _type _rest; do _pp=${DISK}${_dev%:} _ps=$_size if [[ $_pp == $ROOTDEV ]]; then echo "$ROOTDEV /" >$FILESYSTEMS continue elif [[ $_type == swap ]]; then echo "$_pp" >>$SWAPLIST continue elif [[ $_type != *BSD ]]; then continue fi _partitions[$_i]=$_pp _psizes[$_i]=$_ps if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do [[ $_pp == "/dev/${_partitions[$_i]}" ]] || continue [[ -n $(grep " $_mp\$" $FILESYSTEMS) ]] && break isin $_mp ${_mount_points[*]} && break [[ $_mp == '/' ]] && break _mount_points[$_i]=$_mp done < /tmp/fstab.$DISK fi : $(( _i += 1 )) done < /tmp/disklabel.$DISK if [[ $DISK == $ROOTDISK ]]; then if [[ -n $(grep "^$ROOTDEV /$" $FILESYSTEMS) ]]; then echo "The root filesystem will be mounted on $ROOTDEV." else echo "ERROR: Unable to mount the root filesystem on $ROOTDEV." DISK= fi if [[ -n $(grep "^$SWAPDEV" $SWAPLIST) ]]; then echo "$SWAPDEV will be used for swap space." grep -v "^$SWAPDEV" $SWAPLIST > $SWAPLIST.tmp mv $SWAPLIST.tmp $SWAPLIST else echo "ERROR: Unable to use $SWAPDEV for swap space." DISK= fi [[ -n $DISK ]] || echo "You must reconfigure $ROOTDISK." fi [[ ${#_partitions[*]} -gt 0 && -n $DISK ]] || continue _i=0 while : ; do _pp=${_partitions[$_i]} _ps=$(( ${_psizes[$_i]} / 2 )) _mp=${_mount_points[$_i]} ask "Mount point for ${_pp} (size=${_ps}k)? (or 'none' or 'done')" "$_mp" case $resp in "") ;; none) _mp= ;; done) break ;; /*) set -- $(grep " $resp\$" $FILESYSTEMS) _pp=$1 if [[ -z $_pp ]]; then _j=0 for _pp in ${_partitions[*]} ""; do if [[ $_i -ne $_j ]]; then [[ $resp == ${_mount_points[$_j]} ]] && break fi : $(( _j += 1 )) done fi if [[ -n $_pp ]]; then echo "Invalid response: $_pp is already being mounted at $resp." continue fi _mp=$resp ;; *) echo "Invalid response: mount point must be an absolute path!" continue ;; esac _mount_points[$_i]=$_mp : $(( _i += 1)) [ $_i -ge ${#_partitions[*]} ] && _i=0 done _i=0 for _pp in ${_partitions[*]}; do _mp=${_mount_points[$_i]} [ "$_mp" ] && echo "$_pp $_mp" >>$FILESYSTEMS : $(( _i += 1 )) done done cat << __EOT You have configured the following partitions and mount points: $(<$FILESYSTEMS) The next step creates a filesystem on each partition, ERASING existing data. __EOT ask "Are you really sure that you're ready to proceed?" n case $resp in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac _i=0 unset _partitions _mount_points while read _pp _mp; do newfs -q /dev/r$_pp _partitions[$_i]=$_pp _mount_points[$_i]=$_mp : $(( _i += 1 )) done <$FILESYSTEMS for _mp in `bsort ${_mount_points[*]}`; do _i=0 for _pp in ${_partitions[*]}; do if [ "$_mp" = "${_mount_points[$_i]}" ]; then echo -n "/dev/$_pp $_mp ffs rw" if [[ $_mp == / ]]; then echo " 1 1" else echo -n ",nodev" case $_mp in /sbin|/usr) ;; /usr/bin|/usr/sbin) ;; /usr/libexec|/usr/libexec/*) ;; /usr/local|/usr/local/*) ;; /usr/X11R6|/usr/X11R6/bin) ;; *) echo -n ",nosuid" ;; esac echo " 1 2" fi fi : $(( _i += 1 )) done done >> /tmp/fstab while read _dev; do echo "/dev/$_dev none swap sw 0 0" >>/tmp/fstab done < $SWAPLIST munge_fstab fi mount_fs "-o async" ask_until "\nSystem hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp ( cd /tmp; rm -f host* my* resolv.* dhclient.* ) cat > /tmp/hosts << __EOT ::1 localhost 127.0.0.1 localhost ::1 $(hostname -s) 127.0.0.1 $(hostname -s) __EOT ask "Configure the network?" y case $resp in y*|Y*) donetconfig ;; *) ;; esac _oifs=$IFS IFS= resp= while [ -z "$resp" ]; do askpass "Password for root account? (will not echo)" _password=$resp askpass "Password for root account? (again)" if [ "$_password" != "$resp" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs install_sets while read _dev _mp _fstype _opt _rest; do mount -u -o $_opt $_dev $_mp || exit done < /etc/fstab set_machdep_apertureallowed echo -n "Saving configuration files..." ( cd /var/db [ -f dhclient.leases ] && mv dhclient.leases /mnt/var/db/. ) ( cd /tmp hostname > myname _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr $_hn $_aliases" else echo "$_addr $_hn.$_dn $_hn" fi done < hosts > hosts.new mv hosts.new hosts save_comments hosts save_comments dhclient.conf for _f in fstab kbdtype my* *.conf *.tail host*; do [[ -f $_f ]] && mv $_f /mnt/etc/. done ) _encr=`/mnt/usr/bin/encrypt -b 8 -- "$_password"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd echo -n "done.\nGenerating initial host.random file..." ( cd /mnt/var/db dd if=/mnt/dev/urandom of=host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 host.random >/dev/null 2>&1 ) echo "done." finish_up rpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflate_maskinflate_trees_fixednoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_ureminflate_codes_newxdr_inaddr_encodeinflate_trees_bitsinflateSyncinflate_codesfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypedomainnamelenprom_open.urem.remrpc_pmap_numinflate_blocksxdr_inaddr_decodeobp_recvinflate_blocks_resetdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysinflate_blocks_sync_pointin_cksumgetpropinflate_trees_dynamicinflate_set_dictionaryprom0_xmitkdoprntinflate_codes_freeexit_divesymufs_writegetpropstringstartfile_system_nfsbceaarpwhohasufs_statnetif_closeinflateSetDictionarystrlenopenreadether.umulhdrinflate_blocks_newinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbuffreelistrpc_pmap_putcachefree#!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } trunc() { arg1="$1" arg2="$2" case $3 in l) echo ${arg2#$arg1} ;; r|*) echo ${arg1#$arg2} ;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 RMlist="$RMlist $1$2? r$1$2?" [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 M r$1$2$d c $4 $(($n+$count)) 640 let count=count+1 done MKlist="$MKlist;chown root:operator $1$2? r$1$2?" } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist="rm -f" MKlist=":" mkl() { [ "${mklist[$1]}" ] && { mklist[$1]="${mklist[$1]};mknod -m $1 $2 $3 $4 $5" } || { mklist[$1]="mknod -m $1 $2 $3 $4 $5" modes="$modes $1" } } M() { RMlist="$RMlist $1" mkl ${5-666} $1 $2 $3 $4 mklist="$mklist $1" G=${6:-wheel} [ "$7" ] && { MKlist="$MKlist;chown $7:$G $1" } || { case $G in wheel)g=0;;kmem)g=2;;operator)g=5;;tty)g=4;;dialer)g=117;;_lkm)g=61;; esac [ "${grplist[$g]}" ] && { grplist[$g]="${grplist[$g]} $1" } || { groups="$groups $g" grplist[$g]="chgrp $G $1" } } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std random bpf0 R fd0 sd0 sd1 sd2 rd0 cd0 ;; std) M console c 0 0 600 M tty c 2 0 M mem c 3 0 640 kmem M kmem c 3 1 640 kmem M null c 3 2 M zero c 3 12 M stdin c 24 0 M stdout c 24 1 M stderr c 24 2 M ksyms c 122 0 640 kmem M drum c 7 0 640 kmem M klog c 16 0 600 M eeprom c 3 11 640 kmem M openprom c 70 0 640 kmem ;; systrace) M systrace c 50 0 644 ;; ses*) M ses$U c 124 $U 640 operator ;; fd) RMlist="mkdir -p fd;$RMlist" n=0 while [ $n -lt 64 ];do M fd/$n c 24 $n;n=$(($n+1));done MKlist="$MKlist;chmod 555 fd" ;; xfs*) M xfs$U c 51 $U 600 ;; bpp*) M bpp$U c 104 $U 600 ;; spif*) case $U in 0) offset=0 nam=j;; 1) offset=16 nam=k;; 2) offset=32 nam=l;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 8 ] do name=${nam}`hex $n` M tty$name c 102 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 103 $(($offset+0)) 600 ;; magma*) case $U in 0) offset=0 nam=m;; 1) offset=16 nam=n;; 2) offset=32 nam=o;; *) echo "bad unit for $i: $U"; exit 127;; esac offset=$(($U*64)) n=0 while [ $n -lt 16 ] do name=${nam}`hex $n` M tty$name c 100 $(($offset+$n)) 660 dialer uucp n=$(($n+1)) done M bpp${nam}0 c 101 $(($offset+0)) 600 M bpp${nam}1 c 101 $(($offset+1)) 600 ;; *random) n=0 for pre in " " s u p a do M ${pre}random c 119 $n 644 n=$(($n+1)) done ;; tun*) M tun$U c 111 $U 600 ;; lkm) M lkm c 112 0 640 _lkm ;; pf*) M pf c 59 0 600 ;; bpf*) M bpf$U c 105 $U 600 ;; openprom) M openprom c 70 0 ;; audio*) M sound$U c 69 $U M mixer$U c 69 $(($U+16)) M audio$U c 69 $(($U+128)) M audioctl$U c 69 $(($U+192)) MKlist="$MKlist;[ -e audio ] || ln -s audio$U audio" MKlist="$MKlist;[ -e mixer ] || ln -s mixer$U mixer" MKlist="$MKlist;[ -e sound ] || ln -s sound$U sound" MKlist="$MKlist;[ -e audioctl ] || ln -s audioctl$U audioctl" ;; cua[a-z]) u=${i#cua*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown cua device $i ;; esac M cua$u c 12 $(($n+128)) 660 dialer uucp ;; tty[a-z]) u=${i#tty*} case $u in a) n=0 ;; b) n=1 ;; c) n=2 ;; d) n=3 ;; e) n=4;; f) n=5;; *) echo unknown tty device $i ;; esac M tty$u c 12 $n 660 dialer uucp ;; wsmouse*) M wsmouse$U c 80 $U 600 ;; wsmux|wsmouse|wskbd) M wsmouse c 81 0 600 M wskbd c 81 1 600 ;; wskbd*) M wskbd$U c 79 $U 600 ;; tty[C-F]*) U=${i##tty[C-F]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; esac case $U in [0-9a-f]) M tty$n$U c 78 $(( 16#$U + $m )) 600;; cfg) M tty${n}cfg c 78 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyFcfg ttyF0 ttyF1 ttyF2 ttyF3 ttyF4 ttyF5 R ttyF6 ttyF7 ttyF8 ttyF9 ttyFa ttyFb ttyEcfg ttyE0 ttyE1 R ttyE2 ttyE3 ttyE4 ttyE5 ttyE6 ttyE7 ttyE8 ttyE9 ttyEa ttyEb R ttyDcfg ttyD0 ttyD1 ttyD2 ttyD3 ttyD4 ttyD5 ttyD6 ttyD7 R ttyD8 ttyD9 ttyDa ttyDb ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 R ttyC4 ttyC5 ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A tbl p q r s t u v w x y z P Q R S T name=${tbl[$U]} n=0 while [ $n -lt 16 ] do nam=$name$(hex $n) off=$(($U*16)) M tty$nam c 20 $(($off+$n)) M pty$nam c 21 $(($off+$n)) n=$(($n+1)) done ;; vnd*) dodisk vnd $U 8 110 $U 0 dodisk svnd $U 8 110 $U 128 ;; fd*) typnam=$U${i#fd[01]*} case $typnam in 0|1) typnum=0;; # no type specified, assume A *A) typnum=0; typnam=0;; *B) typnum=1;; *C) typnum=2;; *D) typnum=3;; *E) typnum=4;; *F) typnum=5;; *G) typnum=6;; *H) typnum=7;; *) echo bad type $typnam for $i; exit 1;; esac case $U in 0|1) blk=16; chr=54;; *) echo bad unit $U for $i; exit 1;; esac nam=fd${typnam} n=$(($(($U*128))+$(($typnum*16)))) M ${nam}a b $blk $n 640 operator M ${nam}b b $blk $(($n+1)) 640 operator M ${nam}c b $blk $(($n+2)) 640 operator M r${nam}a c $chr $n 640 operator M r${nam}b c $chr $(($n+1)) 640 operator M r${nam}c c $chr $(($n+2)) 640 operator ;; rd*) dodisk2 rd $U 17 106 $U 0 ;; ss*) M ss$U c 121 $(($U*16)) 640 operator M nss$U c 121 $(($(($U*16))+1)) 640 operator M enss$U c 121 $(($(($U*16))+3)) 640 operator RMlist="$RMlist scan$U" MKlist="$MKlist;umask 77;ln -s ss$U scan$U" ;; uk*) M uk$U c 120 $U 640 operator ;; ch*) M ch$U c 19 $U 660 operator ;; cd*) dodisk2 cd $U 18 58 $U 0 ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 11 $n 660 operator M ${pre}rst$U c 18 $n 660 operator n=$(($n+1)) done ;; local) test -s $T.local && sh $T.local ;; all) R presto0 bpp0 ccd0 ccd1 ccd2 ccd3 vnd0 vnd1 vnd2 vnd3 sd0 R sd1 sd2 sd3 sd4 cd0 cd1 rd0 xy0 xy1 xy2 xy3 tun0 tun1 tun2 R tun3 bpf0 bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 R pty1 pty2 fd1 fd1B fd1C fd1D fd1E fd1F fd1G fd1H fd0 fd0B R fd0C fd0D fd0E fd0F fd0G fd0H xfs0 ss0 ss1 ch0 ses0 cuaa R cuab cuac cuad ttya ttyb ttyc ttyd wscons audio0 uk0 random R lkm pf systrace xd0 xd1 xd2 xd3 raid0 raid1 raid2 raid3 std R st0 st1 fd ;; presto*|xd*|xy*|sd*|raid*|ccd*) case $i in presto*) dodisk presto $U 26 25 $U 0;; xd*) dodisk xd $U 10 42 $U 0;; xy*) dodisk xy $U 3 9 $U 0;; sd*) dodisk sd $U 7 17 $U 0;; raid*) dodisk raid $U 25 123 $U 0;; ccd*) dodisk ccd $U 9 23 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" if [ "$os" = "SunOS" ]; then eo=transform transform() { case $mode in 600) mask=077;; 640) mask=027;; 660) mask=007;; 644) mask=022;; 666) mask=0;; 440) mask=227;; esac echo `echo "$@"|sed \ 's/mknod -m \([0-9]*\) /umask '$mask';mknod /;s/-m [0-9]* //g;\ s/operator/5/g;s/root.kmem/root.2/g;s/root\./root:/g'` } fi list="$RMlist" for mode in $modes; do list="$list;${mklist[$mode]}" done for group in $groups; do list="$list;${grplist[$group]}" done list="$list;$MKlist" if [ "$eo" = "echo" -o "$eo" = "transform" ]; then $eo "$list" else echo "$list" | sh fi  . .. MAKEDEV! fd"presto0a@# rpresto0a@$presto0b@% rpresto0b@&presto0c@' rpresto0c@(presto0d@) rpresto0d@*presto0e@+ rpresto0e@,presto0f@- rpresto0f@.presto0g@/ rpresto0g@0presto0h@1 rpresto0h2presto0i@3 rpresto0i@4presto0j@5 rpresto0j@6presto0k@7 rpresto0k@8presto0l@9 rpresto0l@:presto0m@; rpresto0m@<presto0n@= rpresto0n@>presto0o@? rpresto0o@@presto0p@A rpresto0p@Bccd0anCrccd0aDccd0bnErccd0bFccd0cnGrccd0cHccd0dnIrccd0dJccd0enKrccd0eLccd0fnMrccd0fNccd0gnOrccd0gPccd0hnQrccd0hRccd0inSrccd0iTccd0jnUrccd0jN ss0Vccd0knWrccd0kXccd0lnYrccd0lZccd0mn[rccd0m\ccd0nn]rccd0n^ccd0on_rccd0o`ccd0pnarccd0pbccd1ancrccd1adccd1bnerccd1bfccd1cngrccd1chccd1dnirccd1djccd1enkrccd1elccd1fnmrccd1fnccd1gnorccd1gpccd1hnqrccd1hrccd1insrccd1itccd1jnurccd1jvccd1knwrccd1kxccd1lnyrccd1lzccd1mn{rccd1m|ccd1nn}rccd1n~ccd1onrccd1occd1pnrccd1pccd2anrccd2accd2bnrccd2bccd2cnrccd2cccd2dnrccd2dccd2enrccd2eccd2fnrccd2fccd2gnrccd2gccd2hnrccd2hccd2inrccd2iccd2jnrccd2jccd2knrccd2kccd2lnrccd2lccd2mnrccd2mccd2nnrccd2nccd2onrccd2occd2pnrccd2pccd3anrccd3accd3bnrccd3bccd3cnrccd3cccd3dnrccd3dccd3enrccd3eccd3fnrccd3fccd3gnrccd3gccd3hnrccd3hccd3inrccd3iccd3jnrccd3jccd3knrccd3kccd3lnrccd3lccd3mnrccd3mccd3nnrccd3nccd3onrccd3occd3pnrccd3pvnd0anrvnd0avnd0bnrvnd0bvnd0cnrvnd0cvnd0dnrvnd0dvnd0enrvnd0evnd0fnrvnd0fvnd0gnrvnd0gvnd0hnrvnd0hvnd0inrvnd0ivnd0jnrvnd0jvnd0knrvnd0kvnd0lnrvnd0lvnd0mnrvnd0mvnd0nnrvnd0nvnd0onrvnd0ovnd0pnrvnd0psvnd0arsvnd0asvnd0brsvnd0bsvnd0crsvnd0csvnd0drsvnd0dsvnd0ersvnd0esvnd0frsvnd0fsvnd0grsvnd0gsvnd0hrsvnd0hsvnd0irsvnd0isvnd0jrsvnd0jsvnd0krsvnd0ksvnd0lrsvnd0lsvnd0mrsvnd0msvnd0nrsvnd0nsvnd0orsvnd0osvnd0prsvnd0pvnd1anrvnd1avnd1bnrvnd1bvnd1cnrvnd1cvnd1dn rvnd1d vnd1en rvnd1e vnd1fn rvnd1fvnd1gnrvnd1gvnd1hnrvnd1hvnd1inrvnd1ivnd1jnrvnd1jvnd1knrvnd1kvnd1lnrvnd1lvnd1mnrvnd1mvnd1nnrvnd1nvnd1onrvnd1o vnd1pn!rvnd1p"svnd1a#rsvnd1a$svnd1b%rsvnd1b&svnd1c'rsvnd1c(svnd1d)rsvnd1d*svnd1e+rsvnd1e,svnd1f-rsvnd1f.svnd1g/rsvnd1g0svnd1h1rsvnd1h2svnd1i3rsvnd1i4svnd1j5rsvnd1j6svnd1k7rsvnd1k8svnd1l9rsvnd1l:svnd1m;rsvnd1m<svnd1n=rsvnd1n>svnd1o?rsvnd1o@svnd1pArsvnd1pBvnd2anCrvnd2aDvnd2bnErvnd2bFvnd2cnGrvnd2cHvnd2dnIrvnd2dJvnd2enKrvnd2eLvnd2fnMrvnd2fNvnd2gnOrvnd2gPvnd2hnQrvnd2hRvnd2inSrvnd2iTvnd2jnUrvnd2jVvnd2knWrvnd2kXvnd2lnYrvnd2lZvnd2mn[rvnd2m\vnd2nn]rvnd2n^vnd2on_rvnd2o`vnd2pnarvnd2pbsvnd2acrsvnd2adsvnd2bersvnd2bfsvnd2cgrsvnd2chsvnd2dirsvnd2djsvnd2ekrsvnd2elsvnd2fmrsvnd2fnsvnd2gorsvnd2gpsvnd2hqrsvnd2hrsvnd2isrsvnd2itsvnd2jursvnd2jvsvnd2kwrsvnd2kxsvnd2lyrsvnd2lzsvnd2m{rsvnd2m|svnd2n}rsvnd2n~svnd2orsvnd2osvnd2prsvnd2pvnd3anrvnd3avnd3bnrvnd3bvnd3cnrvnd3cvnd3dnrvnd3dvnd3enrvnd3evnd3fnrvnd3fvnd3gnrvnd3gvnd3hnrvnd3hvnd3inrvnd3ivnd3jnrvnd3jvnd3knrvnd3kvnd3lnrvnd3lvnd3mnrvnd3mvnd3nnrvnd3nvnd3onrvnd3ovnd3pnrvnd3psvnd3arsvnd3asvnd3brsvnd3bsvnd3crsvnd3csvnd3drsvnd3dsvnd3ersvnd3esvnd3frsvnd3fsvnd3grsvnd3gsvnd3hrsvnd3hsvnd3irsvnd3isvnd3jrsvnd3jsvnd3krsvnd3ksvnd3lrsvnd3lsvnd3mrsvnd3msvnd3nrsvnd3nsvnd3orsvnd3osvnd3prsvnd3psd0anrsd0ansd0bnrsd0bnsd0cnrsd0cnsd0dnrsd0dnsd0enrsd0ensd0fnrsd0fnsd0gnrsd0gnsd0hnrsd0hnsd0inrsd0insd0jnrsd0jnsd0knrsd0ksd0lnrsd0lnsd0mnrsd0mnsd0nnrsd0nnsd0onrsd0onsd0pnrsd0pnsd1anrsd1ansd1bnrsd1bnsd1cnrsd1cnsd1dnrsd1dnsd1enrsd1ensd1fnrsd1fnsd1gnrsd1gnsd1hnrsd1hnsd1inrsd1insd1jnrsd1jnsd1knrsd1knsd1lnrsd1lnsd1mnrsd1mnsd1nnrsd1nnsd1onrsd1onsd1pnrsd1pnsd2anrsd2ansd2bnrsd2bnsd2cnrsd2cnsd2dn rsd2dn sd2en rsd2en sd2fn rsd2fnsd2gnrsd2gnsd2hnrsd2hnsd2inrsd2insd2jnrsd2jn (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPsd2knrsd2knsd2lnrsd2lnsd2mnrsd2mnsd2nnrsd2nnsd2onrsd2on sd2pn!rsd2pn"sd3an#rsd3an$sd3bn%rsd3bn&sd3cn'rsd3cn(sd3dn)rsd3dn*sd3en+rsd3en,sd3fn-rsd3fn.sd3gn/rsd3gn0sd3hn1rsd3hn2sd3in3rsd3in4sd3jn5rsd3jn6sd3kn7rsd3kn8sd3ln9rsd3ln:sd3mn;rsd3mn<sd3nn=rsd3nn>sd3on?rsd3on@sd3pnArsd3pnBsd4anCrsd4anDsd4bnErsd4bnFsd4cnGrsd4cnHsd4dnIrsd4dnJsd4enKrsd4enLsd4fnMrsd4fnNsd4gnOrsd4gnPsd4hnQrsd4hnRsd4inSrsd4inTsd4jnUrsd4jnVsd4knWrsd4knXsd4lnYrsd4lnZsd4mn[rsd4mn\sd4nn]rsd4nn^sd4o_rsd4on`sd4pnarsd4pnbcd0ancrcd0andcd0cnercd0cnfcd1angrcd1anhcd1cnircd1cnjrd0ankrrd0anlrd0cnmrrd0cnnxy0anorxy0anpxy0bnqrxy0bnrxy0cnsrxy0cntxy0dnurxy0dnvxy0enwrxy0enxxy0fnyrxy0fnzxy0gn{rxy0gn|xy0hn}rxy0h~xy0inrxy0inxy0jnrxy0jnxy0knrxy0knxy0lnrxy0lnxy0mnrxy0mnxy0nnrxy0nnxy0onrxy0onxy0pnrxy0pnxy1anrxy1anxy1bnrxy1bnxy1cnrxy1cnxy1dnrxy1dnxy1enrxy1enxy1fnrxy1fnxy1gnrxy1gnxy1hnrxy1hnxy1inrxy1inxy1jnrxy1jnxy1knrxy1knxy1lnrxy1lnxy1mnrxy1mnxy1nnrxy1nnxy1onrxy1onxy1pnrxy1pnxy2anrxy2anxy2bnrxy2bnxy2cnrxy2cnxy2dnrxy2dnxy2enrxy2enxy2fnrxy2fnxy2gnrxy2gnxy2hnrxy2hnxy2inrxy2inxy2jnrxy2jnxy2knrxy2knxy2lnrxy2lnxy2mnrxy2mnxy2nnrxy2nnxy2onrxy2onxy2pnrxy2pnxy3anrxy3anxy3bnrxy3bnxy3cnrxy3cnxy3dnrxy3dnxy3enrxy3enxy3fnrxy3fnxy3gnrxy3gnxy3hnrxy3hnxy3inrxy3inxy3jnrxy3jnxy3knrxy3knxy3lnrxy3lnxy3mnrxy3mnxy3nnrxy3nnxy3onrxy3onxy3pnrxy3pnfd1anfd1bnfd1cnrfd1anrfd1bnrfd1cnfd1Banfd1Bbnfd1Bcnrfd1Barfd1Bbrfd1Bcfd1Canfd1Cbnfd1Ccnrfd1Carfd1Cbrfd1Ccfd1Danfd1Dbnfd1Dcnrfd1Darfd1Dbrfd1Dcfd1Eanfd1Ebnfd1Ecn rfd1Ea rfd1Eb rfd1Ec fd1Fan fd1Fbnfd1Fcnrfd1Farfd1Fbrfd1Fcfd1Ganfd1Gbnfd1Gcnrfd1Garfd1Gbrfd1Gcfd1Hanfd1Hbnfd1Hcnrfd1Harfd1Hbrfd1Hcfd0anfd0bn fd0cn!rfd0an"rfd0bn#rfd0cn$fd0Ban%fd0Bbn&fd0Bcn'rfd0Ba(rfd0Bb)rfd0Bc*fd0Can+fd0Cbn,fd0Ccn-rfd0Ca.rfd0Cb/rfd0Cc0fd0Dan1fd0Dbn2fd0Dcn3rfd0Da4rfd0Db5rfd0Dc6fd0Ean7fd0Ebn8fd0Ecn9rfd0Ea:rfd0Eb;rfd0Ec<fd0Fan=fd0Fbn>fd0Fcn?rfd0Fa@rfd0FbArfd0FcBfd0GanCfd0GbnDfd0GcnErfd0GaFrfd0GbGrfd0GcHfd0HanIfd0HbnJfd0HcnKrfd0HaLrfd0HbMrfd0HcOnss0nPenss0nQ ss1Rnss1nSenss1nTses0nU uk0V lkmW memWxd0anXrxd0aYxd0bnZrxd0bn[xd0cn\rxd0cn]xd0dn^rxd0dn_xd0en`rxd0enaxd0fnbrxd0fncxd0gdrxd0gnexd0hnfrxd0hngxd0inhrxd0inixd0jnjrxd0jnkxd0knlrxd0knmxd0lnnrxd0lnoxd0mnprxd0mnqxd0nnrrxd0nnsxd0ontrxd0onuxd0pnvrxd0pnwxd1anxrxd1anyxd1bnzrxd1bn{xd1cn|rxd1cn}xd1dn~rxd1dnxd1enrxd1enxd1fnrxd1fnxd1gnrxd1gnxd1hnrxd1hnxd1inrxd1inxd1jnrxd1jnxd1knrxd1knxd1lnrxd1lnxd1mnrxd1mnxd1nnrxd1nnxd1onrxd1onxd1pnrxd1pnxd2anrxd2axd2bnrxd2bxd2cnrxd2cnxd2dnrxd2dnxd2enrxd2enxd2fnrxd2fnxd2gnrxd2gnxd2hnrxd2hnxd2inrxd2inxd2jnrxd2jnxd2knrxd2knxd2lnrxd2lnxd2mnrxd2mnxd2nnrxd2nnxd2onrxd2onxd2pnrxd2pnxd3anrxd3anxd3bnrxd3bnxd3cnrxd3cnxd3dnrxd3dnxd3enrxd3enxd3fnrxd3fnxd3gnrxd3gnxd3hnrxd3hnxd3inrxd3inxd3jnrxd3jnxd3knrxd3knxd3lnrxd3lnxd3mnrxd3mnxd3nnrxd3nnxd3onrxd3onxd3pnrxd3pnraid0arraid0araid0brraid0braid0crraid0craid0drraid0draid0erraid0eraid0frraid0fraid0grraid0graid0hrraid0hraid0irraid0iraid0jrraid0jraid0krraid0kraid0lrraid0lraid0mrraid0mraid0nrraid0nraid0orraid0oraid0prraid0praid1arraid1araid1brraid1braid1crraid1craid1drraid1draid1erraid1eraid1frraid1fraid1grraid1graid1hrraid1hraid1irraid1i raid1j rraid1j raid1k rraid1k raid1lrraid1lraid1mrraid1mraid1nrraid1nraid1orraid1oraid1prraid1p:" ?倢` E0 :"  aP@=9 $#tC    $#t  9 "x "ax  a@= 0'  9#pa(@= 0  :: 9" #p@=2 0!``"@ a@< 0b@< 㿐!`g? 9ct b  :a? WbP! "a 9#l 4=#!9!耢 #!2$t 9ch7  a'@ 6&$t%t #!cl % 9"% 9h  @ˈ  > @b@ dh@z   $t#!t b@<  b@< ?㿘  >2@ `(=  9#t 4 95#l`21 ! 9#h  @G   !@ 0C 4 2 > 4(>0@ b >0  #h@*   :"  @ * :  /`? @bX@4 0cXb@ #-@Ȁ b   8c   @ c b ?`@ ?`8  @@* ̒"@# ǒ"!?#X @$ b  "`+" @a $b "`  8#   @ # b ?`@ ?`8  b    :" @ "bX"`"X@# @1 " f"`b :"  `?R"`0U   ? @ؐ @ "@*"  @L ?b  ':"  @4QP0 @; 6@4@)0"@Ր@d@(" "` :"  `?"`@* "@@e $"@ " @͛ @-c@2a @="㿐 :!` ? ' 5- :3 "g?  @ `T  E @3bآ b@䀥 b $€ %` ``8 ( ` " !c(@3  " @Ι ѐ` `8   0bK ?c@3m ?bX  "bX㿘 :!"`  : *` * & 6@ p?@ :* @*`@"@ܒd b " 9 :7 U@y O"  ! L? @3X @v 4 : a@  :  :a"@*` *  . `@  2 ! ? @2X  b @""@Š" c@2ِ ?㿘bx " "b :!`&"x"x? c  !`(   "" ``  @2?0bP 9""b`  " " ?"x  @8p"b#" 㿘 :!b"""x? ` ` "@2p?0bP  W ?b`"  #":#b ? 9 ""`"c㿘"`a x  "` 9"x "c` 9"# L s " " c  @ :; F@D@ז  @c :@ DȒ E@d ("`%"c@$@ %"'` -" $"  : c $%"c$@ %"b@cb  %`;b8p   : "a aH @1?㿘 9#`L  :!`a@1 C? ! 7? ;  "B@ ""8"b(   :!# 9  : "c    a@1p 0| "X ?㿘b" "b@&㿐  p?b " :   2 @"  "@fU%""` :`@ @S@  :?@ f @ B D (8. ""@:`   ` @b:   2@""  d%"b" 㿘#bb !" "@̒ " 9c@_$b㿘`$" '#% 9b"@  @@N @?b@}b&@@$b` 㿘`$'#b"@  @ &@ b@Sb&@$b 㿘' ""   9@c &!?< 2 @ @ @ < f $ ` 8 H@' ""   9@c &G>: 2 @  @ߐ  @ :d $ 4`8  :"   a@0 !>@  :"  @0 >?8 b8@/ > ( H@  '" ,@m  :؀ 2   N>" h @/  >'/0- :2 @   #\@, "쀢` :"   #" : $  @ d ` "@%@ Ē   H`4   `@[ 4 ` " ?"쀢`2   @b @/H  (HP  * 2`  *` '     "2  @   @ :؀ 2  '" h @/?'#' 9b@E #\@  <@ Eb@㈠ 怦!:   @/ 0 H    @   b @.֖ @m   8:  @.   c( @.   H`  `@ 㿘 9c  )  $% # ! 9   :b#  "b? b> B@""8"b㿘"h"h ` 4+  1%"p"p"h  "h'% @3' 9cP@.P >   9   =bpi"#"   "b@=bp] && %' 9  =bp M "b&& ㈢@ `bp <`B=bp "@㈐ &"b$  ""bp@ <`C &!=bp@$" :a @$"@ݒ  "b?㿘! 9#  1 9# 2?!=@o  $#  # &#c@- ?㿘! 9#  1 9# 2? @R  $#  # &#`@- ?㿘! 9#  1 9# 2?!=@5  $#  # &#`8@- ?㿘! 9#  1 9# 2?!=@  $#  # &#`p@-i ?㿘 9#` >1!=@#* @ "! 9`$! 9 $2 ! 9`28 `2'13 #  @ #`$# @)? (@   & & $@! `21 2& $  @  &㿘 9#`J >1 @Y#* @ "! 9`$! 9 $2 ! 9`28 `2'13 #  @ #`$# @( (@Ɛ   & & $@ɒ `21 2& $  @N  &㿘@% "[?N V 9c   &N?@&x!=㤑* @ # 9  @ؒ  # 9 7?! $c  @W c`$c  @&S!=@( (㤡, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@Đ "[?N V 9c   &N?@& 㨑* @ # 9  @w  # 9 7?! $c  @[ c`$c  @% @(" (㨡, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@!4㿘`@.   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@ ؐ ? % f!?#`' @+ '  '`,7@` :a0@ @!㿘la@+I ? 2 L 2N   aH@+4 ?㿘 H   @   4!  H H@ @+ap? H,  k @"&, a,@ N,  a@* ?㿘`K a@l   ?㿘 L h! x   :` @   & `  @  & ` @   6` @   $& ` @   (& `$ @   "6 `* @   ,& `0 @ ߔ  @&  H 8&  0& `A@@ : `;@ Δ ` &L < (  @ &,., Y ?  W㿘@" @ f!c'@"T ư?``x   :`,& ",    A4  #`H  A @3  `a A @   !ǒ @   ~#`   @   t`   @   k`    @ z  b`$   @ q  Y`(   @ h  P`"   $@ _  G`,   *@ V  >`8   0@ M  5 ; @ E  - L  `  ``b     2 ,, 6 `b0@)  ? bX@)  ! @"㿘`m b@j   ?㿘`m b@j   ?㿘 @"b㿘"쀢` n Ӓ n #`x  :` @  `& ` @  ` 6` @ } `$& ` @ w `(& `. @ q `@& `8& `0& `6 @ Ӓ `H:`& @ ` `"6 `> @ Z `F @ U !?# @ `*  * `& `N @ E `V @ @  @ `*  , `,& `f @ 2 `&`^ @ ,  ??& 8 n ` "  .< (  @   @  b  `:&,.,    @  b m ` ?  |㿘 @ D"b  f!Ԭ'?@ ? #?` ``,&"쀢`!’ @   `   ! @     @   ` "(`x  (x% #x#`H   `  b `x ;@ 6 @ C  `Òb,   ;x   ;@ 6 @   %   @       @   $   @   (   @   8   .@ x  "   &@ o  v `  >@ e  l'? @ `2 @ F @ X  _, `  N@ N  U V  2  @ B  I ^ @ :  A n     n  $ =  "b    # 2! ,Ր, & , $   6 b@'  ? c @'   @Ր#P` (:`((!Dž0: 2`(0 ?    ?㿘ڒ  " ! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``, 3`8`@`0& B&?&E :  8 3` < @ (@ `H   &,.,   `  b`x ;;   @  b  ` ?}  &p f!?c'@. !D?  ?  ,& Ѐ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) c`, x; ;  , ;  `***   : .`.`.`.` )x   =(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8 ::: *`@ `**`@ (`(`(`J(`<  *` @ (` ?(`v  p       "c    $ 2" ,Q,   , "   6  c@%   ? c@%   @P fgghggghhh㿘%   c*`.@4` 6*@Y !?": b  ( $ @y  X@$  ?&@ѕ4 &㿘`@ @  :" p @$͖ "`  ( $ @ b  ``  36   @  :"` :"` 08  @a 8, @'  :"  @$ ?<   @B `@$K ?㿘`    @+  8 @ "`  2    `@$   8@̒ >%:"`2Q @@`@ a@# @?<   @Ґ %: :@ %:+ :" @@$ "?X@# ?#   ` @w`   @ے b 0  faԬ  '   ` Z!\*` €"  @# +?"@}Ԑ!x ,"耢`, @f#?":,@7 < ( ,2`@U 2' &,*  2`@5,2`@ a, @K a@#E ?$:!"   @ ``"`  $ ( @ڐ @#J ?"`` $( @_ ( @1 `tb  "  36 "  @c%`J) :"@}&"( B@s  *"@ :"  0@" *`2`@>0  c@9a"  6@, @ ) :  "  :"` "@ @ݖ " 2 :"`"  08 @}   @ݐ"P8@< !"`2&?<  @S 6 `: "  `@% :  " @"~ ?8L /? " /"` @i@Ԓ  6,@ 2 , c@a$@i , @z  / ,@ܒ @! ,?8 9#"#%$ 3 :b  :"`c@ :b  :$c :"` c $ "  @"c@ܐ :" @" 㿘@k 6 "3:@|"耢 b  "` b @ 2 ?b @!ߐ ?㿘@ 6 "3:@{"耢 b  "` b @ 2 ?b @! ?㿘o@( :" @! 㿘\g':-+ 2 '&@"&`&& N    L "  2'<`  @#  0 '8+!" cH@ @=` $"c@!* ?@"*@@X  @!A ?2&㿘??@    9:" @!& 0c@0  :" @! 㿘@ @!?&@"`  0   8 Ɩ ?c0 f!Ԭ'  `  &a  X 8?# :D @ 6  `@ @@]  ! H      c%? @,   :" ؐ 8   c@ { ?  @R   :" @  ? &  @ 8y`xy`yy`xy,y`y`yHyHy`y`㿘"  "b$  "$"`$ "$"䀢`$ @"$ 9#܀`@8, "b(`@ $ ?@  ?"` @? 6 㿘 N `@  `@ ?@l?`$ 9N /".  9c$$  $ $  9c " "c 9"#"cܰ 㿘 9#䀢` "`"Ā` "b0"` `  9#耢 9cؒ @ 㿘"` @6 9#܀ )' e%  4   2 `2 @  @ ( 2 㿘 9#؀ - 9@k$!#:)+'܀`  9"(@$, /5?#䀢 "&# &#*?#` "@@b̀ #b a0@ ?@@ #Xb  @{?0 $"(("$@s $ذ 㿐b0 % 9"b0  % 9# 9@V؀  $c а? 8?` 5#ȓ*` €"`c @ @ c `0c ap@ 0c  c @% 0c  ., cx   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NOc耢cK -0 H?c耢7:c" 2&  8 0@/ (c$ " @ & : & , @a, 6 ,c:  @ 09&,  & c @r,c&` & 㿘"`)"% e'`? $`@  $ *`@@; = :, *`,? ! e@rܔ" *@v  2%, `  2,0  e"`? &`@Ԑ  $@2`b0@  (b f!Ԫ'  "`" @U@?`&@ * &@Oc@͐aԐ `@S "Ԁ2  ` ;!@@""@Z` @Ӓ @ /` C ` `  #h #`#db#\ @ ` ? ?` 2   `b@`0b@@U`&@  * &@N @u ?` @T", @h  2 @T", @\?`&@ * &@N͒@7a @"8b f!Ԧ'  8;a @nn 4""%8@Y@0 @ "/  @"@Җ  @N#㿐@V` N N N @ڐ@T N 2N0@Tx   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0(2   0(2    0( :( ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? 㿘"4: "b`4`I?"4J@ - ` b8 *b8 "aJ"8`@34 . :  "4"4'?@s  :2J @ e#cP :2.  `ᘀ  e@#ch@  ?*@$"ᘱ. > @Lt$<<<<<<<<<<<<<<<<<<<(H<<<`<<x<<<<< <<<<<<Th<|<<<<<0HT<$hh0<hHThhhhhhhhhpThhhhhxhhhhhhhhhhhhhhhhhhhh(hhhhhxh$4hH  (<<<<<<<<<<HTd<|<P<<<<<<<D<<<<<<<<<<<<xD<<<<D<<D $,<<<<㿘@@ /`""`@$""@t#Ѐ @0"@t#耢 @P0#$"@P  5Y- :`JT#*` €O#:b@!$"x`Gb`0@; @? "b9 "b4:""bP. "b)  "b$@ "b "b:b@| 0:"-* : `#h*` € :""  : :""""#" :""  "b  "bL`H@ߐ @1 L  ݤۤ:@b Ӥ ""ͤ  ""Ǥ   "" @!:"# :'`"< @9 H : "a"``@  e  x@Q9c` '+@#@  `H#@Q*`0P "bT!:@>":hh h"  bh`@q @bh a `Ȑ @e"@g ""a !:" @s  9?T"c@O" 9 N"c`@C 0:@ Mb A "";   ""5  1"bH@"", :@ b $:@ b  ""  ""  ""   "" @O@ D??B   esې#H :"b !%qȐ   @@  !  @  ! " % @@@  ` :! :"a`A#T*` €! `! `!7! *@#@ !@! $!0& `!@a @ @?. @"b! 9! *p@ !@! $! 9"#㿐 : ""'    ) :7; :`J ԓ*` €#:b@!` $"xb`0@N @"x* $"x %! 9"#: bJ@ -2 J` ""P '""P' :}""@!p w @s  "bm" i"bĐ f%!:@b a@]Z%!b U"b Q"bВ  :""L%!0 :"D"bL @"b@Q-`  : @a@ :bL,"?'"? #"b!'" "b!"bT! ! !!"""bP@aߔH?I? `!& *` @! 2 e e# e#H'b !?  !?@X !?   : :!8 "a :! "ab @w @&!   y -;97U5` 7@q"h ) e"@mp ! x@O@ !@ʒ  @@o "h@q "<@6"< #b@0 @@@qmb 2 @`@ (`%L `L@` 6 @@ "@@qHb`  `@ 2L`""L"L p+ 9  k+ 9@h` D Ғ  !@!@q"h  e"bp@m% !bx @Ŕ@t ! @k@ "h@p "<@"< (b@ @U!@@pb 2@`@ ".%c`  @?  {` @5@ @@pb`  `@ %c !"P "J @t" $"PJ !$"P8"Ƞ%+:@@mL `?,@l b @! @+ ?<  А @H  ?` /,`ϐ P ! : :?#$" ""b#b"#"P     /9 ``D"*` € "b : `&" "b %a "b & :   :"a%a %a "b e#H :"b %a& "bw  ~%az"bx:@Kwbt"bx!:"@lbp  %"bx@ @[%@ @Ő @<`V"b@ @FO:bJ - J "B%P"?%P!:"# :'`"< @ H : 0"a"c@d  e #@Lc` %)@@Œ  `H@L @  "b! "bT :  :"a@@ ؀?@?!a* `G@"*` €@ ? @` 6@@@ 2@01@  a @ @@"b܀ `@@  9@ 9"#%! e @"" <  c8@ @@㿘"! ecX@L#   9#J 6 c@A#@ 2@ #`?"`# * $#@FR 㿘@n@ :   㿘 : `c@ ! e1#@ # 2@ 㿘 N  c@eː a@ :?ca@z @0?L , ' :@lT , 2,@@lN = @o 䀤`."@ "`"` ` : ""  $L ې 㿐 @>  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @~ @  㿐@iג  2  J?` '@  @@* "b<  㿘! e#@KG##@KC %#@K?@##@K;``#@K7 #@K3 #@K/ #@K+ #@K'!``@K$##@K !8#@K!H#@K!x#@K!#@K!Ȓ#@K @##@K a#@K"#@K"(#@J"P#@J"x#@Ja"@J#@ 㿘! e#@J"#@J#@ 㿘! e#@Jސ#P#@Jڐ##@J֐##@JҐ  `@JΒ#@ 㻐 f!Ԩ' "N ` `L@` `\*`: @2``ga@  a @ t?,@@X @$aX@ @)^?`,@ J \2N22 *@M @*a$ $J + !*:  P" g G" 0  p"0 $ $@% @,@!@ ?J   :a $ :"!"a  :a " "a! @ܐ!㿘 N  a@  a@n ?$@$  :$ $ `$ $  :a " "a :"!" 㿘 :!耤  )' e%  2 `2 @B" @0  2 㿘 :!耢`  "Ā`   \$  W "`22! 2 *`2)!耢2*@cN   $b8@  ` /*@6$  ` /*@$ @h?$ J / * $ $ & !       2    @" &bX@ʐ ?㿘 :a  &"Ā`/"`4?2   #@.         J@ /2 @R 2  bb`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ "`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  㿘 :"`! N  /N    . .  @`@&   $bx@ݐ  ) :N, /% : ` :N, 2,  . ., , @6@ѐ,&, 4  : $bx@  :!` ,@Ԗ  *     , ,,@Ö "Ѐ`@     ,, @,㳈 fa "'@H"-+)'#!>@=@;c @9#H@H, 6@jX @,c`0@Ɛ,O@$#0〢  .@#  O逢 @# #@  @Q@d,&` ? @z 㿘 @ ? ` ,, @ ? 㿘N@`/ "@l$&@` @ ?  ?*@  * . ?*@ .   f! :%?a''L@dZ, F D@3  @x 3   ,@` @* @#@p  %?W`@@ Z L@ @"@  L    ʐ    2ª  ?@0,@` @@L  @,@L  $``@a % O  O耢   e#`@ O#`@O耢  @cҔL"@  f! @ 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @::&* &p 0`㿘 @|!h  "b:"  @pe"@! L@ !@5 ' %J?`/"?@   $a@ A⼀ ؒ@r" /* "@N &+@@ % :!`!*` €m"T`a@D 5 ⼁㿘 "b "a@_ 0b @Z 9@"`@@ h @   ?@ @ߒ   ?@ @Ԓ   ?@ @ɒ 2?@ݐ @4"@   "@   ?؄ؔ""  '''@S   Ȁ    @H Z: @A  Ȁ    @6 H: @/  Ȁ    @$ 6: @  Ȁ    @ $: @   Ȁ    @ : 'ؐ @ @    :" h@  ?ɬp0ȼx㿘 :"` :@s 2  :"` :@ې 2   :"`" @   㿘 "S?N # :b   !=@  $b8bN # \N  #" @n 2 c@ = ,?  @g @!=@܋b, @ " 2@ ,  bc @  ?, "  "" 㿘 $!=@b :b* `"  @ 2` `2@ 㿘 "S?N # :b   !=@  $b8cHN # \N  #" @w 2 c@ ː ,?  @g @!=@b, @ " 2@  bc@  ?, "  "" 㿘 (!=@ :b* `"  @ 2` `2@ 㿘  N c@栒 / "N,@`N & ?А , *: * :  .2c耤 2c @ N J 2 @Q  `` L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ `@@  S`L@  @@]^ N$`$ @ 6  `h $ ( :L $@~  6   `@ @&$  $  @ `@ ֐ @? :b $  :"""b   :b " "b`@  ? :`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@N`   e!DJ?   ` 2 .2? 2? J 뀢?@H(  @ 2?L?Г* @L *`В@ `=r$@$@` k"*` €N Б* N * ?Д * *  * 8$` "NNБ*` N * `?А @$` ?Г* @N *`А@$` D  d$`N?Г* @N *`А@$` ,  )?$`N?Г* @N *`В@$` ` `""?N?Г* @N *`В@`$`  N?Г* @N *`В@ `;$` ?@K&@?? 㿘1 :" 2 )@Y  &"  aP@  ?㿘 :" `m%`"`b )@b -  5      @ 2  @ 2  ,@_, ` &,  &  ? $  $@@$ @d  @[  $``$  `"$  - b  $ @ $  "@ @}a@ 9 ?㿘! :" 8#`"`3` / - +`@z)" *  "  2  `   @ 2  @ 2   #@<@:㿘 :b    *@  "@`@%@#`2 㿘1 :"$ 1A !G@r  &"$a@ Ȑ 5?"! !1* * * * * * * * * * * * * * @}" : "b8"@b 0 :" "ؔ@  ?㳈 f! :b$ ' 2  1@WG$- @`;+:-@2&``! :"8  @I ` ` "8b @  [?@E@Jb ```2@`  8`  ?$`= @H  .! :"8  @  <`"8@f: 8- $ $`$@ $`" " 8:" X@ >  `:"  bx@  `?@D?a @T"㿘1 :"( 2 "@  &"( b@ ?㿘 :"(`b@ڐ I @"b(, @`0` `@@c  2```@c + @`@Y &`c@ @Y &@@Y  &`b(,   &` " @@@֐c8@ ?㿘! :"( @@_""(* @ @b 2  @] &@ 2㿘1 :", 2 !=@   &", c`@] ?㿘` @  ? 㿘 :",`-!=@ןb,, @` `2` " @8  b,, ""  "" c@  㿘 :", ` }  @ 2  " *     +2$`& `W& `R   B`25 :"5 :@ 9"" "$ 5 :<  &<<z  < @!q  c  &<b< @  b<"" "$  &   &c @ c@  㿘1 :"0 2 !=@/  &"0 `(@ ?㿘 :b0   0*@    ^   2<0㿘 :"0`6!=@ֵ0,`@     2  2  @N  @X  $0,`$ $ $ $  $ " @n``@* 㿘! :"0 &!=@z"0*      "  2  2     "@ & &@A@?0?㿘! :"4?2 "! !1* * * * * * * * * * * * * * @z"؀  $"4"`@ʐ ?"@؋ x :"4 /  @  ?`Д@ 0"`' "47'' @'؀ "4@Ԕ b@ "b@a@ h f :Ԩ "4'Q 9'@3 >Ж "4 @S 6"4 @$Ȁ .Ж "4 @C &"`䀢  :ϐ :"` :"`ܐ: @ "4??@  "4@x"4@? $"4aH@3 ! @!㿐`@  @6` `   *  `'  * @Up$$8DD000㿘 $ $ @ J@" ?   " @   (  ((( ( 0(2    0( :( ?   @    *  *** * + 3` ` 03 *   0*:* ?  !    㿘a$?N aА!@E     Ւ"? "bH ?㿘-)'+/$%@_ ! @_ 耢   : a@   !a? P @  ? %D ۢ!ذ 㿘" ڰ?!"   " 6 & ` &   @Y,&@"$" @Y,&`d 稔 ! / 6`l 研  $& `t 皔  (&  `|  H :  獐` @&     ; 8& 0&  x:N` `2 `K`0"T.,  P., "& `L`5"=G., " N`C.,   & `,@XĐ,  ( &  " 6 `,@X,  @ 6U&, & N` K  & H @ "@ b   x a:  ;@  & 6 " 6 ., -&,&,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& 㾈  fԒ ` '-!L*` €"D`$%°  bx b b b, d, c%   c c0 !@6  d@X x :?, /,  2  1,, @W d d   c!H ,d  VcP" @  b a:!   `d < $  `l 3 (  `t * 8  `  !!`   7!  ҂  ?       cp@  a @:#㿘> ?V  ?㿘 ?  ?㿘a$?N aА!@Cǔ  2?  ۔ "? ?㿘ߒ"  ?   " 6 & & &NaY   aY@W, /, #b` ,"@W &@b$b" @W&`d 嘔 ! / 6 `|   H 8  剐` @&  8&  0&  (.aHa) 6 $`t w & $.a(a Ւ  `l j &  x  ;@ 8 ,& ., &,N``L!t*` €  @ 6 &     "  &6  6 L /2 &,N` 4 `  ` `  ` & 6 aI   aQ ?c , *`  ,V&N` 2 `  (` &  6 `   `"` &  6 6 `, @VX,8&,N` K  H@" a  bx& 8 :&,., `H@`  a"@   b  6` `x& ` a: : 㽘 f !Ԁ`'`c``   , c, cȤ @ c !@'x    :,Q@U  /, @Uܔ d ?` E*`" € 53,` ` 4 3,` , ` aI  ? @ `2 @aQ     6,` ` 1 2,`,  d@U` `|   % `  0 7,`! H @" a  b  x ;@`|    b`aД @ a`( @a!   `d\  J $`l S  A (`t J  8 8  `A  2/H  @a ә  @a)!` )  ɒ!    ?       `0@|  a @̐ X`c` ?J/2 J"`4 ` 㿘 @nh  @sŒ`! :  $"@`@s :  "bD@k;"@@w"Ѐ` `Ȕ`@0 ?㿘! :"@'H'L'P'T'X H@wE@"@㿘`  :"D@T’ 2. ?@W 2* 㿘'P'L'T'X L "b"` 5 e1"  :@b @ &""`@sP@w@ 㿘'T'P'X P "b"` 7 e1"  :@b @q &""`@s'㠒@vڐ㠀` @G\`@s㠒@Y 㿘@[<Td,XhL 0@P`p|0p f!Ԓ  '//'  @  /'|"a`@ @˴ @#:@%@q+ : :b 'd/; :9 :'p'l'h't'x 3* @€b @W   "ba @qm  $/$ @$@  !!H@F @qV  e`$H@Ӓ b@4ڒ @6b 2 baP@q>  / , , ,"$b@  =c` bap@q  c@D  c@FN a@q  `)=c }$ / x% @) " b@F3 aH@p  @V gba@p  ]$b@:$V Q$ M$ I$b @V` 'bba@p ?#@9ba@p  $b@X )'|bb@p  $b@V8 /bb@p !$b @V(  :  "bbH@p @r@_?? `a* & @ @acD `L"`L""’    H`D" @@ *-`@3 #`@A 2 b`@pI -` @ @Rb!"   bbx@p4 ` "` @' b@   b @-`@ @i?c ""H`< 8   % #` `+` *" "" @4  b@H 䀊 @?c @n 䀊 ?c @n  䀊 <` 8   % $ d $ db@o $  @m  H<* @ *@@ |"`H`H, `4 4 4  `, $ , $ 䀊 <` 8  b@o   '/// d @m ( 6 @L+#0@ؐ    @m   cH@ǐ    @m   ch@    @m   c@  '!?##`@Ș c@햐 @'?#`@mc  '?c@텐 ! ##0< '#0c@z  #0@mK  #0?@4 `@ ` `p@>`'0`@vbP`@obŒ @ `@ !@ @2䀊 2@a  4`*`@s  b@, #'䀊  @ ''@ 2 * +  & l  @  ' h@j]t  x:b @KJh'@ϐ h@ @ǔ ``쀢 @R@I @ې 㿘:" @8`@ a!@  `L @l $  쀢`  : @d `"  :#Œb @^ @$ 㿘!:"  @Ւ $" ?c f!+ :b' --  :" 5 a`!J*5  `5 @4`: @4`   *@* %,!?# @~|#' ##' #b#* #* #*  #* #*  *  ** :" @d`  5 ¨ H 5 @W5 a! @)  䀤@J{ ?#`@qP@@ӄ    :b @z Ԑ @ %@ x @~ `-  @  䀊a@<' @40&@  H@ a   V"  / / / / / / //?" "@ ''Вb@ ?? :*`" * "* *  :@B: @e : :c( # #B;c( :( :8 :# #1 : ":1 :" `@: M@ <    `?"' @: "@   *@ -  䀊`g` :b @Ҷ v@b7 8b@3L -"  @  @ܐbDL "  @ϐ  @ːbD  @b "  @`@ b X`@Fx bD`@a`  ::b 1H  :`0@✐  :c䀢 X` @FZ bD` @a` `@@≐ @ 㿘# :c?!@}"D @ $"D?$c$c㿘 :c"D !0`X@b !@a 6V @ `!?"bPbD!@aq 6 @q p""""bD0a~@aa 6 """" 㿐@J7   `@+ ` "X `@2c  2q@`@Eߔ - ` `  А @!  `"""$ $ $ $ $ $ $ ` @EĐ`  @ @` ` ` &C@` @ < " ` `@K\ 25@` ``"@`"*@"@  ` T   @ ` bT bT` T   2 $ @  $ 2` ` ` " @` @K􀤠  e#`@dBX@ 㿘< "H` :"<"#"""@8  2`P# fa  @????'S  ''@4 " @`@c   @&  @`@b  ` ` " `@b !`!ؒa@b  "@/bX @D@3@.bD @`HaJ @I! @&#@&!a @!0㿘bD aI@`-䀢 @.!@㿘"@` € 㿘"@` € 㿘@ 8 L  :"L""c㿘"<`!"H  `6$"H"@` ` @Ґ `$"H  :"""""㿘@ސ!P㿘"@ b< #b<p f!Ԧ'"@~ bD 0a@_ ``@ bX @D[W`""P @@"PP  7Da@_ a@z  @!` ld dld d㿘!(@ 㿘! @㿐@@֐ @I֔ @a@a "@R`a@aې a @I "l@" p " h@Ia( "l@" t" l㿐"@R`  a@a " !`@  a@a @H `@ )'?%?   `2 @Ih"X 2 ` 2` 2 b@a $` @IM$` 㿐!bX' @C" @IV"䀢`"J@ "b(@aa bD @^ْa @ڐ"@㿐!bX' @Cq" @I1"䀢`"J@ "bP@a< bD @^a @ߵ"`㿘N 0   ` b X*`@ R``x" 2 # es) b aD@  `D " aD@  `D "p@ߥi  "@ߙ"] 4 aD@  ` " Ѐ  X*  R ?*  aD@  `  А  X*  R ?+ N \2 `" N @F% 2 ,  N` `@F  $ 6&"@ &㿘 `  0 e ` b X*`@ R``x# e !D?  ` 2    ? J    ` 2""Ȓ@Ŕ0@"Р  #@bؠ &` f!Ԕ ''ĐȒ Ā !/bX @BH"bD"0$ a@] a@ޙ"a @}" f!Ԕ ''̀''e #@0 '̐!'Ȕ?"? 6"P #@0  2NȰ !'N?  eaD   ` ) N  :% *: ?'̰  )t Բx't# ;t`$$? `` @V# -aԠx't tt "t''Т ` ԑ,`@""@```bX @AbD @]a耢?a@#@a @}a#Px f!Ԡ'bX @A#bD0a@\?bD@#` 'a@\Ԕ?@Ԑ#p @}3#x f!Ԡ'bX @A`#bD0a@\?@ݴ#`@"'bD a@\?@ݤ#p @}# f!'"$  bX $ $ $ $ $ $ @A%bD 0a@\w 2 ! e#H@$"#bɒ#H`?"`#H * $#H@   ???????bX @@"D0a@\K x  e cH@## 8  " " `? "D0a@\+?@"#r      , `"  $   e!D `     :"    #@/   @#Ƞ / H` ,?"``H* $H@z ,@`@#HH  ݢ`H`?"`H * $H@[   ??x?bX @@R"D0a@[  ecH@#Q#`@#@# @{ h"8 fԢ `'%H  ?????bX @@bD0 @[ja6  :" ``@> " HH a`(X@]Ր  @{ @㿘"8`"h#`H`Ȑ * !$`HbX @?ې"`H"bD$ 0a5@[+ `X@ 㿘"8  `h@] %`@] H `4`@,`$H㿘|"8  `@]} `@]w `H@ "bh㿘b"8  a @]c aP@]] `H@r "`ȁ㿘H"8  a@]I 'a@]C H?# @ ` `@ `aؔ@]2 *` $H` @2```2@ t`"  @2` 2```2@!㿘"t@<? ǐa @\ 㿘@;  a@@: ##,@2 ?!!H@\ʐ # @ @X c @掐㿘  "?` 2   @-6 2   2?㿘` q@!h"!x!x @pc,` 16 %? #-+)@`2` @  2`  paa@p #a@`@ @ `` 2@6 `@ǐ!p f!Ԫ'!// "@bX @>\bD0@YaK , @~ !#\! @ `! @h!#\ @ !@a @y!h f! 'bX@j"R"@"`@\#("䀢`@U#8 e cH`?"`H * $H@ `` `  ` @j@@2#H@ 6'#0   ?????"X @=̐Da6@Y! 耢 #X@E"X퀦 @3*  Dcp@ a6@Y'쀢 6cx@ @#ؒ  ؀@;H`?"``H * $H@ H`?"``H (* $H@z (  H`?"``H )* $H@d )H`?"`H * $H@V  U-@# @ 7   ' )*! @2 @2 ap㨘  ` ` @u  ؔ*@`2і H@c#H`?"`H * $H@ L )   ` -+) @ 2耤@= @:c@  @4# ``$ݠ @ "@  @ 0"T`"T"  ,  € $ 2 H  @xs#x f!Բ 'WbD   :" `+a`X@ΐ #! "X@<bbb' '' '@)'@ϐ"X @@!09  "2@7[ @!H &@"!`@!X@ې!h@ؐ!p &@"!`@ʐ!X@Ő!h@# @v*!㿘 Ё㿀 f!Ԫ'  bD   :" `+a`X@ր """ bX $ $ $ $ $ $ $ @:6D0a!@U "X:" 1 /2  ^ $ " " " @|!"X @:b  ?? ` ` ! @_ bP # D0a"@UXb䀢 b:" `1&"$ $ $ @O b"X@9 " " !@9 P   e"  !@-  eH`?"`H * "H@Ȑ a @u!㿈o bD   :" `+`X@ """ bX $ $ $ $ $ $ $ @9D0a!@T 6!:" 1 /2  a $ " " " @!! "X@9~b" 7 7 7 7 7 @7@"bP ,D0a"@Tb䀢 "X:" `12&"$ $ $ @ձ "X @9Nb" 7 7 7 7 7 @7@  eH`?"`H * "H@, 㿘 :#"#ؐ "D` :" `+`X@P """ """ """"bX@  2"X bD   :" `+`X@- """ bX $ $ $ $ $ $ $ @8D0a!@T7 6!:" 1 /2   $ " " " @)!! "X@8Đb" / / / / / / / / / / / @/@"bP 8D0a"@Sb䀢 "X:" `12&"$ $ $ @ "X @8b" / / / / / / / / / / / @P/@  '` '' `''̐ ''` !7'ܔ''''` 1 e " ``` "`@2```@" #H`?"`#H * &#H@& ` f!Ԭ'ѐ bD   :" `+`X@H    bX?????? @8"D0 a!@ST :" 1 /2  f????@F"0 bX@7@l@2@"D0 a%@S0 :" `1   ??? ?@%"P @k@"h"P`!"D0 a"@S bX:" `12   ????@"xbX @7@kא@  eH`?"`H * "H@  @sI"㿐 :#.`  `, ,  @ޒ @: @s 0@gĐ  #@`  @i$ b@U/ 㿘 :#.`  @:   b@U `, ,     @~[ 0$  * "@  * *㿘  N 2 , .`"@d2, "@]2r e cH`?"``cH <* &cH@ * &cH@ >p ; .`  ?ؐ ??? ''a`@{Ԁ  @vb@TO ` "`b@TF  @r`? @?@  `  ` `&`6` @ԁ㿘 ; .`  @9  b@T `, ,    @}[ 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  㿐 "*"`, b@S b@ ` ?#@  b@S 4 , 㿐 {77c@  @ c@Su "2 2 㿘c0@;@  *bc8@;6  *bc@@SV 㿘# b b ,b  2  4 4   #X  @ b   8  c@S1 b6  6  6 㿈 ; .`   ,, #@@l 耦`4 4 4 4 4 4 @#㿈 ; ,.`   , ,#@@  :, 逦`, , , , , , , , , , , 4 @Q#؁㿘 ;.` < @h @q' `  ,,  , ,㿘@"`㿘@  : "c`@R "@ R  `(@R   :* 㿘! ; < <  㿘 e`P@S#@y x f!Ԡ' @pbD0a: @O"?耢`؀ " aԀ #8@ِ#a @pA#@x' fԐ'@#,2  ; ; "L"P@pk "bD0& a:@O?bDcP@А  7a9@O?c`@Є  @p #px ; P' fԀ`'c@R @p7 "%D0a:$`@O?cP@[  @4 ;`ND7 a9@Op?c`@I  @oϐ#x' fԠ'@p "%D0a:$`@OO? cP@( @oD a9@O@7耢?c`@  @o#㿘!!P@U:!㿘@ה㿘 D@9s`D㿘 D@9m`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ ~T,,,,,,,,,,,,,,,<,~h,,,,,,, ,,,,,,,,,,,,,,,,,8,~L,`4p,~~~,,~㿈'H@n  !'@R # @ ;"a8`h @MӔ ` ;"!8 "#\"07 "c -@n   "c'#)91/3;+ ;% G}ߑ* @€ &%"$cX %\%"&$Tn$cX $cX'#D%"&$Tf%\ %"$T%\`& $T%"&$cXY%\ '#D$cX&S%\ &"O%, %,K&" G"H ?D  A&c   <"c "7&c  3"@ /"c +"P$ 'c4&' ""cL " "0 "c$ %a< "  "< %a< "c@lH@ч?z? `!H*cX'H`& cP cX cXH  cXc cXa< " cX    cH " c 2 cX  c4@ec4c4 &!: 'c4c$ $a<   >  : 42, ,a" &#      `h,  `" b(ސ$ T (cX `T"" "bP"耦H@  ;!D@ @vAc8㿘#@` "ܐ@q   @/ @sǐ@k #`d# ` `  @L5: ":  "N`D0B6 "5`0= . !V`6 #`3" `@   `@  $"@s@)  @sn 0 (@)`D0 `!@# H`D@  "c8@r! 2`8 `P@Ð  f!'H'D' M #P` '`#X` #`H '`H'x'|' ''t'p'l'h  'd'\8 D@#lD@Ԑ H $  "#82 LD2(#`2($ .2 (#`2( $ | 8'|` @8< (< 8' x 8'x08 040#X `z'#D`  ` \@Q` @QZ ` \ @L @y @nh4'h@nl 4'lcL  @bDN  h@np@ 4'p   `  @1  `  @   @/$@ @  $` @/<  L 'tL ` @  $`@/N`-"$@5$d 'd2(8d`K|'`'H /'t''# `p@P֐@nG'l p''`p@Pʐ@n;'x`p @P@n3' x@P@n)h?"@#X  "bH  f@ f @j 㿘 8"0 @`8 )   "  ?L"R 6 #`2   ?"@€㿘_㿘  "  @  eH` ?"`H* "H@ А   2 p f!Դ'R6 #X`#` c4 @@ Ԧ)' e 6􀥀H` ? "`H* $H@    ߬􀥀   e#H `?`$``@ H* $H@ 2 H`?"`H * $H@ 㿘#P`   #` #H`2 `M% e` E >H` ,?"``H* $H@ , `( ;a8 H` ?"`H* $H@  ` ?"``H* $H@   M ``2` H`?"`H * $H@o 㿘<(@- e @@ I0L0@-8@8 I0DH`?"``M /HF /H`?"``@ |H9 |H`?"``3 @H, @ eH`?"``% =H = eH`?"`` %H % eH`?"`` *H ** "H@  㷐 fV 6!Ԁ'2   D@LU$   D@LK$@F,#:@b  e#a @Ia. @!0@(a @f!8㿐#`@*?!H@0 @㿘N 1% e#*`: ?D  J   2Nc0  ?N e#H`?"`` #H* ##H@p  N  㿘 #" eaP@I<#@o 㿘@㿐a'D@  #b@/a "b Ta!:71/+)#9 ; o"@/᠀ ""b@/ג!  b`@Ƥ!@>D@:D@͔a?݀ ? `a * @  @  `@C !@Z   !a@K 0Ā@a@ @o㿘! #"@/a  e#@Ha0"#@Hb@o ?c ; faԐ8'"    ! ;""(4`0 @ * *` ,`(  $"?#@ 4ޤ  & ;⨄"( 4`@3`*` * ,`+`4  ⨒8&@⨰ 8$! @e4"(㿘"0@ ""8@@"@㿘"0@2 ""8@@"@㿘"0@2 ""8@@"@?c f!Ԥ ' ?#@`2@ 4`  ?#@4 4 6&@ &  @dƐ"H?c f!Ԥ '   @@`?#@ 4 ?  # @4`@ @4` &@&  @d"P㿘@㿘@ # "c"X`@$cР ?L " # $c #"@.[bh`?# $c@d % @$@:@4@ @!@/cԀ @-2"p@-/"x@-,"@-)"""@  @0 b`@.' ?@- @J@ - +J` 2@@. 2@@. @.@   ?@@ "@@W`@$ `?  ;@5  @5 @B0@  @;@ː  @  ;#    cԀ "@1 @)@==@ @< @  @  @a 0@k @Y @U @3@S 㿘@fɐ  @@'㿘@n  "@1 @6  JJ "  " J@! J ?( J@( 2  `J@   㿘 #`"#`  "c@  ;#|  # @@@0@. @<@l ,8D\`' f% ;'   @cܒ# ;c #h@cw , $c@BNbX"i:#`n"Z:`2"R:`Kr `KK:lĀ`"L:`F:cĀ`Ea,F:\ !@"K:g"A:d;:MĀi`"::"@7:C%"@"6:#@.:68!@"+:p"@(+ :&2"# !    :             : 2b ̐ Ӓ ~Ր ?'   #""(''////ch@bؔ ,! @  ܒ @Ro$ @bU"㿀# faԠ'c @& @"ؐ@ːa @b:#㿘 " J    0 @   2 @㿘͐ "@   2?@o㿘 "   2 @s㿐`h @A     2 2  "#@j# "@K  #(  "#  "c耤` " @Q#0 "@2  #8  "   P"`㿐!?#`'2'!*` #@#H#P #X #`#h#p#x#~    #,# *` 㷀/ f'@# #!$ @ 4 $ +#  $ `- @0P# # "`$# "` #%#$` # "` # "`"``       ##"c#c" "   " c'#В`"# @:*" # "`#"`# "` #"`   P  #Ԁ 2`#"`#"`` 2#"`` #"` ˒! $#J 2 # ; "$# ``"#܀J  # ; "$#  "J    ; "" + %cJ 2 # %c"c "c)!###\ (`0 #@c#c#\ 8@`@%#c H#\@P#c XP@#\K ` "`#"` h  p8 x "`J  p"` )좒 "#cJ@  # @  @$Z"@c6 @'@q"c 좒 c#J@  ## @ْ  @$0"@c  @'@G"c ؒ좒 # ϒ젒 #  "#@("c#J  < "b @_  㿘 #!@=$  㿘N  N@ *` ; "c*` "N@  ސې6㿘\t &&&k & Pd& #&㿘      4@c  2  ;  4@c ; "c㿘! ;#       4@c  2 $#  4@c$#㿘#Ĕ4@ 㿘 #Ȕ4@c㿘#̔4@ 㿘#Д@ 4@ 㿘 J  # @4㿘@+ؐ 㿘  H 㿘 #Ԕ4@mc㿘#ؔ4@d 㿘  #ܔ4@W 0#ؔ4@P 㿘 ;#    0 @(@P@9@)8@J@: @[@K㿘# @4 ; "c㿘#4@   ;"#㿘# @4 ; "c㿘#4@  ;"#㿘# @4 ; "c㿘#4@ߒ  ;"#㿘# @Ԕ4 ; "c㿘#4@Ȓ  ;"#㿘 4@ 㿘 ?@,?@  "!  @K ?!@c  # @,  0 8   @ ?@S$?쀢!(@+ 㿐 d$` ?, @     @  $@  ( @E      @ ! `? x`? x  $   ;#` $ @} 2$ x ,    "`   "` & > @ & & @ " #@ %  * 2@  * @ @B ? 4 2?@(? d2d d@ ;d 2d ?@[ǖ ?  2 :$!@@+U bs?:$ ;#? # `  ?*##    $" @(Β ?倣  !P@+0 =   d;  B;d   &   , ;d0  @0 '!`@+J@_    ؀ 2+? @, `"` @ "@@& &@" #@  "`   "` & &  " # $( @[%  㿘?  ;#?!h@*Ӓ  ;"# `?( "      2 㿘@ W? 4^ @ 8Y  c @ F%* 2  $ 1: $$@) %  d45 d8/  d@?  ؀  d2 d@   8  +  c @ F+ 3` @* @ ( 㿘1 d @d :0@D?   ؀  @L?  㿘 q $  2 @4  2 @(  2  "(:  ,? 0? $ ( 0 $(( @B 㿘!  @$@ ( ? ?(#@`"( "(`B : 㿘1 d( ? "d(d 4 21?d$   d   d ̐B?   ? B?"(:   @$@ (@    ; ? ; 8 㨄  㨁㿘  2??0:0  !??: 2?! @$  ;$0$0 $4;$ ;$@#$($ ?? ?#$ ;$0  $ @Y ?!@)* 㿘` @fP   ?d? "d;`#@``#`` "`"`#`#` `" "`    *   ?㿘! @ ` ` @"`@@ư"` @2` "$㿘  @Y> ?  㿘# ;ct@! $$ $8@e   ???:$ "$:$0"$ $ " ""$:$"$(` ctӐ ct d ?"d ct@  d?""d:㿘! $     d 2   2 @VId ?"d` @E  ;#t$ @Β    ? eDH `?? eD   㿘  e!D    (  (@?Ò 1@ e!D@      (@? 1 (@? 1 (,<`X\Llٌٌٌٌٌٌ|ٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌٌX0""8(0"b0"<"@㿘""4"b0㿘@&@\0!@"0@\"4@$"4㿘@\ 0㿘%8@&d@\zb08@$b0$8%8J "8#@\jb0 @@ 8@8㿘!#"0b4@  "0b4? $"0"< 0@""8㿘) '4+ %" 2  b<0:  @ J 0L@\' @4 "@2`@:`@ 0L 0$b8%b<㿘) '4+ %" 2  b<0:  @@ ?L@[@4 "@2`@:`@ 08? 0$b8%b<^㿘%8J , #@[Ұb0!  @@ 8@[Ő b0@@  88J  "y8`@%$8@[b0 @$b0㿘#b8 0@JP!@["4!"0@ b8b8@[$b8"0"@$"0CN   㿘!@[~ 0!v 0@[v 08 0 @ 8 @*`@ : @8 *8㿘1"8! 0@ "8*@`J@ 2 `"8"D  "8 0@ L 0   㿘"8J V 㿘!"81 0@J  0"8 0@J 0 "8 0@J  㿘1"8J  "8J 0 "8J   㿘J 0  ""<b8*`b8"D   ;  D㿘 @ Z?`dp"*` hd1"8J  1"8J N !"81"8 0@(!J !"81"8 0@(4 J . ,""<"8 0%1"8J  >- [ "b@ 㿘b@ "b@@C  z  㿘H0  06.@.@H@(0?д(`? H@F26 0Tp4DDXdLPp<LXDpL|8l(4`H謝㿘@* @"㿘s""z7 @ 㿘!"   W"b" @Z!"!T!" N!" H!""B!" ";"7"! 㿘"Ģ? @""  /"b `"(``   "0  "8 ɒ 㿘}}b`*:"*` "@0.L@ +"` "`! ;#p "L@@IL@ $#p$#p"!L"@,"" L`&L@0" L@L`㿐!"`/ $*` ?Ѐ @֒  d} :o$" #Lb     bĀ ! ? +   @    " Y"bk  #M #쀦ILb G !"Đ ? ,b@  "@b@K @  -/// / ٖ : d  ?`; #4*`   ! " @b  "b0  o "  ?݀   3  㿘@#  c? c?c  @& 0c@"0   0 !  p @$ p$ p㿘 ;#`"H@G@"? P:  X    4   ;@c#t    " X#b؀ @'Z @!- :$b@!>  b؀  @WL ` ( @!,"H$b؁㿐 >a8'"x@";㿘 ;`"H@"J" @#Q "   g   0 @-o㿘! ;# #"H$##"@ "@! } #* $#㿘@V? Lݠ?:L㿘@!"!! @g @j "@Ɛ0+  >$"@  @  ` !"@*" `$"`瀊``"@! @㿀 # 2  :   "" e""# `  :⸀  *@,o #܀ ?W`؀  e`;`؀ 2 e- e!" "/ " " "/  )/@'쀢`H ??`c *` b   `b b ! "b  " !"  "` @: <"  @"А"  @  db b ! "b  " !"  "` @`: <""  @ ) <!"  " `   <"  " " ` (@K""!"  " `   <"y" !"  " `   <"g  " " ` (@""l !"  " `   <"B" q !"  "` @: <",  2"@ "А" ; ! @`ؒ  $ ,  "4  @ 7 `؀    ؀ $ , " 2b b  b  "#  2 @ " # @  rb b  b  "# # @ G Zz @@&@ I!"  " `   <"@ "6   :  ` d  d:@ "b  b @ d @ bu⸀    :@ Df@$u'"^>쀢 J  ⸀ "b     :\ ⸀ "b     :Jl!" " `b!" " "b    <"- " G %  ?  ? #bb"%  ?  ? "@#b b$`     J@H  @3` @ "` g .`"+ ? & +`J`g+` f`J@`J@J@"`J@?`J@2`?`@ Ɔ d㿘 d  f   d f" d㿘 <"H㿘 <"L㿐 <"Pؔ @2- 'N   <"Tǔ  p #) f!Ԣ'@  7 #쀤@ 1  +, ,԰ ` ` 6 d` d Ԁ!Ԡ?3L ?!Ԁ !C! @N 㿘@ @Q%u@Q&@@  0&  & @   @ ?@   ;J#N@ "    ;J#N@@`  ".@ `@ Հ㿘`@P@ @*N@  N@ "`@ `@ J"?8J?   ?J?8?㿈# ;ct "@耢?ct쀢?ct@@! <"\ "  ;@ctb@"\@["\$"\ ;"#t㿘  ;#t@0 @㿈+ ;ct" @act   @^ @'@ @ V `@  <"X L'@ ' @>@耤@>@@ @@@)q @*ɒ  '@' @@   @` @  '@S耢 y Y@HĀ@Ő ;"#x@ <""\"b@8%ctct @/c  "c ;#p ! ;#|@`? # $#|@@@!u!    '@@ 㿈@  @ |     ;@#t @] ! ;@~ #t@#t @{@m 㿘 ;"#t@2 㿘 ;"#t@: 㿘   ؀  @F@P퀤 А 耤  㿘ݔ 㿘 ;#tՔ 㿘Δ?㿘 ;#tƔ?㿘 @ "  @_㿘1 ;#t "#t@` #t㿘 @W?㿘@@}    ` f 㿘 <@Kv"X "  P@ْ W J 㿘0@?@{㿘@N   ;J#N " N`6 ;J#@2N  2/,  ,N`&  ;J#@2N  " ,@@NN ",`@# " ,N  ,㿘  㿘1 <"` 2 "`Ӑ &"` &"`"`㿘. @ʓ> @ 㿘٠@NML    ;*`J#:`@ ;J#@ L 2  L   `/ @N" a   ; ;J#Jc@0N*`:  @"@# ,N  ,㿘 - L@ )@M@M @V   Ș Ж@0c@(w @ @F@㿘/ ˒  㿘L@) *`: `#`%2 @(L`L "L`L@ `%`#2  ;#x ;#t "@΢`@M`L@  @Ȓ L@1*: `#`%2',@(L`L " ,L`L@  @`%`#2  ;#x ;#t ",@`?" @y@MV `L@  @,P% f'o !  @H ?   @t @   @    @J 㿘  @H~ ??? 㿘 dE  d@ ,,9@@@L, ? $@(6  $` ܒ$,㿘@ )L &x  @LÐ@L  @T@/>@}`@@v0@}`h #Ѐ KאȮ( @tȤ  ؑ,@6 "@L`@LȤؐ幒 Ȥ 6ؑ,@ "@Lf@Lc%@@.@)Ȥؐ@xC,@@㿐  | =  #Ѐ 2L h?! 0)@ !( "> L | @L,@L)  g@.J@  T @U  @e 0O&&@9!( @VL@  㿘 #Ѐ )"@EX!0 @K@K@Kސ  @.`@ @"8@   <  `?@8  @K  @ ” <bh@ 0$@X  @W <  @K * Đ@  <bx@@D8@( 6U !@㿘  H YD㿘  ,   ؀ @Ȑ??   R@  `4 "`4㿘 `8 @U"`8㿘     #?4   t   #? 2?3 `p ` " < #?@ @Ƕ @`p  <" 謞@d? @ @ "d?@ @t`p  S? <" 2N?@!HI? @  @    # @ S @G.  <" ?  p  p    <#    "`8  p @    Ȁ "?? ` Ţ @Β?  @ ?   ,  " 4   ؀  `4 "`4  <" <@d <""@ 1?㿘@    #?   " 4@ْ`@R? @? `@#@ ?㿘  P   4    En 0A@c??5 3`  # @ )  , @   @D     @<??  S `4  "`4| 㿘@  ?  `@?@1U <  T   p  #?㿘!X@u  <   " 2 㿘`2@ <"@ && @" `&@&  <b "b㿘? " " <b?"b㿘 0w f& ??> . & & Ȑ㿘 @ ! ;#t@'$#tΐ@ @ߐ 2 < <  2  <  < 㿘 2ސ   <㿘# < b@ 2b2  㿘  "   @: `: ( :@ (:` * J   "   " 㿘? -  <"*  : @ ,F?  @Qؒ @@͒? @?`? 0# - B? @     @ x ?e  "X^B? c# `؀ ǀ ?L  @B  \  0`؀ D  ?f- 㿘  `  <"*` :  @ @ f   @??F? x  \ '- /-  - 0  ؀ a   ?0U`B - ؀ K  ?2-   9 @0@A0%B? @      @  !" X@ ۤD@?؀ @? ?D  @|㿘?" ;箒 0`F w?   ;:#m`F ?   ;:#㿘 !p@5 0I ?    #  @0 #  @㿐@~?  ^      D@0`8?   @nD!@ 0?!@㿈@*@@[㿘?  !@ ?  !@ 0@   2@ 8 D?  D @ 㿘   ?    #@㿘@@ &@?     8 w @ݐ     ! k 橒 "@Q 0@Ɛ  @??   W @8R( @8#"?   0  ? ܀@ N    #"`4"8"0%? И 054@    $@ 0 % ? =? ߀@  " 0@?  㿘1"@ "cJ 2 "X"c $ <"b $ < <$""㿘+ <b $@MҐ@MΒ # <@` @[ bb@B! <"b@B۰ @M"@Kb$b$"%b ` """b*#" #" x# f! aԄ  l'  @   ` 5 <""  ;*cc`? < < ;` ;#@#2  <   < <" "* <""*@ `"" l 5ؐ@: @E $   2  b `"b 㿘%L  c @2c ",+     ,:# @   <@@  2  : @  <"b*@ <"@㿘        0Q   "耢 3b + ;㬐?`(&b %!"耢 # <b. J?:`@b"J@  Y" $" a&b㬀 -  b (㬐 $!"耢# <b. J?:`@TRb"J@  +" $" 2"b㬀 ,#b耢(  " "㬐 ! <". J?:`@$"bJ@R  b $b "b㬀 !"耢`  < <"@J? "耦 ِ ~   ;c@A(b @@@@42 N -*`: l "`"" N       M b "b 㿘J#   ! c Ac!   @ <@6G" " `  $     <   <" + <b*@ " <" < *@b* `  " " **@b *@ 2$ <􀠠 "@ dx H < 7&8"#  > && >  @b:㿘 c2 Oc  4 8 8 8  @"8!"!:`:`"@"`$  $@ #@    4 2   8   2 ! " "㿘"@   < "c㿘!!   d$!@ $!a` ?$!㿘  l ?   2 `c  cc 4 @8 @c " b@ f4; 9R 2M "!|  ؠ= ?"9 D@ <"#47@50D 2 "!  ؠ ?  SD@8 <"#ߒ㿘  2 `c ~ cc 4@8f#" b@ f4- +޳ 2=?B@@ٔ  ؤ) 2`#`D (@%ދ 2?  ؤ 2??D?@U㿘@  ? ? ? 3 @ u?   ?c耦& ?@B? 㿘N -  @"@@"G ^@tׇ @ @lZ @6} "@U 6@lN"Ȣ ) L@ &N ϐF @=@=  ̐"В@ @K N 2"֧@>@;@65 @l @61@2 0 ` @F@C"@G@( @   "`0O@   4!  ??:㿘? . 1*  ? #@/  . 1* "㿘 '"1 . $0,! ^) ;#t  > & 1" '#  ;t!> & #!!!@ @  ;#t$!"  ?  ?#8@ߒ  㿘`?㿈  @  ;> t&> 㿈@ 耢? ;쀢?  ;#t!"$:$:$㿈 ("2?2 ?2  ;#t  D#"  :" ;??t@"  㿘[   ;#t #H@q ??  4  ?? ;`SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSܝ㿐 ch'@  2` #p@  0 <"c㿘   < "##㿐 6   "@098@?Ñ* : `:!*`   `  `  ` >!  ` >!` >!`  @ &   ̓*` '#@㿘     0 3 h㿘   @㿘  ; Ld "|@l# >@i!8@f#@c#@` @] P@Z  ' fԀ 'C  0԰  Ԯ@А  *`, @@*`ВБ:  @ <"@. $@ ԏN@ ,`  T?* @?*`@  < <" "cxI"t`0@C % <t .0  `А0@ 0@;@;  <.   "@@t 瀦 0@:@: "@@0@:@: <x "@@q'(#@( @7!㿈 + ;  "N@00/N@ @ ; ;*#&*cN`   ;N` !@ 0 ;*#N` ` ;*# ;*# ; # c//'!0/@㿘     !@@ 0U @  ; "c|  4 \[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x[x\[x[x[x\[x[x[x[x[x[xZ[xZ[x[x[h[h[h[h[h[h[h[h[h[h㿈 'D+b"J@   2%b€ %b@JD@ b`"@%b%b  DJ ?`03'D!8*` DJ@ +`? `}'D < D"c@| +@ 'DJ@ + `  ' ;d"cp aDD z?'D @]? @ @< 2 '!'@ђO '  "    5( D/ )%`? !@ J  D 'DJ  D@U 'DDJ uD@ "@€ DJ lD㿈@'H@ @'! ` @@' !2``!" `@ސ'"@[0ɐ `   HJ " `@  "{``  "&   o`L Ci`"_`"```" ` \` `?V"``?Q"@"H`?I`?E` ` e!D      e!D    ` @f`)"@4(`$" "` ``H@Δ쀢 2 `` "` "@"P@˒ 09`  €H `  @  `  "`  `` * @'@``   "`0` @  ` 㿘.1"x@ "㿘@א    S@ 㿘@ː  ` 2`@ 㿐'"@T㿘"J㿘L@ 2&@ѿ &@+*`: `$ "$ @ 2 N $". -  & &.  Z &@@|@*N 㿐W L -2    ?А  &%?`'"@m  А  * .  @*`: В@ Ѐ$&`2 㿘  >`Đ "`"  > Ā  Ґ  :" ??㿐@!㿘:" @t@76@73  q@㿘6`.  .`@B2`* @ *`B2*@* @ ɖ d  @ d  d@  @  㿘 ( >@: @ 2 @2  @  d @  d @ 㿐  ؀   v"`0 M >    0  + > Q         &  `1@Dڒ 2     "   "      Ը " ȁ㿘% >"@ ;#|    @{  "`0$ȁ㿘 `Ā Y"`! >  "@   * $ ȁ㿘N*` : N x% fԢ ' & ``/ @ G `0?, @   ` -?,@ @2Ð x% fԢ ' & ``/ @  `0?, @ y  ` -?,@Ҕ @2 㿀% fԣ6 '`2 /@+   0?,@t ` -?,@ @2g (㿀# faԠ'Д [@5qa @2O 0x# faԠ' B@5Xa @26 @㿘N2 *`:  % (`N n   s dN2N@L`  *`:  L`   N@@@@`N 㿘@ p q Ώ   ?㿘  # ;c|`"    #  I  c|` #  > 0 @  #ң    "`0㿘r > "n  "`ā㿘! ;#|  # W@ #|  # f 0 e     "`0@? ??  > >   2 8 >* 㿘7   >.8 > >(8    >* @: >8    >*??@; >㿈# % c@"! >! ?@d@!c??cO c$!$耢?쀢?!*  :? >a4!?  8?# 6?a*42 # #a?㿘 # @ 4  >* 2     >   ? >*@@" @  >??:   $  耢6?|H||{T||||||||||||||{T||||||{||||||||||||||||||||||||||||||||zz{{H{{(||||||||||{H{{||{|||||H|||||||||dD}@~~|||}}}~x~D @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@,@@@@@@@@HHHHHHHHHHHHHHHHHHHHHHHHHHHH̝㿘 P! $   $  $ !@ >"a ! >"a!! >$!㿘@2#  c#@ "  @wgc@$c*@㿐//x# faԠ'p ؐa @/X"x# faԠ' a @/B"㿀# faԠ' a @/-"㿘" 㿘? ? ? # ?   ?c耤& ?' 㿘?. > `6p *`  # " e@ Ð?P L W @ X 4 ;.#t@b(M M l  l H ?2C /  $< 0: 8#? 0 4+ )`'% @   `p@ ҹ ?2   ;#t@  㿘?`6!*` T? 0 + @0t  ` #耢 F?:{ B 8 `   |`z #蒆?: F?@ `ߐB 0 ;#t ;#t$6 ^͞G B 8 Q`O   H`FF?0g;Şސ& ? 20 * !    ̐  ^ 0'  "@ J ? "J? 0&"00  ;#t x  J:" ?." \ J2 02 0?㿘?* : ` &#h*`  ?* : `2"*` &@?&@? &@? &@  D&@&@?㿐# b% $N 2N1N"8`:&`?`%%`.2* 0 `\* Ñ: *  N%  N '( 2  N  ?'  N 2Nb` @&b㿘 >!  㿘    `  # ̒"@ *"@   "c؁㿘    #"@ "@ >㿘N@= ` e!D@   @ b$  X* R  N@ ?"@N@ 2 @N`  `N@ "N``, `N@ @(,L? "?,   2  " 2  2  " J eD   J   2 > >04@ 㿘  8 ' o ㈀0 $ #䀢 ) a&$# ? #  @  怒W# ?$㈁㿘 ;#?#`?E  ;#??#:;#"  8 + c* n?  ce 4?2c耥? 42 c耢@( c0̮c ?㿘f  "@ 0  `?d"㿘b! >  @J   # >@q"` ?a0 "$a0@U$a0! >!4 @] $!4"c 㿘! >!0 " >@U >$!0"!4㿈 #"  >!4@ >!0@  @D耠`? &@ & 㿘# >a "?@ ??  :$a:㘁 `%  ;cc"  ;2   c"; 1c + -  > 2'  >"" 42 2" 4 2 ( 2 㿘  `@ 42 ` @   " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@p0&@#㿐!  S`   ` `>    2 J@ 2J@> J@ 5 2``'D J`  `'D 魐 J@ `D` D 'J '`J@D  J` ` 㿀'P>'T ;'PT  o PT "@@ 8 F :`@ F :`:`5T(N  PT  Pj >'!`2@㿘 #   L "#h㿈7耢?쀢? Z? @? 㿘~   `"#㿘 ` V ?P MsF    ` ? 9    D` ! ?* '# c "? c 0?? ? ?㿈\"   ؀ ? 4 d d 2+:v4 Ĕ `D  D??    ld 2:M l  @, $Qv# @ 2 `  "   `    `` 2: 㿀`N@ 'e 2 ]"@# "@U"p3 `  \ `    c  "c 1"#(!  L    U?`"# L  "# L "#!   (  ""# ??? ?+"c &??#\#`#d?      02   D     x# c- ?耢 Ā ?? ꭔ ? ?@ @c cc`@ <B"*  : 9Fc" c2`(  <"*  : F #@#2    <"*` : "*   * @ :`@ f # 4 ( (&:##\#`#d !  ##?"      @? :# :J@+`H8 2 H "H`HK@2 `2"2" J@ @  ؄  ؄  ؄ ؝㿘  &a@o &a@k &b@g 0 @d  @a  @^  @[ 㿘  ؀ Q "" ؒ @N : Ǩѐ  @C  @@ @iO@3 &a@8  t  "`0 # % `W`耢   2  :   ""0  <c  l "c  "`0"l"ƒ x'''@2؀ ?؁㿘 @S" "`ܐ "`܁㿐  ܒ5 ? ?O O   / 㿘@KPPPPPPPPPPPPPPPPxPPPPPPPPPPXPtP,HPPPPPPPPPPPXhPPPP@PPPPPP@PP( f !Ԕ! $! >'a''@& X) >' >!:% >5 >/ >9 >;7x Fs'* @€"X  a@  f$\\ "`a@   =%"XY$`"@폔 J@ 6`"a@ @$`8B$`H >$H` :$`"@p J@ 4`"a@̐ @$`@#$``($`"@U J@ 4`"a@ @$`($`` @$`"@: J@ 4`"a@ @$`<$``@ $`"@`H $H`` $` `($` ` @$`  "X  b@a $\@ \ "`b@T   =%"X$` @@` $` 2&P(` $`@  $` %L@"@յb0@ʅ 7"T @ ` $`$`H$`L$`P$`T{'"@챔 J@  "b8@  g"!"@읔 J@ 4`"bP@ $`$ Q$`` M$`  $` H%L"@~ J@ 4`"bh@ڐ $`, 2$`"@h J@ 4`"b@Đ $`  $`"@R J@ 4`"b@ $`0 $`&P@@`?? `a* & @ @`@.@ b@ @ 2@- b@B :" `-bȔ@r b@ʐ @-ɐ h?' !@@臔 [ Zc@] @ђ @  @˒ : @#  *% @֒䀢  >@2 2#H@ @$  >"X` ' ` Ԑ =$&`'   'ش  !; ' `'`7 -a+ > `9 >"T  o-` 5`   ؐ@(,`   >bH 2v@#pq"P2`''` 2  ܘ @#  ''@ܠ  bH 2L@#G@ $ $''$'' #\@** "@  " bH؀` >"\`wc@ e#@"bH 2c@@9"  @ @$? #$! >"H  ?@[$"H  ?c@ː @,ʐ @u@5 @3 @1 @#"H`$"H@%ؐ < L >`` >"H`:@, "" @ڈ @#   2  &`&`&`  @&`D&` 㿘'HH@昔$㿐@Ӓ J @ "`E    >  &` `@ 6@䣒` "1 `  ?+@Ւ` &@䔒 ! @@䊒 `@"` `2  ` P`  P&@ 㿘 ecД( h`@ː#@,' 㿘@㙐  @ ;' n L  o  @) = 2*`"@2 2   >  @2   "*@ ""`2 `Д@  @͒Ƞ 2L@N㿘@㻐! f!Ԓ '@ؔ ?1 @Yܔ$  ) '  !K@  e!D  J   2 K@  e!D      @Q ! @" 㿘  & K  e!D  J   2K  e!D       * @ 㿘  !@$0!$@@m @& & @ 㿘!  $@h!@U !@> &   &@& & @ 㿘   a(C  @ 㿘   a(@c @ @ 㿘   @!  @. a(@ 㿘  a(@ 0@ 0@o @@\$Hl|(@$P `p 㿘 #" ea@@#@*m 㿘`   #   0"` a@ @*``! " @*`$ @J? "@m`a!  *`" a * @!?a  * @*a @ $a"㿐c`@淐   ch@#  @X " J ``  "` @ch@ @8㿘%     @ " @i  P, @J@  d, @@\  @V @ @S P @P 㿐 #"J f  g e      `  "``( "`( `4 "`4  0 `R$,!<*` ` ? e!D      "!!33 ̀@ cp@7   *` * ?А""!:"@罔 "@"J@ 2 # Acp@   "!"!!:"    "a"@甔 "@"J@ 2 # cp@  "!"a    ""`4"( (   "("`4" 4   "4"`(" `T "`T    " L""c `8 "`8 c "c  Ԑ `"x" e#c @ @(   k"`  g"c!:@"""` `:"[ `   "`$T"  ` "0L"    " "LD"c  @"`,   "a:"$  6"c  2"`H  ."a  *"`D  &"a!:"@("؀  >"""@# " > "b@"Ȁ  > "bc@6  `!@@   >" >✐@  ?Ȓ? `!*  @  ! - -  2  @"@@?`    a    ( "a "a/ *` *  @n* %@@j*`+  (%`P # ` ,@@@  `  `P,@@=䨒 "`P! !@@"x"ch@Ő ݦ   !Ԁ    "`$ 2 @H @( `?#쀢 "?@ ?  @8@??`@'`?0@ @8 ?%$@?Ȁ  @̖ $ #\   @)u  $   $ $ @۔ @6@8 㿘 @  @+@-   A    2     "   "  ""   J     "J  2 ! "@!"  " "    ᴝ㿘@Ӑ㿘@{  $   $  $ $  @L  `$ $ ""! a""a  aȐ  "@ `   @ "  㿘0@ -  㿘0  㿘  T `8@    # 2  ` @"G  @}   0  `!@Է`#Д@u @ `@#  2`8㿀  #ؒcc c}   H 2 #@}Ӓ    >" / Ɛ / + ?'耢`''%a-# `@J? '  `'@r 2Ȁ  2a %a'      'n ' !Ȁ Jy# c   $ 2@^c  @^_   @^V!  L   @^L c 2 2 L 2 >" 2  # 2 @^.㿈    ! '  }     @   ??   @   P >", @5Ӕ `U  D ;쀒 "  J? e!D    2'  J? _""   2    K  e!D    2 K _   !܀ 쀒@2   2  ` `d !؀ `?   >" 23 `A3 `` 9# 5 # 1 )# `< `  ! !@  !̀ `" @]f 0 ! aȐ $`<`&`$ "!@ :0@ -`?&`㿘  (   ??y @ɐ& &$&$ &$@J? $2 N@ & &$  " N@ ^   ?& &$ " @?@  ]&  e!D@   2"  e!D@    _ , ^ $ = - : / .  0 "'    c H* R +  2  :  &   `   @" &a? &   2%  # 2  2 2  `   ?"6   `&$"@"@?@   "* "    6 $ " `0*  `#   b X* R  *`" #   &$ "  @ 㿘??>>   _ $$ "$  &   2M@@m ?2F% + @@`"@ ?"   4$  ? * @$ @*$  ; < >>  < >    :> @@7 ?    @* @&  $㿘@ `8@zא 㿘@o `@@zː 㿘@< `H@z  :? @ @ `. 0   cH*P@"    * ?2`@ 8  @ @ 8+ *㿘  $    e@QcH   ,   eH`? "`` .`:  H* "H@' @[y P      eH`? "`` .`:  H* "H@ @[W X  eH`? "`` .`:  H* "H@3 e  @cHcH`?"`cH * &cH@Ր 㿘@5TLdtшѼ㿘@C % #,' ``0'4 L*` €"   "`h "`d:" $` ?!<`:`p@Q @b   "`\@@@} ``?ђ?ᘓ* @   `@*`   ?!<` @ "@@   @:@ 2 `@ 㿐@  2 @yb " ,`* * * % T@ɖ Z @M D @  T 2 >X f!Ԡ'@# @`p x< @   @ݔФ   )@ #Ъ @˒  2! @Ĕ   @ 2 @   @y= 2@  `@%  ! @ @  ,@i @,@ :  @^, :, @!   \` @YԔ  h`2f !  d@Y !@x͒Y  @  2S O d@L ,  ? ?/7  @"ϐ ?X'T'X'hab'l'\ @8T @B!( @\$ 'X'`'d'\ 6#\ ,  @Вa    @ @  @Ӑ!0㿐@   @x`!@7 @64  ``@ᥐ ` `D@!  T2`@Ꮠ T 2` `D@   @Ҡ! 㿘 ?!<  `X`?  # @1    2`X@ 㿘 N  naP@y   N  o   "`X " X % ?  @ے , ` @*  $< @w $@ , `$@  @Ē , 2*@, $@㿘   ` "- @ "( @ެ . " * `@ɸ 2  @ɱ " @ޘ . "  * `@ɤ    ` 㿘'HH@u$㿘 ea`x@#@ Z 㿘@㿘a@Z  #b @a؀`? ':%+ ` m@\⼢ 2a@֐ @\B!@@@z?倢 ?a* @ @&@ `  `J`p   &``@`"!@ - @c2@@2@㿐`J c b b@ `@f `@"J@ b @r ` @U ` @"J@ b@@a ?# * * 2 `@ ? 2`  ".b`@G @@W2` @b@v  㿘@  .!@@6 6`@@v" `@ 㿘  ! # #" e#@b0 # e"b@c"c@ b@g 㿘@"߬߼ԝ㿘 ec0@#@B 㿈!+7)#% `5-'%/` 7"*` €:"$! %a &| % x:@b ? "b:@b ?"b@yc?ؒ?& * @& %t !`#$p   ''1'  @Κ ?c@u    c@!  "#$! x @V#t@V#p@V#!@V#!@: !%a@2c !@,`  %a`@N t@Q蠒 p@  @ p`8@u @ @ @|`2"@p`H@%  @ʔ p`8@uv  "@ 2b`h@ui @?G@\А耢 `x@u\ @ʐ 8 ? @gTa耢   ` " ` 耢 " `` ` @u 0@  8@uS @  @uI0HȚaB + cB + 3`  *`  @   @uZ01@Y: Ȁ̀@u! 0@ha      ! !?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?#" @!  ?"  ?c@ ! @  @!  #? "? ?c@ ! @  "@! @#@"     @   #!"!"a  !   !H@t@O@I2  `x"!  @T!p!`"!!@Tې!@Tא!a !@T&@!@a &&  `  㿘. >@ 2@b@s @Xxb@s 㽐@̒ `8@sx @ђ  ?b0@sn b F ! "" ?b" a * "a  b@@  x`"X@Td a @x)'b, * !"@ x @TPpa @bx @TD"x04b@d   b@]  b@ @WƐ b@s @֒ `@r @m `p"Ȓ Q@~2 0 b@  @U@B< @U * @B4   @Qd@U x `*  d 0", &@QT xa *  0" 0 ; `@ C@8 !  @ b@@N !"@x  #@S`(`(  `x53 d,*"@ x @Sbp   `2 dx `@S"x`>x #@S`X 0#8Ē tx-+ d,,"@ x @Sobp t `2 dx `@S\"x`b@@ܐ  㿘@w((((((((((((((((((((((((((((((((((($DDDDDDDDD$DDDDDDDDDDDD4xXxhLL@p`P4D4$Tdt\\0\lH\0ll$P\\0|00000\0Ddddddd ddddddH dddd @ 0 <  H    T        `                p  ,  , , ,   , ,  , , , , , , , , , , , ,  )***))|**********)d*****,)+++++++ԝ㿘 1 ec@#`@}##@y`P@Ր 㿘:" ! e`@o# `@h#@Ǥ#@a`@ 㿐 'Ґ -<+)'#%!7 `95;/ * L@€ %`  % (  $  $`$ $ @t ??ᘓ* @ @R~&@^'#`$`&`@Ȓ %  @; % 6@`@ @ ?`);*` €&@'&@ r0 @ƞ@0h@@Kx  ` : "b k c @Qx B .`@J@ -)@ Q`?`#< *` € ,"` ("` $"`  "` "` "` "`!@:b # e!c@ߠ!x@!@Q0   ?''''  ܘ @Ț 6  ܀ @{ 2! ܘ @ 6!ܨ`  @Pِ!8` @!`@PВ`_ Z " @  ,J ` L ` 2C ` >#`2; , c@V$  (`*` @ #  @J @ @P! @ `? @`@6 @Pz!@Pw!  @zǐ ( Q((  ?:* b(0  .*  ?** *a(X f!Ԥ ?<'  "<#@.! 2,##@0 . #`@ה! ,#  2 !<aВ?`<! *` €  ' `!Ѐ` `Ē @ܔ  @ . c@Q` ",@ !Đ@'!"@Ҏ!h" `  !  ???ؒ'@  /Ѐ/؀``ِ  ` ِ    耢  /'/ې !#\"! @ *aؐ"@U!%"@!@@@t !"@!" !"@!" @ !` f !Ԓ `'<!h*` € !(! `$! 0?    ??   !:@ 2:@` 2``2 @  2` '@̒ @Ԕ!h  `  !  ???ؒ'@   /Ѐ/؀``ِ  ` ِ    耢  /'/ې !#\ ! @ *aؐ @UE!% @!@b@U@ ! @!  _! @ْ!  @ *"㿐 `$'<!ē*` €                @  c "Ā ` "`Ā 2"@T$㿐 b ('5: & s @M@ g"?c@N| ? #)/7`@J@ -@ R``-*`<"X €  ?    ?    ?   ? *  ?  ,   ? "" ` $` 7$ "` "c  %   !"(?2`@ @ ?2`@ @ ?2`@ܐ @  ?2`@Ӑ @ @ t??2`@ǐ @ @@f?2`@ @ @v L X%L?2`@ @;@N?2`@ @ D?@  X    @R6  @K0?@f ?( @@ڒb  "(b0@MuH p $`  ( 2$`@Mf"`@Mc"$`@ @ ? 4 ` 2 L 2   ` "  )# 2$M@L " M@`"M@` "`c`@  & M@@  3߀  M@ g(@ / """@M L` "@M`  ` #@'@L"Ѐ  @L"؀  "  7 "0 "0 ""#@˜@LА#@ X  X '  ? ( ?* ??* ? *  ? ???"`P"`(P*``H 8 *@㿀 f!Ԣ  ' 2  2   2    2    2 "    ?? @A   # c(@Դ  X`@"X a @ #0H ` ?  #" "`X?ย "`X<#l* €# ##P , \   c,#H" ,a,@d ? "B,   0  0L "L  } -,`<#*` €  ??  ??''''ܐ @{  'ؐ@s   e#cX@H@ ` " ` e#cX@;@  " ` e#ch@0@  @ @? ? ? ?   $4 ؀ 2     ?"F`"F2P`X P*P2 $`X2 2 2 2 2 2 * #@@:A Ȱ 444Γ*`4Ѐ`4 4     ? "R"R 2P P`X2` 2` *P*`$`X*`*`*`2`2`2` 2` 2`*`#@@;  ,,,,,, , , , , ,`,  @@    2   ,@"@ J@ ""@ ,@{ @ b @q ,,@bj "&@Ғ /   @@,@?   @4`N ,@@ɐ? 2$#L` $'@NU  7 @?  `@   ! Ŕ  @ '& `  ,`` @ `0  e#c@@X 㿘@M        e#@c@= `X "`X@  e#cX@Д@, <`  ` @/ "@?* "P P*P" * " " " " " " " " $" ( *PP`*`"`& &  &  @?#:,@`?X R   "X  (*( (P 8  f   7 7 +` !77'7777( (   ?,2 !G#ؐ!@ߒ!2@! ?"F@   ?#"@@  2 # #d     `#\#`@ ,2  @ /!!@!2! @ (p ? / / // 7  / / / / / / // ////2 2 2얓211[#"P8@X!2T"P ?"R@   ?,` #"L@   2  ,`#1#&%! #d   @  `#\#` @+#L#,``0#1# %   K 0 *  2`c@ ,c"Phc@!2"Px   ?''''  ܘ @ 6 ܀ &@r 2ڐ! ܘ @ 6͐ xܢ @*@s㷈 f!c " ')@ '#@La(@ '@@Hࠒ@#㿘:!"b   @P"L a c  g   \    5X  &X *+ \5  `$ X``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @X % # ?   c @`   @.`X  # ?   c@ `@`X  #P ?   cP@Δ `@`X  , ?   `,@ `@`X  \ ?   `\@ `@ƒ`X  #쀢 ?   c@ `@` Ƞ% 5Ȑ@#`23 c @Mђ  @İ %?2# %@K?"L  `@`耢@  @%"  e#@` @ PP?(P@J@@"@ +#PX8 <(c #P 4! #P (? * #P#P#"@  ? @@ *@c "(㿘 `D `" @F# 0; ?X* @F#P  "  2  @F#`  e ?#H@P @C T0 @F֐#p  e ?#H@{ @5 0  #@F  e  ?#H@k@㿘q# @F#      e#@.c 0 e#c@$  "  @\ e #@`0ߒ L -+ e/ ?5739+;  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀  ,   @FL  !  $ @F@ 0$     @F2 H  `@F+@F)x @АcH@F" $`  L 4@F` $`  L 8@F` $`   L <@F ` @#@G! $ @  L@E` D#@G! $   L@E` $`  L ,@E` $`  L (@E` 0`" $@E  0"@& 0 $   L 0@Eѐ ` `" @0?H@EŐ   ?@kcHcH`?"`cH * %cH@\ 㿘@E! $! e# ?b@Q#H@E! #H@Jb @ L㿘`?@E! ! e ?Ȑ#H@9#H`?"`cH * $cH@)  %"1@Eu0 ?  @ cH`?"`cH * $cH@ @ocH㿘`Y ?>@ 6  , < ?`&  @  * & @ !  ?`&  @  * & @ʒ 4  8  ?`&  @ >* &@ >㿘 ?# " @M 2  x f !Ԓ`'X*`= P €@T*!8@ $!H @'!X  @!!h  7 7 7 7 7@-7!x@D" e  / / / / / / / / / / /@./!@D e@#H! @!㿘@@ @M    `А *`: ?А *`: ? *`: ?ɀ`2    = ,  €* ,`  *  **".@-0-8-H-X-P-h-h-h-h-h-h-h-h-h-X-h-h-h-h-h-h-h-h-h-h-h-h-`-@00\0\0\0 080\0\0D0\0\0\0\0\0P0\0\0\0\0\0\0,0x  %  `@J@ -`?`J#*` €         @   ?''''  ܘ @  6@"p@   "@m 2@C"@   ܘ @ t 6@ݐ"@  @@C"`@  L 2@ @m㿐b#\#`"ؒ   @C{ 㿘 L   @4" 2  @V $ @Q  L ?  M@ P  @D   @%b eH`?"`H * "H@ 㿘?`K p*` €###  #( #0#8#@ `@C#P0#X@C f p!Ԯ' "@ |"J v    2   p@    ` cx +)#` @c@@X$@@U`{@?w `q#rkEg `  `  `   `Y,#@Ȓ : G@B@=9   @擐@$@@ z`'+)#@怐@$@@` c@n@ߐ$@@ܐ` #@BG `#@B= Ԓ#@B5  @#ȁh fܘ!Ԡ 'ܐ瀣@" +    +@B ! @q#؁㿘 @ ϔ *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @6`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J Є?Д (* 8А ?Ѕ*8* Ѐ4*@*@ 㿘@.&㿘 !!)@"@⚒a @"`" @⍒b `")"@" $*   @)"*b(@v *6""ܰ!`"@B` 2  2  )"`@_bP*?"b܀ J  @"h  @"x  * @h#  "!" "cā㿘!"  $ %"4'!4  @`"$ $ @!!` "2  "@_0*"J" @֐"h @ѐ"x "$$ $㿘 @!b "`U 㿘 @!b "`K 㿘 @!b "`A 㿘)" b@ؔH*?"b܁㿘)"!b@˔*?"b܁㿘)"&c@ᾔ@*?"b܁㿘 'D'H  'D` &`D  0D@5H D  D@D@5H D $ HH)"@ፒcP *``@6` H*?F"b`"H`""`H@J a  "h #x##  (!D  @ }`H"`  )" H@  H"`H` `"` `@`H @j X f!'H' 'DD@5%H HH)"@#c*?|"bH&( "`R#!d`|@ " ')@Ӑ")" H &" ` ` H@6 *" ?JJ e!D    "J ) *` !/K e!D    " K  b X* R +  *` +(!D )@ ѐ )"  @ P  "h #x#  !#    @V!& ` H)" 1!# &##@5cȀ  ` $ `&#H @4 2nLD  " , M& ` H@5v (!D H@ v)"  @   "h #x#H  !#  @ !& ` D)"  1!#&##@5:cȀ  ` $ `p&#  ,@hH, @(= H 2 H@@]#@+WD QL ` DH@5  >(!D "@ )"  @   "h #x#@  !#  @ #&`` 2 )" !!# $##@4ԒcȀ `` $``$#  &@+D?@ &" ` f! @#㿘@ 㿘 D"Ȓ"`##@ 㻐' fԀ 'D''H   'D` &`D  @D@3_H D  D0D@3TH D $ HH)"@Oc *``@4` H*?"b G *" B  J  e!D    "`-   *` "/K  e!D     +`:   b X* R +  *` +H"   (!D H@  H"`  )" H@  H"`#H@C    H`@\W *@ D:HH @4  H H` `"` `` 0@U D  :Ȁ@@gw @ 8㿘@8p !)"?`" * " @ "@)& ` )" (!!#(!d #aL$##@3$aL $#)$aL"@D $aL)% `"@> 㻈 f!'H' 'D@D@2PH HH)"@N`P*?"bH&( "`R#!d`|@M ')@"v) &p" ` ` lH@3C g)*" 'N     e!D      b  X* R  +K@`*(!D )@  )" @@  @ !#     0@ 3&`` ))" 1!# &##@2`h "&#`` &``&#)" @1H 2N@ɐ &" ` f! @ p x㿘!(!``)" "&d`@ݐ ))"@ )"  @%Ð !`  &)"`@xd0)"@ @%  "t'))"|J !(" (@]a!#@Ua0 *!&aHH #@I`@" $(!<!#" ,ax@2 "h(!Xa@% v"(@a*n"*j"b@(!D  * b @0)@."@)"  )'bP@8'@"h'!0<')(!7!)"bx@ܔ(!p,@Ӓb"$ )"x #"@’b%" @#  *  x@ @ܭc0 `*""܁㿘  `? & `@`x   & )`@` ) &"@@c8?" !)"cP@q㿘(<ĖX*"b܁㿘" h*)"b"x㿘!*"b܁㿐  '!0 `?:"!0)"@)c`@`x 2`' ("a0@` 2`'"!0@ #@J  ))"`c@*?"b' """03'a0V1)"@ca0 )""@c"@  a0*""܁㿘"$A*"b܁㿘(p5 *"b܁㿘()8*"b܁㿘!H*"b܁㿘  )"@@۲``*?e"b܀   "t `?1""t `@)`x    $"bt `@`   ""t2 `@[`" "`( @Xޒ `!#@!#)  "b|"t! "t )"| ")J  "t)"@d`$"t"t)b)"|J "!((a@O  "t*""܁㿘",*"b܁㿘 (*"b܁㿐 )"@'`+'`@`x 2`' $"a4@` 2`'"!4@ J ')"`a @*?!"b!4 `?"!41'!4 (a@ a@ ?"a@!4?!)"!4@a@!4   *""܁㿘'H  'D`D@.ʒH HD  H)"@Œax*?."bH`@!`*"܀!`" $ H)"@ڐ!H`@r!В` `*"܀"&`)"") "b㻐# faԀ '  @! &`  )"@@ڀa*`@/` *?("b@ٻ`  `@W *?"bܐ@T$  )"a@]*`@Wڐ"*""`a@c a @1" 㿘'H  'D@D@.3H HD  H)"@.b(*?"bH`@"@㿐'H 'D@D@.H HH)"@`P*?I"bH&( "`R#!d`|@ ')@鿐"-H !&&&" ` ` "H@/ "@@ ` H)" 1!# &##@.bH  ` $ `&#H @. 2N@Ԑ &" `㿘'H  'DPD@-H HD  `D@-H D  HH)"@ٟbh*? "b`@d" H`@]"㿘   &`  "&`   )"@@yb*@@IbȀ "Ф"`!@=" " `@.ϐ` 2`*?1"bܒ"@. "``J |"`@.` `@.^" 2`*? "b` @ )@"`@b@a㿈'H  'D@D@-H HD 0D@- H  DH)"@ b!*H*  ?b''"?@ HJ |H@.` @." H*?P"b&( "`R#!d`|@ ')@蛐"& `+  a w/H,`@"ؘ @l 3&`` &)" 1!# H&#@@-ʐ# `` &``&#& `` D?@Ҁ`@ &" `耢@@ai 㻈' fԒ '@  @ @-Ң W @P   @  @ @ # L@ #(@?( / " -/ @#@2c0  +/'!4  !)"@"@叐 @"  (!t8@[  @[ #@@U?*"b@ @O쀢@6 @3 ?*@U#H*"""" @#X@# fa'H' 'D `D@+HD?  H)"@cp*?V"bH`@# 7 D  H@Ӑ#H"`D 'DH`@# # D H!)"@#@]" e O@ @Ȑ?,H" D 'DH` @#Р  )"@#aԀ  (D 2 ?H` @p#(?"a`a @#㿘!" $ $ $@[# 2$ $*"܀!2 $ $)"@#@K ($ $㻐# faԠ'@b$  )"`0@ka@T Ha*"b@F P㿘'H  'DXD@+HH HD  H)"@C`h*?"bH`@ *"܀!" $ H)"@Z H`@ 㿘'H  'DXD@+H HD  H)"@ `h*?"bH`@А Ȁ *"܀!" $ H)"@# H`@!㿘'H 'DD@*ڒH H)"@ؒa *?"bD"@#H㿘'H 'D8D@*H H)"@ֹa *?"bD!X@H㻐# faԠ'@ɔ$`@  $" @ @    *@ . #@/@N a@ a @\!`㿘'H  'DhD@*^H HD  pD@*RH D  HH)"@Ma*?"b`!@`㿘!" $  $ $!!@`$ $㿘!" $  $ $!!@`$ $㿘!" $  $ $!"@`$ $㿘!(!`  @  @F !`  @ @[ 㿘#(a` @"!, @ ")@})" D?"b$ @$a`"" 㿘  )"@@ؒb*? "b2`@⼐"(@#Ё㿘@/ )" (@ (!` * "c*"#@ !#@凒 㿐'H 'D8D@)H  HH)"@՚b@O*H@# ? '!)"@"X@"*h"" !)"@"p@ "1*J`  !!)"@"@"$*@.#쀢 *Zc@r @ J (!` 3&!)"@ @"@ @Z *?)"b3&b@0`h  !& i@?`h"`h@ٔDH? €`(!` * "c*"#@e @/ 㿘*u*"b܁㿘*i*"b܁㿘  ()"!("@,$!D!D*""D* "D"b*`"@   *"0`"0@   b0 &`J!$J *J@` J2`@  b0 @* 2  * J *`㿘'H  'D)"!)"@$""*C""܀  DD@(H D   H)"@Ԋc*?*"b*1()"b!t @")b`  L " &!t@ ,(!t#)@9@"Ƞ L " '!8@96# )"Ș   *``` NLC *`:  $ \2%J*J!: J 0$JKJ@J?ϕ+`   "@  K`J 2 " K@2 K 2 J 2 K J   'K +`" 'Ja81  . a8J [  \ $"J+2+J  +J $7 J e!D    * J 02?L  @`+J@  l +` f @ "`  +@  W  *`G: :  \ $?27JJ e!D    ")JJ 0?L & @`+J@  J+`  @ "J +@   J  + J  , ]*`J d  J2J 2J  ]`\J BK)J ,V ]":R e!D    ")+J 02?L ! @`+J@  +`  @ "  +@   J  +N  0)"@#(㿘" $ #H !2*"b܁㿘 h&X*"b܁㿘(Xh*"b܁㿘@ #x``*"܀!`" $ ")"@ѐ#@ k#`) "b㿐 )"@#0 `@  # )J )"@#0 "c@p D:"ȁ㿘@ 5 @㿘!" 'H 'D)" H  DxD@&JH D  !H)"@E`*# )"@k  # *`H * bx@T  "  0"@ )"@R *z""" " `*$ q"ܑ*` *  @* *  "@ bx* * ` @'%&`? "`@P   "?̑. :  .@ bx*` *   @ƐN "Ė.@`0@ e3 eb`? "`@& b  &b ?23 e?b`?  "`@  )3 eb  ` &b)"!@*?"b܁㿘'H  'D8D@%H HD  H)"@юaH*?"bH @' ?  *H)"a`@v*""܁㿐'H  'D8D@%`H HD  H)"@[aH*?"bH @'/ ?'H@@)"ap@D *""܁㿘 !x!@ `㿘? )"a`@#`㿐'H  'D8D@%H HD  H)"@ aH *H @&q  *?;"b@Ѥ! J !a@?% Da@  '')"  <0 $$0H% $  0 @x @Y< H<$0% $ @Y5 f'H' 'D  D@$H   H)"`Ȥ  1"  H bx  @; 2  (H)"`@Ћ*?"b&`h@$- x,`* ` @ NN  e!D    2  &`k h*`:  $ \"Y XN    e!D    .   ** :` ?а N  e!D    , D?.?H,  &h&@ $Ȕ" @DH *:  i2D  H,&h&@ $Ȕ" @,H@@.@`N 2 N @n.@#*b@7 `)"@ *S""2N` )" ! (!`  ")"!(@*?;"b" $  !)"&@ h"@ b!(` €!|(!< &N`  )"`?"``@* "@@Ð &$@ h@!|b'D@'Hx* `@2 2ND&-  @c!8㽰 f!Ԓ?''!'@?'((?' '$   `'a@^ (a@  ( (a@  ( `(a@  (  (a@9 `@ /  L 2, 2%! L  2u" '0@܆'  J  ` ^"H@Ll ;`@͐' bx@ a@    a@     M  /"@L}> ,@C / "(L 2,(`@h '?"@L:# @ߒ8?2h(??(:P@{bЀ   e&@G!' 6*R#V'*#@'@S fax@ )b  ( ':ah; @%?@W V'$b@w (h@ B $:h " '00 '@3/Ā`0'!0 6(! 2(!h +!h2) @&)" #`?"``@* "@@^ #)" :(h@ F h)@())@"@0i$ '0'!0 F(! 2C0(!h`!h2<0  (80)"(!h :` !h2) ))"?`"@  #* "@  #)"?`" * " @ )@f"0 @KS#(< @$a "M [@4 ] " J ``:2*  @4s : ', !4  )"c`@ͥ @  D#| ''& 8@_4`& 8`  P@@_4  4@ #@K ?' M   #\! @h c@~!" $ )"c@P  @L '?## @/@     #\  @h  :" @?'c  2 @}4 #@J @c`' " $ )"cؔ@ c@0U" $ )"` @@d : -@ `0@ @V % 2*`H@   `P`@˖0  `x @–@U0`H@   ``@̯0  `Ȕ @̦@4 ?@J!    0 @W '$0 $  $?'0*@0 " ' J? "0 0'!4 )"a(@s$$@ ֠ a8@    a@@  aH@  !P@I @U$(??:P 0 @ '$0 $  $?'0*@0   J? "0 0 e'!4 )"a(@$$ap@  $ `@,: (!P:!P!P ,q  l,J h $a@ " $$ ` )"a@ @p?@ @T@T(X$`T'@T Q@bЀ  e&@c!' 6 *@I4" R#V'*#@'@k  f  @   a@@ )b  ( ':ah; @"#?@T]$@T' W'$b@ʄ (h@ B $:h " '00 '@0<р`0'!0 7(! 4 (!h +!h2) @&)" #`?"``@* "@@j #)" :(h@ F h)@())@"  $@ '0'!0 F(! 2C0(!h`!h2<0  (80)"(!h :` !h2) ))"?`"@  #* "@ #)"?`" * " @ )@q"0 @H^!G @!l (!P!P?"0 "(!h!h "@ " $ ()"@!#  $ )"@ݐ#@@ '@HQ! @H$!  @H# " @H@ @ $?$@S$`@SQ  @SJ@SH( f! @W"@㿘@$? !)"@"H@"*#@@6 㿘@$1 !)"@"`@"*#@@( h f!'D)''H'L"P'@  ~(!`  > Ȱ `(@A ~`D@= @Ր"x M " @ː"  M "  Ԧ H* @@   b@  a@   aА@   L?g0caȐ@  g Lp?V0R /@T :@P@L @ < :8`5`*  @,@: @5 @ 2 D D@G_"|0  M L  H*` @GJ"0@9@6`@  : `. @ :`L@ 퀦`'.@``N@  @0+ /  * '!4  )"b#\#`@X!@* 9 @r!(!`  L  #"'''  N !!'' !! #$# @7(!`  $#耢  @& 2 #@FȒ0 #(c0?ؐ '7)" ~ " ,  ` `N@ c8@}@ ` `M@ c8@q 2 ``N@ ``#('ؐ '')" J`"I?M@ "C? $  )`#Xb@c@` `@G$#h''܀` ' L!!##p'$# ? $# " ''  *"@' d ԰ @Q]Ԑ 'Ԁ (D 6 (Ԓ :H* @ a(!` ? u  f! @Q#x㿘 F @`@P   c@E  5 N + (, %2%,@J e!D   D ",J e!D   D `@,`,`N Р $, * : eD ` : eD ` "ɐ? * (:8  eD ` * : 8 eD ` "??ɐ?Б* : 㿘aȐ@o  a@h  aА@a  @<c   8+ fa)'"bx)*  @#ܢ  @ D#|  ''''@Y'?-c/@_ c@Y  ȐВ @  OВc@K  OȐВ @ POЀ @Y ?#@E *@ِ @D*?"b `!@i!!@c!!3&&`d T?     #\! @b @G!)"`@  @ 6 , @)  :" "  $`     #\! @b ` @! 0@Dq@߷`H?  `6  @Da P*?@8"w # @0 @.'*ch'@% 6 @DF XE*  '  @  @D3 h`@Ʒ!*$#`@Ʊ#1, & @`2"@DE # $ )"`@Ə`d@ΐ # " @@ @ *@*?"bܐ '?c!@æ   &'!4 @C & d@0 a @D Ё㿘@ , !)"?`" * " @i @" D DbĐ `"*#@ 㿘'!4! D'H'L'P'T'X 7$"3)b@T H @  b@G b @  bb@:!b@ɼb?`" * " @ @b3,`@  j@C!*?"b& a@ `@@ɖH`@@ !8@i`@  "p@a@@`?" ƀ @ѐ 㻐; fa 'c'D @$9j @!    *""ܰ  '@5#`݀` `@5 #!, @aH  4!*@4#!, @aH  @Ń@ @!*D  @" $ !)"@!P@"*!"b ` >" $`4*5 541"  ,*#  )` ")&"a@?d)"`? "`` ,`:  @* "@@M  e!D `    *ܑ*` * ?А"܀  *"ܐ?    *"܀ " d   e!D `   2   d`  `) !# d--  d`("  `- *""ܮ "!*,!*@4/#` `" $ 4 !)? 5"  !)"`?"``@* "@@@*" $8$+ @@ *"܀`"#ٴ 1, ""p @슒*"܀!a D@ D"  !@`"?П@ ?a  @E!@g * "b 㿘@& !)"& D"`"@v!@"*#@  f)"$'"( :?p'd!((  (?? H8h;aP'D'H'L'  LJ -)"a@L`)"b@L)" DH@ L f"!c   Ṓ ''|'x`'*'l@ӭ# /l $  "p 1 D" @ܥ?&"| |@ݐ x x@֐  d@ϐ d(*?"!C"ܒa@Ő '|xcx@ 'H@b  H( e"'`"c"0aJ@ |( @먐 H'x`@Eo' ( P@A |@땐 x@뒐 @돐 *a ""a T'07H@]`' (H@@"|@v @s *! '@R  <  ")H"@Nb(|@Y @V @*(:P@ *|@G @D x ?x@= ?*"(d"a@# f1 D""`@PD@b@  "D@bH DL"  ?` @p    ""@dR  1 DH@@p"  D :(d G"" "P    >"(d 7"a`  >"'lLD"h .|@͐ @ʐ x(d`"! P |@껐 @긐 x(d`"!x@ꮐ  & f@  fl@ x' @!? @ꗐ "`'x`7``:"" S !h >`B;!h` 'R @'4 4&@'!0 ;(! (!P 3(!h!hp *)p  )t !)t)" #`?"``@* "@@Z #)" :p B(?p!h@ݹ"R @$j$ ('!0 M`(! ((!P C`(!h`!h<`  8`)"(!h :` !h2) ))"?`"@  #* "@ #)"?`" * " @ )@a"`H@?M":" ]'!03 !h!hp 8p  )t /t)" #`?"``@* "@@ #)@*")"' :p!0 B?p  (! ((!P ( @;' `?"``@* "@@ (h`B :h`? "`` .`:  @* "@@w(h`B :h@0` '!0 B(! (!P :(!h!hp )p )t )t)"?`"@  #* "@9 #)"?`" * " @) )@ܒ" @H@>}" @ :" (@>q"p(??:h@} (d`"!@@j |@ @ x "(x@ڐ (!h`!h2O f  K f@, G f|@Ȑ @Ő x(d`"!x@輐  "p 1 D*?."b" @l?&" @%Ր *? "b "(@(!h`!h2  f   f@  f! @Z"x㿘@B !)"& D"`"@"@"+ @5 )"'H :(''X '('?'T(??'D((  :!P H;h'L'P'Xb'@ `?'܀ #" $  )H X )HJ -)"aH@L`)"b@L)"  *܀ *HD@ L0Q'"'䀢 ' ܀@ +'@϶  +p -  "p ! D" @خ?$"䀢 @ 耢 X@ߐ X("aT *?"("ܒa4@Ґ 'xcx@͐ X'耢H@b lHJ |gH@Ӓ  U(H@&b /:"   H@="0m 2,H H0""@毒   /,`(H@<"0O!X (:"  (H@!! (H@<"0;!X :" H@ 'HH 0*!X  H@ 'HH ܀  "    0!c    L@˒ (:P@  +@7 @4 *?s"b@  ܀   D"`"Ȁ ސ"P _L  D"hӔ  0ː P 0@ܐ ' X 2XH@b X e#H '5"b(`#HJ | @ 'H @@`' (H P@ !0B <;ah(! (!P 3(!h!hȀ *)Ȁ  )̀ !))" #`?"``@* "@@|3 #)" :Ȗ B(?!h@ْ"R b@ B '!0 M (! ((!P C (!h`!h<   8 )"(!h :` !h2) ))"?`"@  #* "@{ #)"?`" * " @{А )@9" @:" @;""(??:h@?`H@;"07H@;9"03"Ƞ" @ @    @,? "   @ؔ  H@:"(X T"!"b(@q Ԑ 'l !03 !h!hȀ 49(Ȁ  )̀ 0()" #`?"``@* "@@{O #)@ظ")"' :!0 B?Ȁ  (! ((!P ((ahB@,z:ah ؀   @< `?"``@* "@@{ ? '`? "`` . :  @* "@@z(h`B :h@,7?n Ԁ  !)"@c"@#@'!0 B(! (!P :(!h!hȀ )Ȁ )̀ ))"?`"@  #* "@z #)"?`" * " @z )@" @ :" @9"(??:h @H@9ސ"@ (X T"a "(@@W @T  @M @{ (!h`!h܀ `    @  "( s(! @mL@ ?h'\@ '`\`H@'d?]@u\@~)"cpH@<(X T"a "(@  @  "p  *?"@ @ 03@1 D"*?`""@ԥ &"쀢   @ "(@S(!h`!h  @$ @ @㿐 㽠 f*aԖh  ''\ 'H ? ?@?@!@9>#! **#h @  @  D"b@8 T (!@  ?c \@  *@8#*c   7 S" ,#)bx '#*bܶ@    )" @o#'!4 `$bx)"@a ! @#*bܶ@    )" @F# Hݐ!& 0  ) D@? D !"#m$ 0"@* P! D``@@Ȑ D*c  2)*"ܒ @J  h )"@  ! Dl#\#` #`ptx@ 5| )*  @s*w*`* k@o*{*@  ( @ 4 , )$ `H@ *"ܒ @ 2 * )"@~Ȑ!e! D*#  ? D !*x|Xhl#\#`#d#h #l#a8TPp@ t P)T ^)P Z)X V)  @ⵐs w* *`k o*{ * **c 6.&x|Xhl#\#`#d#h #l#p#t;x;;;;#aXTPp@ t )"@~T ! DT  )P )X )"@~B h! D  @[*(*+ s* w {*`, @k+`o@(+(@+ @ *(, @$ @6.&$Q$c@ ! D*"'h@/  c )"@}#! D#\ #a`ab@ l )O`Oa@ )Ob@)Oc@)"@}ϐ!l! D*#*cܐ@ n4 :"  !& 0 @7  HU! D D!*b #@# #  S  D 5'\)*#*ch@ʔ +(ap 24 # Db?" @.  @]   $b@6ڐ H, *%apap # ?c \@z  #@6Ð! ! D   ! D"" '\b  \@b  ! D@6!! D '\b ) \@R  ! D@6"! D"#@U # (@6"(! D!@ "?c \@5   @6~#В 'L"#@L "@6r X! D@^  6ap@6h"0ap #@:  `    :" 3)"x 0 `"'    #\!@T?  "8|'!4)  "bx)"@|А  @#    9  "H #\*   "`#\#`#d #h #l#p #t #x #| # ## # # ##* ap? %ap'H(@ H` %ap#    '\"  \@p   @5 h ! D@"H?$"( "ap  f @ "h* #h% f!'cԀ`' D'"# Db@̠  @5"@b?$b @bр $b 'Ȑ  @%  6b@5n hb@ @ɐ"㿘(!h#:b `!h2 $b   ($b @: $b 㿘@  Db "b㿘' Dxc$@Ȑ   )⌀  "⌰  ) "`"(!`%&&d@"!`  @!`. `!*#$d @! a @ !*#h @ސ!a @ڐ*,&!<a<!@"&!@a@"#"@&!DaD ##&!HaH p"&!LaL("h"p&!PaP*aX#"h&!TaT(#aX&!XaX!*D"&!\a\""D @o!`"Ȓa`@k ! "0 @f!q "0@baq)!)&!a""$@X!"Ȓa@T$!'!8$@O%e$@K!8 @2 $ 㿘@ !)"?`" * " @u, @Җ"*&` D*"# `"#@Ӓ 㿀'D'!'H'L'@ƒ"Ѐ  "(!X ""@'!#Ā  1" "l  *"耢 2 1" "ԑ  @ )"@z"0 (!`   )"@z# *?"b܀o  #(rc *@c# ; yb@ާ '!D"h`L @ޛ ̐ 0@ ǐ "h`'LH  ! D"Đ `$"  @}  )"$"Hc0@eL0@p  D""D@2bЀ  )"  ! D@#bЀ  ! )" "p ! "p 2!  2 ! "hH &0"p ")@ )"g`?"p 2#!  2! "hH "! U "p @Ӑ M *# *?"b@ 0B"p ")@ )"7`?"p !*# R  '7@~  6*@3c#H*# *?"b@/  )"     *# *?"b@ΐ 㿐*# R 7' @I   cP@3/*?@"b    㿘@V /  1, ""@ܯ   /,`%@2"< )" @y#X04$@@o  .* `&   d,,:   9, 0@} ,:  02 ?L? . ? 1,?`,??`"ߨ 1!㻀% f!, @' @2ܐ#*# *?"b@[H$   @ @R  @`  " @@2#H @c@  @Л @*# R  ' 7V 7'   @ 4 6*@2t#H*# *?"b@@    V @%$ 4V  *"܀"(   @Ѱ#@P`,t@x f!c'D*&"# 8'H'@#"  "`(J  #"`( "!! "()$3!#&% "b#`, "("$#!&c$`0@$t*"b")"` "x@# . #L * #c@ 2&c$`0`@ 2&c$`0`@ 2$t`@ $`0&c @1 #"@`@ 2  "bt@ P) "b|J !  `"b|! "t  )"|J 2@1 h$"t@  L `@ `@ @`Ȁ 2 e  e"@iT ) "b" "`$ XR)@]"b z`y@ & s( p"a`Bk{#ܓ*`  D d"c| D `"c|&!" 0["c( W"a('@4 `"@N"4"K" ,!H"#(?D"a!A"#:"`@T 9 e#)4"b! &"#-"0:"*("":"J e!D    :"@u!"$ `@S !  "c" "`$"" $@D@4H `! D* "@("!pH)*  'D'H#bp"@Q#"젒 @( @N@*+ @:$ @"!@ ϐ a@ D HH:@  ("aDH &<)@Y)@»"P ~@Q `(@ ~`D@ H' #"'ؐ '`''D@ 1"  !(!`  )"""@v!@F !` "" )@„"P`?  ~`(@ǐ ~`D@Ð @F 㿘@  )"P@ƒ 㿘': @ | #(a` !, @ " ! DR @6 @& @$ @! D" & $a`@, @Z"?$"$a`ɐ a`  !, @ " $a`R @ @  @$ @$a`*"# $ !(㿘 ))"?`" * " @p {)L dƀ`"~, )"@vz!0"`? "`@ "  &"` v"s~@#(a| P1*"@r? )"@vR!PB)2 L )"@vI!h9)  (!`  ")"@v;!+)"("aL €a|(!< " L  )" `?"``@* "@@p   #X@~)" " &j!)@v"@f"& h1 e$@"  ۽ @ː n~`(@ϐ ~`D@ː   C-    `"J@ KJJ@J`J2  "  " `2J@?㿘&(%* ha( ,"8",# D#`#($a| $a|@ @& a|(a8 J@ b,!$ ,D J@ `"D#a8J@!fd("D tJ@ "` ?,D,`D  J@ "D("D tJ@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " b,* b, #a8, D    " D(" D t 㿘 T?@~%))`"!!@Вa3 Da1 C * `  L a@pa *   *@ @~ 0!@? )"a )"b@ ?"b   @? `㿘 #" e   b0@#@ې 0/ f'@#8  L " @p # @ ?#P@.  $@@c`@?  "a:" #h@-͒ @r! &/@ . JH#p 0B 4@q :'᠐@ (#&`d@ "`d@ . "@ `d@$ `d$L  @| . @  $᠐@ L@ 0"!@   8 N@" @ @!&@@aހ @cx  !@R   ?@  @!&!@R   ?@  @l!&)" )@! ") ")  '")"@s (`% *` * x *    ``@!  e!D   ",  ,@! sx"`  0"@ x*` * ?`"-$*`x * @ * * `"% * @x *` #&@!E)*:  ,L? , `0& 0 )"@s3 7 @,a@?    @4   @,#@,#@q! )"@s  H)"@s x@,{#@,x#@Y!? @˫ 㿘!! T @$!  ` `,3#`"a02.@!. @ !`"`\.,a2.@!. @! ` ` ` `,퀢`\.La  D #` #@Da "    㿘@6 2 `@+ & & @6 P &`@+ 㿘  @2 *@7;&  &`@+  * "  & 㿘  `  @ .` @6` @*@6@6㿘  : , @ޒ 2  * 㿘#(a`'H  'D)&"da D8D@ݒHD  )H"a@@*?"b! "t " (*"䀢H "t H)"|"J a`@     "t H`t! " $ ))"a@| !aȔ $a`@#&"4 aؔ @"H("\&a @ @)"*a @"( "x'*a @ !#!"" "cH  @f '!4%" $?$$&! "!+` 1+ D@ƒ   D@  )L? ."? ,)"b@: D 2,!+b  @@zҔ  )" * "b  "bl` )"b8@ $$" *"" ""l` @b`@z 2$$)"@q3"p$$% f'L'`'H  'tHLut H*?"bְ H L - (! 'x !!@'x !@"@  'H@@# 2"'H!@o0HА@K! "'L'H 2"/'H@  @@# 2 )"b@ )"b@ e/ O@А@̎?.@O 2'H'HH HJ#`L 2@a#'LL;#``t `@Q# 'tt+#0``)t`#0 @)#8 27 (! \  )"  *&cP$@Y h *"(!|m@5"(? @ "a`  bx#H@ `@   @#X㿘#&@`h$ )"@p-#hL)"@c`h ,@ $ e"@@- 6@ ?L@ ",@ R (!|@$ $*"&@㻐& `/ fԤ'`" , ! E B"" < ? @D;$ < , - E  ""`"` ""< ! E@C# N #@˓J? /  $d @ ?@)&# Ԓ@$?L@ / /,@ $"c@@@  #@( @'1" $?& $& $''0`$0)"`?`    ` *"@  d + @&`)"d`?`& $$0@%<@ p< 2! E )"@o=   H&# <b@F$ b@ <$ <@q 2.b @ؐ p㻐' f%!' E#(aL 2B !)"`x@ؖ@f" e@$ O/   b X* R  n"$  p a" y""$@nߐ   $aL"`@ @`!)  @ǁ h" , $ Ȕ ,@ڐ, @ 2Ȁ  @(& @l  @H & @'̒ @` 㿐#'%"a4$ ???$$'! " + @@ʒ )  @ܒJ   e!D    2$$??"$$a4 2 $$!)"+@n\ @"@l $$H%''"-*4$ ?$$! m`#+`@L e!D    " LL e!D    2 a@w  2)"@a   2 0, ,, Ĕ#\#`a`@>`@Ȓ  ,@?'''?Ēx''''@v?쀦`)4  )"a@`@$$"$$4 2 $$!)"+@mΐ @"@ސ $$?"%܁㿐! E @?@$ @`w @?  @ `?㿘#:b (!?2$b @ $b `7 fԲ'!  @ː" "   D"  bȘ "  # :@ (! /(P P1(5 D!hȪ@ B `5`-  -`@B2`* @ *`B2*@ *@P  d & d4 d"@*#?․`@̐@{ d@@cH""@#\!@$@  4`  <   4  a"@, @@aJ@"` "@#\ B#\P@f    "@'ؔ" 'А"@'' "" `@  " 쀢" ;"     " @ # ' " " " `'" `'А"@@''#`ĉBA?ЋD.'@ @Ȁ@}""@`@.@r@o""@@h.@@b@_"$ <@ <@ܐp@ܖ%)!h !h` #ȁ  PP`@(@0@-""@@]%) P@ @""@@M%)Ȓ @8b !h!@3?В. ȅąB'@d @@""@`@.@@""@@rh.@h@ސ@ې"$ <@9 <@X@X%)R @Ő@  ``@Ő @ 0@ ?`" * " @eŐ @/ @ā#" $+ faԀ`' a@  " " " `'x" `'|А"@@'x'|| @x#(ahĉB@?pp H B3? ?  @  ahah ah  ah  #H (!Hp#\@c;`  PX B ;h  #p @ d Uah ahP ` L pH D(P`@P D"ah@ D 49 P2P@ @"b !@?hp. hąB'@M.@l@@ߐ d$ <@= <@\@[  )"R @Ő@ a @à 0㿘   ,@ƭ@4 **# @ "  @ I 6C, )"@j  )" `?"`@* ("@@d %@n,`)"   ?`"@ * "@dv 逤Ĩ 㿐)"#:b R `h@?   P*"#* P"c$b 㿈'''' @] 㿘@h$gh$ggggggggggh$h$ggh$h$h$h$h$h$h$h$h$h$h$gh$h$h$h$h$h$h$h$h$h$h$gggh$ggh$h$gh$h$h$h$h$gh$h$h$h$h$h$h$h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h$h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h,h$㿐@@ Ғ /  @ @/e @/r  ` @@֒` `@6@@gL!o* 4#Đ@/Ó2`@@`؀ o }"c@@` o s"c@@`耢  `@ @ Ec" P@@` 2 @`@@ ES" X@` 2 @`@@ EC" T@za 2@ v9"#0@pa 2@ E0" @ga 2@ E &"`J -@Ða@ ` 2  @!0@.aP  `@@ @ v( $$ L E" \"(```  E E!ha@/p!o" `!o#Ā  #!@a 2  D4###q?4`'o%o@!㨠  @̈`?$  , , 4 o"@B @# E`T" @Д `T@.h!@e%v@ @( a @ ϐ @  @.!@i # E`\  L  2 @ a P a@ @  2# E`\` @ (   @`@<  @@n@( "  P "`@5 2 P!@v@z"c4 㿘! Ea@.h! E`@.d! E`@.`!#b@.\! Ea0@.X! Eah@.T!b@.Q!"@.#@-"8㿘 P@  02  @!0@"` P"`, P@]@ P E `d@ܐ o# P" 4 P @ "8 P@E"`<㿘 P@@ P ED ", P`d@  P "`o# P" 4 P @ @"8㿘!@Ò @ P  ! ` ,b`@ bp@ /@ 1 $@@ޒ@ @Ð値` P`"  P "`0@a܀ ! Po" c  P""` P c@   " P   @ @ "  P@"`0 E `d@O  P "`o# P" 4 P&  @# 8 PD@y",@㿀 (`P ,@ ` @!` `P       @@/@-[x@O 2`P@-S"0r"`"4@`P aЀ " E@0`P` H"``P ` 6`P#"``P  "@0`P`"`2  : "`P  "@0`P` "` 2`@ : @:@" `Po ` "``P ` 6`P#"``P ` "``P ` 6`P#"``P `  "` `P ` #"` @㿀 P`< `"`, P@4` P   2 """" ,@А P   b@  P b@ P a@@  P " P@ Pc" P"  P@   P `@:@.< Po@`" @,|" P @i"`@ 㿘 P@@ P`D"`, Pa䀤 2  Ea @  P"  `d@  o# Pb" 4 P   "8 P@u"`  h * (`P",f @   @Ȧ @ސ@-Ғ   @Ր@-א@,"0@Jh  "  0:07"`c#c( #@@@-@+0##c8 (`P",f @  @Ȧ @@- 2!㿀!܀  (##X`P` `,@ ` @_`   @]@-_#h@+`P&  &  4 * @ w 2& `P    2  `@/  g 2 @o 2!@+s"0e 2`P 0 $ 0`P <c $ ,@ubp@@`P b@?  4@  @  `P $`P" `P  o#4 $`P` 2"`@ 2@"@o#& &@ '0#x@+0 #@+A0 a@ @ے㿘@((4 @*ؐ#{  @ȡ(4 , 4@ "@(  8W$ 8 @@@ 4"*@ @ W L, & ` @ !Ԁ "! 2!J , "!@( A & $. ( @@m`, $* @@ f $ 2! $@* P0 "! "J l @( & (  h@*l#0 @*g@  @;`l (* 㿀 (`P ,@8 ` 3@"` .`P     #  @@,@*\ `P @*T 0@B`P"@"4@`P "`.㿈 P'o4㨔b "@  @0 6 b 1   P`< " P "`< P < 2 P`" P @)  P "@ "< P`<`@*  P <`@@S 2 P * P8  b  "8@8 P: `8@ȓ, $`8 P"f `8@$ P@& P: f @2`@@<  $`88 2 P b "8 P "@84@ "@  "8?#  P2 H2 H P!o`H#2`0 '@mZ P`8  @)a#\o P #ؚ'@@ P㨒` 8@㿀 P@@)!0 P` 2Z P`s E P'o I! !H@@+@)e Pah ,@p Pb@ P a@@ 2% P P   " P@!p`@);"@  Pc @0"@)/!@@V8 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P E @Ĵ "`  P"@(! @a P a@=@? P "` Pf " @oa0 @X@p) f P!o!'#4"@2 P b   P "`"4@0K` 2 P`< 2 P@ ,@`@ 2 P P`," < P 2# @-a@  Pb@ސ P a@Ր@א @a P a@Ɛ@Ȑ P "`X!8  b  "8@ P: `8@<, $`8 P"f `8@$ P@ P: f @4  `8@&< $`8 P`  o#@ `8 "  "`8 P  ??  o# @$?'q P   7//    2?0#42H2H2H'ܠ @k!@'䀢?" Pv#8   P'#\ @@Z o P'#\ @@No P#b48@R! @"㿈!o# ' @kv @'"(#\o P#ؚ' @ @㿈!o# ' @kY @'"H#\o P#ؚ' @@?cc  /  @* $@% P %@  @ Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  `@ "  P&  @ " @ " @ "  P` @% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2# P( , ?#@#@ ?, "@ , @"  P& , @" @" @" ٚ` P`@#\#`#d   @  P"e Pe!+ !,"e P *`@ P *`A P *`B P@j* C P"`D P@2`H " P P2 J 2`J P " L P" P P" T P" X P @ \!?#  /  $@m P %@h @# Ԑ$$ $$  "  ?"   "  "  P%($ &  $%(&   "  P&   "  "  "  P  2 Pa ؐ%$ $%!`4  "`  "  "  "  P ``2"%` @.% Ȑ$$ `$$ `"`` "` "  "     2# P( , ?#@#@ ?, "@ , @"  P& , @" @" @" ٚ` P`@#\#`#d   @'  P"e Pe!+ !,"e P *`@ P *`A P *`B P* C P`,"`D P2 H P`? `L`@ƒ`  P"`L@& " P P2 J 2`J P " P P" T P" X P @ \  / $@Ö P %@Ñ @ Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf -耢  $ f -'f - "  P& - "  "  "  P`@#\#`#d   @  P"e Pe!+4 P!,"e P * @ P *A P *B P* C P,"D P2 H P2 J P" L P" P P" T P" X P @& \P /ǒ $@ P %@  @ Ԑ$ '  "  ?"   "  !" a$'Ȳ`4@  # @   "` "` "` P#\`@#`@+#d P"e Pe!+4 P!,"e P* @ P *`A P *`B P@o* C P "D P2 H P2 J P" L P" P P" T P" X P @Ő \㿘 $ " (@#0 (  @#*,  4  8@#"   , @#㿘%o ! E@ T@}&bh $ T@$}"pv#(`v`P " @2  `P`@' @`2`Pv#<``P " @  `P`@  @`2`P@p2 `0!, H `$ H$ H`0 5o 2! E T@|ƒbh & T@$"p@Ғb`02  @ʒb @Œb` @@&@b`(@b`$@b`,   @c . `4  E".  `8  @{ c@  . @c%`!oc0#\l#` #d #@s@c` cXl#\ #`#d #@`@b`cl#\ #`#d #@M#@Ic@#㿘 9 d P"f P&@!ؑ*  P"f P& 2@#x#@w# Pf"@ P& 2 P@#i  P!&"  PH"@f X P@^" P"`@X㷸+ faԤ0' @[@%] Ph@D< I @@K|<'x @Ex @?`#@@$e` / @1@%3 Px@ 2!( @! @H#@@$H   @@% P@( P@$ P@   P&  V 4M-  "  P O  $0M& `H@  -  E"  @"` P @Ő P8& @@   E"-   @"Ւ` P8@ P& @@@,@  4 8  E- H @!   @  P@m    @ P@\a @!`' fԠ'a @W  P& b   &q b   E'''Ф'@-'ܠ !0@Ā   !@@" 'Ĕ@!P@" @" @e P @!h㿘@ &,  @eH 2&J =2&@ "&@ hD 2  @ && &&@!А!x&" @@@@  &,"@& 2&@!!&@p@m@j@`ؖ@㿘& "&& &@ #&"&  2&&& "* 2 H-2* _* H* 㿘o#  E@ p̀   E"@c"`` @!\!0@n @@ِ @א @Ր @㿘# E`X&@! `X@!x!0@bh `X@!o"0 @Ab(@@s㿘 4.` 8@ @˜ @@}`"".` @P  "0@!B @  "X@!5   "@!- E J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @X "N 㿘1, P% `@ "= `  e!D@J     @@2 @` " ' $ ` \2 ,@ \,@ `,@`` @* 4,@@ "1" Pq|rrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrprqqqrrrPrhrrrrrrrrpq`rrr rr,r8rrrpqq4rrrzz{{{{{{{{{{{{{{{{{{{{{{{{{z{{{{{{{{{{{{{{{{{{{zHzzz{{z4{{{{z~}}~X}D~~}~X}d㿐5 EP@7q@$!"0 @"@ " <$@" $@" "!"!,""$ E$@!Р" $@$@ $@ $@ $@@ * $@  * $@  * $@ *$@ *$@  * $@  * P$@ @wb蠒 @? @]@~@v#( .  P 2& @& $ P@)" P @-&  P& 2`2 P%@p0 q@#q`0@% P"&  2 Pv#``?㿐! E@ T T@wb蠒 @8? !@ؒ @$#0@#㿐@$>`I*`" @0@  * "@@  *  ~"@ x *  s"@ m *  h"b @ 0``@$*`0Z#`@yc@#P0R!!@ "K&! @!@0@b b  bbbb @$I0+@#_b && `@D#@0@F 0@B 0@ߒ0@1#@#@ ;@'#@"㿐@~ ! @v> .@ @$ǖ ) @`:@a`: 'a2@U@   (@0  H# @ް @"㿐 @4 !!? ( p   E",  @c! 2 !.@ !@ ,"ۤ ; 0@ 0 @ 0 @@"v 㿐@!! @; P 2& @e P& 2 L@m L E ?$ L "`\@ؒ { !@p@"G0@j!0@? } Pf @㿘v#(  @y 2  v#<  @y 2 @ `  !@@R  `@V @t' vc<$"c<㿘@& & P!p@:  P @>& 㿘!@"0 P"f  P& 2 P!@%  P"0&  @' P& @0㿐@V {@!@!ǐ0@`(4 2 @! @(4 0 * .`@$ 0'@^?a }@m@*`2`P70^ ` ` PT"   P `  2 @ْ  2`  P"` ``P $`P/"  P&o# 6  @    P@q!0  P " P@"`  P"㿐@>`:@*`  `0 ;&`0@!@I @! 0+&`@!ې /0$`,@ 0(@!E%&`(@!A!&`$@#&`@#&` @#&`@`40@!@ @v ;@ @ h+ faԒ'@f̠   !!? @" ;"I @ ʐE @@`  @"8@̔ @rې@d .'w@7̐@4 !!?2 v@Ɛ"` ;" @  #d@Ԕ 2  " '  @̤  ̀@2"ؒ"@0@G* : `2 *` $@"k@!@]̔  $̐@ @!؀ ؒܠ $@{@Ē!" @\# ;" @ 0 ̔ @"   @!̔ @! є @!̔ @!  @ !!?2 @#0 ;"p @l @`ucH @`ocP ̐ /@`fcX @``c` /@#hۀ ; L@@G#0"`L@` @`AK?@CL@`A ," ;@֐#0 @Ӑ"0c"@@ @: *`@ "` * @  2 @֐# * @ @ * &@a @f#Ё㿐@   2 @#@g04 ,* ;@!2@Z`@  @ @L @qi$$&@@Œؤ ;@\ @3p% f'ؐ@ (@  2@d X @v b,@ &@ $@ ,؀ ;@1 @  @ x@% @@ԁ㿘@'   @n㿘 @e 0@㿘(8㿘%㿘ڐ 㿘 Ԓ  & 㿘vc$  "c$   @㿘.   " "㿘 㿘. * * 㿘 㿘 P㿘 㿘 㿘$`㿘{ 㿘v "m$ܰ㿘f 㿘` 㿘f㿘`㿘$ Wvc&"c㿘M㿘G㿘A㿘;㿘5㿘/㿘)㿘#v$" $㿘㿘㿘 㿘@/ fԒ ' @  @' @t? @ !v#(          2 !v 2!v#(` @u` 2@`2 a( ` 2 !@@a`` @o #($`L$@$`X$`\$`T$#(     ,` ,` ` @ @`m2k @  @"a`H 2  @   2@!x @o  @ @$`H$` 'Ȓ@ Ȓ @@F "7  $  @  ` !aȖ @` `    !ؔ@`  $`  $  !a @` 2T y'v(`^ `L @ 2`H ?$`L`H``L 2``L "(@<` 2@($($vc<$@6"c<@B `   @\7'` b8@Ub@P"`"@`      2  $ $   2 @ ]@ 9 2`Lv#(` `0` @<@`2`0@m@to@ ` @~"㿘a( `1v @͐##8 @є `#8c8 @n #H#8 "`@#X#8  @ #8 #x"`㿘v#(  v@ @  v#8 L@ L "`T㿘v#,   @ޑ, v@#v@ o# @ 4 1 "@@ L`P$"`P "@ @4*`" *  * ?)v#,   #   \ 2   "@2`2`` 2 @?#@늒?o:" # 2o@jʐ#v@*#o@jÐ##, `  #` 4`  `\`2L€L T L `L" T8+ f !?aԐ#'@ *:" @`` c@!`X`@?$`X  `T /a`X +@  $`\ L@T"`T@.@Ta1v#4  '@Ӕ # @͐#4a @J 0H' f 0Ԣ '  @ @ms0a@ǐ  `8@ 4 A A20  T 2,   (@ @mS0 a6@ :"  `X@d & T` Đ  `    @ x`# fa'`  '`'ܒؔ @P@ "& 0  ( & 0 0a԰@  @Ȑ 㿘vc@   "  2 2"c@ vL`P  "`P"@K  2$ @ $ $ v@`$ `  $"@"  4$  2"$v@ "L2  2  "@LP" P㿘@  v @v#,$ "#,$ $ $㿘#vc,  "$c, @ 㿘` a   @!0 㿘  :  :2 @㿘 2@ܒl! 2"!@0" ,  @ """@ 㿘 6 2@*   &    @q  2 @- 2 $&a00 2 㿘 ! 2@~*  @ "  2  @ "  2  㿘   &%L` I$`ɒ  `  e "  @ 2@$@ !T &@ !%Ld 2 $ $daT`@  `@ 2@ $@ !T`d3@㿘L `㿘L d`+ faԀ`'+ ` "#@@ "@` '`@ @}@ؒ @w@6 `  @`2` a  @!H@[ %'L fa'D'P' !Lx$ @E@G @kL 8@:@<!`@!L h L$ hL`l !LL"l p 2x|$ pxD @L`8 @#@@5 @H @0 @#@@!@ 2,DȔ @@ @j @ސ@ @j @Ӑ@Ր @j!@! @L  $@@ 21DȔ @@ @jq @@ @jf @@ @j[ @@!В@q @ @@MD @w @s@A @i @e@2&' `b 2,DȔ @Q@S @j @F@H @j"@%,**@%   "'  @6a-L @% @!#@@@v@ L$ 0P$ ($ ,$ l $ p $ $ L L'$`L !$ @(   $,@V',@"@ @@ @- $ `@@А"X@@i ` $ $'  2" Ll  \ ``@ `-Lt V 0  @LH8 @#@@ @ @@z @L $@@ " 4`%@%t$* @*`@ `*` &"`` d "`d@=  0 f @"xPL X"# Ȓ @^ 8@Y#@@$ @N@B "Ȱ P  "" Ȓ @6  8@1#@@W $ @&@   Ȱ 8+ faԤ $' @`8 @ #@@0`$ @@ 2 < @ 8 @#@@ @@ڐ C <    < "  : "`<`     <  " @ : "  @@@h{  @@ #@"b@ƚ#@  a @#"Ё㿘%LX  s  `"$X$@ & X&$XL\" \㿀  @l@ 2 `w"蠒   @]@_@A"@S L`t$ $ "`t$ ` d$ d@ 㿀`    2: 4o# , $4 4 4" 4`4`"  4 8`8@   4 2 4 t?`t @   u v@ `v   @ @ @)#ް  4  @a 4 @@ @j & <& 8& 4 t ? t`t @  v u@`v " t@}  " `(& (`4`"& 4`8 @@ϐ & 4& <`@@& 4`<& <&`4&`<@#(`8& <`8 t& 8`h`t& h@ `  ?@& `4 `@`"  `t " @$ `" p"@"``" p "` p`2 p "` p` `2,"` pB" `, $`" , `, 4 , $" p& &("  & "&!"` 6 , `",, & ,`,@6" p&& "  &" & " p" `,  & ,7 0@ # faԠX'@ o# 'Д @  @ @@U#@a @#h' f lX' L   &  @o#@'  @@@#x//''  @Z#㿘L  l㿘L h㿘L p㿘 4 8  L h 4. 80` 2`"`㿘 4 8 !L 8 h: 4  4 h8 & ` 2` "`& 㿘 v u  L p u0` 2` "` 㿘 v u #L`p u ` `u`p֒`v & ` 2`  "` & 㿘[#@ߐ@ w %Lx #L$x`|  $`|  x `|  &@&  @eڐ &@`|0@x㿘 L |L x㿘 #@В@$`㿘L \`"` "@ u   8  " А 2@# 2 u@`2` @ 㿀@ 0L X`" `$@@@@`8 @@@  P@`2@ڐ `L \``@Ґ x` " `@A ` "@@ @4`@`㿘 !`1L  1@ @ $1L@@ :,`"@ ,?1L `@e  1 X% fԠ'  @6@8@@Mq (Ж#` @@ @Md ,` @u@ @MY 0` @j@  u v t@}! h " !@@s!( @!H㿈 @c!X  !p @\   !@V  '@Qِ@M @Q'@E @Q'@= @Q'@5  "  ! @+#\ l@'"("8@# ,  ,` 8  E",`  4   @# "P@ ``,`"`@bh@' fԤ ' P ,/ @ p@Ԣ$@  *@ x@6 Ԥ$@ؠ@  @Ր"㿘 % !,  "@  " ` @ v  2 ,X' fԤ'  2@? @}T :" ` "bȔ@ @ ݐ#` Hbl@  #0 @ Δ @i#`㿘v#0 0 & 4   e  ####p@  㿀 '& 0bq@~͔ 6@ #  2 0@ # 0 bp@~䀢 6 0@ {# 0bf@~ @ p ( @ & < & 8 <@ e Ho# E E& @& D"@"D 0 ''bg@~耢 6v@ O xv#0      ### @  h\% f`''@h  '#\@Ԗ@j``Ԓ#\@i#`' 4 '''@ఒ @ 3  @ 㿀  @ D@2  D 0 8@ < W$ @$ D D @"@  8@ @  @ D <$ @*`2 $ @37 $ @ 8@g 6 @ @%   8" $ @  '@\  @  $ @"  ' 8@@  @$ @ $ @ " @   㿘  @?v#84 Ĕ܁㿐#L`  @ j %$`@~a 2  @ !L $ @ X!  ?c' @~=  @ J!H XL # faԀ`'2 @ 6!   ? ?  //'/77/77ƒ  @ X@ s7L   @   6  @O$'@ D! a԰`? @!Ёh' fԒ  ''̔%ܒ @{_̔ /@ #!   '' @ @m"\\\\\\\\<\\\\\\τ\\\\\\\\\\\\\\ϼ\\\\\\\\,\\\\\\p\\\d0888888 88 888888(8888t888888888088X088888 888888(㿘  4@`( b@c  " &  `@ !؀  `l@  ! `,@ @㿘@t@`n`@'@`@ ',! E E"X", $"X"@ G0 E"\"X  & $"X@ ;"H@ 8"p@ 5"0L@ 2"I&  8  4bﱐ   E", @ "@. 4""@/ д 2  E", @ ː#@@@@ؐ@А$@.%@@ ` @ ` & X`' fԀd' " ! @  * 2 \ !* @8 5*  6*   3*   8 * !` `! !,8!(@ `  !,8!(@w  ! I I#@ob# ?" y 2`@`#\#\#`@m"@ &`@L``T` *@ `N`z 4 *@ * **?"`@/` '@ `l@# / / $/ `l@ @?"'@ @`,?`l *@ * ?`l @{#8㻘\'H'P @Ԕ$ i P ,`"_` 2[` %@ S``  E" , J t ` A  `<`    '@ 4% H ޖ-* ,@@@@* ,@@@  @@Ȧ`@Ph fa;L' ? `' #H@N  , Eb .    a@j E .   @+ @?* : `3=!ē*` +;  @ ` e!D@J   &@  x t+?+` : *?ѐ t+ +?` ` `` @ #@& Eb .   J @ E".  #@b` @ @#p쀥@@  E".  &@#@֒ @! E". @&@ݐ &  ` @ʐ  ?* : `6*`   ; "- 7 `  e!D@J    @@2 @8  " ' $ ` \2 - \-  -  @* "c- "- ]-@ U'@KS̒@^@ R@ F@@th$A@ T* : @ D* 2 H@aU$.LH@V H@N P@F  X `@]̔,$0J@! h@@$`@  : -  @<А - + `@ # f! @W X# f`aԀ '@  7aԠ (8@'''Ȓ@ ';'Ā  " ' ِ ڥ ,   F`  , a @  㿘a&  2&@\!&& 㿘L! " " "" " " 㿘,!0 2 @>!H &@& 㿘@ # ap ap $@$!@\$ $ $ $ 㿘!! !Ԑ & @ ! & @& 㿘 `>2@: +@ 2'`1`!뮐 2`@!`@```@``먒!`륒!$``!` $`뱐!ఒ 2 @Ð" && & 㿘  4$  뗐"H  && &  㿈 ' '', @*$ 쀢@ $  1M"X '  ''@ "F"X $$ $ 㿘 "  " / "!)!@@1̐&@k"h1#㿘)o#@r@ 2*:"̀ "   # #@A"#@<" #@6"#@1"#H < @ "  `,`@ 2` @T @#꣒c 2   # <(& "&꟒c&&   @6,`@ @א` @ے@#n&&@㿘" $@@ &t<L`0Hl؝㿘ll 5v7llv3v v9v&T&t&cX P"!x"cL* *'#`㿘 ? & @uo  &la 2)"a` vLl Ȁ@ l! v"cX"Llxl L "x#!t*ltQ tvcL*?cLt*@t "t 㿘<? e!D    v - vv"#\"cH@ے0O? e!D     vv"#\"cH@0:lvvl"#\"cH"*/+ l!xl!t  v#D  # ? e!D    l # "@\l vv"#\"cH@\㿘lal!v#\ v#Lv"#Pl!|##\v"#H  #a{vcLv"cP l!$㿘)l!  %v\'vH#l$a!l$!|_\%!a v#Xv"#PH$\!|$a$H$!| l!&!㿘 ? 㿘  !* %%`@6#%l!* `\`" l%2l@!#0%l!l"a*!㿘#l,a  ː x  e!D   D  a@ͥ l "aa* %%2l@#`%l!l"a*!㿘!l,!! -_ e!D     @o l "a e!D   D "! !* %%2l@#%l!*l"a@㿘N8  b X* R ?`!*`  c@G !Oc@Gې !Fc@GӐ !6c@Gː !=c@GÐ y!?@Gc sq!M ’`@G g!@`@G _!7` @G W!9@G`(  O!" ’`@@G E!`H@G =!`P@G 5!*@Gw`h /-!I ’`x@Gm #!C`@Ge !8`@Gw  N  !: @GP` !`@Gb 2N  !’`@G: ! @G2` !! ’`@G( ް!`@G  ְ! @G` аΰ!4 ’`@G İ!`@G !@Fa !K ’`H@F !a@F !%@Fa !' ’a(@Fڐ !a0@FҐ !@Fʒa8 !H ’a@@F v!A@FaP pn!1 @Fa` ge! ’ah@F [!ax@F  2T ’a@F J!;@Fa DB!< ’a@F 8!Ba@Fz 0!a@Fr (!#@Fja " !N ’a@F` !@FXaȀ !& ’a@FN !G@FFa耢 ! ’a@F< !a@F4 !+b@F, !,b@F$ ڰ!.b@F Ұ!2b@F ʰ!3b @F  °!>@Fb( !J ’b0@E !Db8@E ! `H@E !b@@E !bH@Eڐ !bX@EҐ !bh@Eʐ !b@E x!/b@E p!)b@E h!0@Eb b`!E ’b@E V! b@E N!-@EbȀ HF!$ ’bؐ@E  ° ’b@E} 3!b@Eu +!(@Emc %#!Lc @Ee ! @E]c( !5 @ETc8   ! @EK`H !㿘!n'H'L'P'T'X#p@$1m#p$H@#po# cH@#p! E ` "@#p#p@b ’cP @]  @ՒcX ` ! ech@u#@#@ߐ 㿘!n'H'L'P'T'X#p@u$1m$H#p@ڐ#po# cH@#p E `  @e#p#p@( ’cP @#  㿘!n'H'L'P'T'X#p@K$1m$H#p@#po# cH@#p E `  @;#p#p@ ’cP @  㿘!n'H'L'P'T'X#p@!$1m$H#p@#po# cH@[#p E `  @#p#p@Ԑ ’cP @ϔ  㿘:" %`N m`@I3”H@w &@(. *` 2: .㿘%m'H'L'P'T'XpΒ$v#T#vc\!nšpx$@wT#p#pH$@)p1o#! #H@p#3vcP @#Hc\ P  EvcH E#̔”"  @c E ` $v@pp@c !’#P @^ @cPcP@X #P @T v#H Eb`@M ’c @H v "c` x# fa'@' @@Ȕ aԖ 'ؐ `  @ * ؖ @ a԰ @6# p% fԠ'@'В@ ؖ ?` А8 @%  <     *  * ?@t ԰  @#'ؐ@f ԁ x# fa@'  @'ؐ@T aԖ 6  `  @ 2@*   'ؒ@< a԰ @# p! f !Ԁ ''ؒ `  @ *@* ؖ ؐؒ@@ ! @#㿘@2  @``?㿐  o#p c'@A o#p@T 1o#pc@T 1o#p     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @   &o#ĕ*`77ܕ277ސ  7ސ@ @p  &㿘@Җ㿘!o@ #@ ` . $#w @1o# # i&#@P 4i?###&#\$#@Ð  &&!o#`   $#1o# ?&#@& 4??# Pc#$#2&#"` x` ` (6`$  ;5o  & 1o# &#@ 4?# 2&#&?@ 6xo#% fԐ  ?? '/7'  @l    Т !?'ܐ# @o  6' 'ܐ#"@o  #!(# @ox  6!`@|  6'{!'ܐ  @oa ? :" -j!  @oQ ? :" -Z!  @oA ? :" -J" @"H㿘zvc0`& 4  "Ô""""`㿘 4 @' ? P":" 3Ð"Gb؁p! f!Ԓ ' &' 4 @lmԀ !1"! @#㿐@ 㿐@  g( 3f+gf# g( 3f+gSf#㿐'@ה 㿐'@ϔ 3f g2`* *#3f g2`* *#㿈  @   @   @  @ (7@@  &㿈@@ @   .. 㿘̐ %w$쀢 "`c   E, b , `" @  `   Ev a"#d#d 㿐  } {`|0 ; ` ` j0f?ޠ㿐] ; !̐ 㿐L! !  @@R  2!@@  @Qːϐ 2㿐  ! !!? ! !`H @@  !`@z @QQ@p@ . ."Ȧ@ 2!,@@T$@@@@@ .,@ 2㿘 &@` . @i @ 㿐!$" !K!0 0   .@ .@ .@=!00'  : @@  &  @Ӑ'"` `.`@U` `" @@> @s ; " 㿐f!"8֐0 @ 㿐  `  "@t & @W:   "X א"a !V@ Q`}`{"̐ "`;"p l Ӏa ̀a "yV  @Q``: @i@  "@_ @P|6  )@ & @:  @"@``: &$@`&`:`@$ @2㿘L@ -  `2-L@L@ 02( L`x !` e!D     `̐#(v"̐#@n L@ `` ? @ /??Ѐ@L@` *  *   ' 0"## #p#̒#̐#. #̒#̐#"      %.& 0! 00,      .2`00`!  0 ;" [  @0'ے! t P ;" H @0Ā'l'ܐ8'ܐĒ / ] h ;" 1 ! M ;"԰ !а @0tĐ?'ؐ / 9 ;"   ! ) ;"  @0P'Ԑ}! ! ;"  @0='Аj : ! ;" א Z! !H ;"z ǐv @0'̐G : ! ;"g c 7! А!H ;"W S @/'''" ;!B ܰ. * *  ,ؑ: `  `?Ԁ`Ȓ J#*`   ?. *  . "*  . "*   ?. *  . "*  . "* 㿘@ f!Ԕ  `:'"b"!'|):'͠|%͢/ 5: o"h@^@R@? ?* & @ @C@`@Q' |͒c@i ?`' ''|@| $ "    :0 -:0  # #0#`#@Ab ͘cȐ @kۖ@6 㿘 e͒c@lҐ#@. 㿘@J  @$ 1'΀ n L  o  @Q0 = 2*`"@<9 2   @2    &*@&`@k  @fޒ 2L@_㿘@7LT\h` f! #b'J'D -'Hΐ @S`8         %!597;1:3΀ 2* @€a   ` @  @D @@H??@פ  `@@G Δ`H@k  @yΒ`P@Y -@   @"@ Xΐ`8 @@ " `Β @"  ΐ`P @/ "Β @ ΐ` @@0฀ @ @ ?2 Β`@ @Ȑ  @Ő `@ܒ ?I?@?C ? !@( ؀?@% @ ?2 @  @f@ ?2 @  @/ @,@)  $@O@7 Ĕ`'Ē @xr Ζ  !a@8`@ @ ?@裸 ? " @a" @ؐ @@ѐ  @͑,  ?@ ? "  0@a(@x @x ?Β!P@j6 㿘 #" eap@k-#@ 㿘@ D㿘x!xz !  ! x  "a  @"  x=!  @Os 6 @F R!' K  =% K# Kc   $c " @ 2c @F @ !c ? $c ! K#  @ # 3 @K / $?$ $c ! K#  @ # x@6 x! @/  ! @F` ΐ!@ ð 0 >  B=! +㿘@;   @FH @ !H N 2 #&+!+xa 'x @N  6@F) !@u!x: ސ @B (c ? 4$c ! K#  @] # B?@ >?%b`?%X $c ! K#  @H #  @}  2 x"X*@ @ @> @  8? /xX *@x "\ Xx*`x"\` ?㿘N !ϒ`P@䮐 @@E`2@>u X@1 6N*? ! @   K#@Z>   K@>Yϐ p@?0#`## e#@b&  㿘u Kc  `'@&-x+x)x W @ `b "\ *@ @ 6@?`@   " 㿘"  ! K##  N@`  N@@o~` @= @J`?# 㿘x"|J |"@ʒ  K&|?& b >+ K# Kc   $c "b@ 2c @= @ (c ? I$c ! K#  @, # Ұ @a ΰ %⼐?%b $c ! K#  @ # |@L |b@,b @`* 5Ϧ?@ `*?@ &  x"l@ J @Ő  ?% K   $ b"" @ꖒ 2 @=E @ ( ? $ ! K#  @Đ # j @ f %⼐?%b $ ! K#  @ # "b@ bl@~Đ`b@ b⼔  < # Kc  $c " b@I 2c @< @\ (c ? $c ! K#  @w #  @  %⼐?%b $c ! K#  @b # b@ b*&b㿘) e"  3x/x? %@\a"  %"X'x␔ >+x! K#   bl$# " @ 2# @< @ (# ? G$# 1 K#  @ # K?@M G?$␐?%bl $# 1 K#  @ # bl@8 bl,`*`x "b` 2c@ bl&c@*@bl" @ ?@"|J`g" `p` "0+`9*`0&||`r 0$"| $"| $"|@;  @@`@0% D% D ?$`@π"|  L <`2#( L" D"|J@   KJ` 2 K#H#  L`< "#  <@   < ? $ ! K#  @  # а?@ ) ̰?@  L@@w < L "`0% < ? $ # Kc  @ Ӑ c @   # L L`D@ Y`@ &?x"``@ `@ ?$`@`@ $`@`@  ?$`@%xx L|J@ n"@ p l @`2 `@` ` ` "@$"|`|<@m g x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|A"X   L@# L <`@@ D) xc<@5 /)x#x"pb (x"t` b`x"@6%"p"H$b x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|"Xx"`@@#ۀ x"t`ߐ"p x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|"X@ "|J`q`Q2J $"|?"|J? eaD   ` "@ x"t` %x xx"""bp@  &? x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|^"X KJ#(#(` L@ ! @6[ L@  @L#( F"#(W#h#px"px bB 3x/""h"h`+ K#`'`q%#?x"t`"p x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|"XT K"cx#<x "p@` "| ?ϐ "| @9Y  @<#@  L̐"0 L" 4ϰ?" 4 x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|"Xx" L"x4b@&4@  ? x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|l"Xx"t`x"x"@#x0ax"t`X"p@S U x|J`n" `p`l   2  $"| $"| $"| |"|J ` $"|/"X!x"xϐ!@`"x@u   Kc "@}#0x#<x "p@` xb @  ?#"Xϐ"?㿘x"t`xx""p"b"pb 4 π x"  "H?㿘x#<3?1?%x)x`  ?, c<钐膢 " ` Z   @  c<ڀ`#?㿐x"|J@ A e!DJ@ `$b||J?   ` |b|J`  !; $b|J@ !`@r$b| ' !x"xϐ!@ʒ`c"x ϐ#^[ ' LL 9% L1 K# "`&# H@4 2# @. G## ? &# ! K#  @b # 6 @ 2 $L?$H &# ! K#  @M # b|@ b|'J@  L"| @`H`* '#"|J@ "|H*@@H  H㿐 K#`'#В x `"b|? L `T  =- L% K   $ " P@۾ 2 @.m ѐ# ? $ ! K#  @ # ܰ?@! ذ?%`T?%P $ ! K#  @א # P@  P !*@|J@ f /Ϩ 7x5x|J@ !T %`T < ! K#  P$# " @k # @. # ? $# 1 K#  @ # ?@ϐ ?%`T?%P $# 1 K#  @ # "|@ "|P *@"|J \ %"| P*@'"|@ I`T =! K#   $# "P@ # @-Ɛ +# ? 9$# ! K#  @F # 6?@{ 2?%`T?%P $# ! K#  @1 # "|@f "|P  *%"|x 3xJ  2#`T <%x! K#   $# " P@Œ # @-t ِ# ? $# ! K#  @ # ?@) ?%`T?%P $# ! K#  @ߐ # x@ x  @:h"| L @P`*bx@@ ["| KJc( c(@= @q`T <'! K#   $# " P@i # @- }# ? $# ! K#  @ # ?@͐ ?%`T?%P $# ! K#  @ # @ ?? ' L @P`*@??'"|`%"||J` |)x#8 B3x% K   $ " bx@ 2  @, ## ? 1$ ! K#  @> # .?@s *?ϐ" ?0$%#8?&bx $ ! K#  @$ # P@Y P@n:bxxbx""*@L@ ! % 㿘x e ""c< /x-x' K x ?" ` l J?`  ` ?5` u s?b|N   |J ` "||"  N . N   X   $ ! K # ? $# 1 K#  @ # ??@ ;?#<V#<$ @ m # ? $# 1 K#  @ # ?@̐ ? x? "h $ ! K#  @~ # {@ w㿘x"    @T%x3 )x` @ =/ L% K   X$ " @  @+ c ? }$ ! K#  @5 # ?@j ?% ?%X $ ! K#  @  # "X@U X`@m5`@@@ %x` =/ L# Kc   $c " X@ؼ 2c @+k ϐ#c ? 2$c ! K#  @ # c?@ _?$?%X $c ! K#  @Ր # @   X* * @F ! K<?# ?`X#x$c<$# c< @x # # ? $# ! K#  @ # ?@א ?x? "h $# ! K#  @ #  @  㿘x"xb   x"p  K  Kc    "c  x"c<S @     @ c ? %c ! K#  @< # N?@q J?ݐp ֐Ӑϐ̐x@#<$@" "@p $$$☐" "x"`c @隒c x? "h %c ! K#  @ #  @(  㿘!x"p䐦 x"pxb "@ ` U"< S`& "@N` E1 K)x# `@$&# # <<$ @ # ? &# ! K#  @ # )?@ %?#  ?%"h &# ! K#  @ # @̐  <3  ` 㿘% K  $  @> )x ? $ ! K#  @h # 9?@ 5?"`@  ?x"`""&@ ?$" $`xx %""<#"h`$ ! K#  @4 #  @i  㿘 x"H$?"`@  @" #xⱐ `$c< A &?@@ 㿘 eaD`  ` `Ɛ ?x* b 2"xb "b" 㿘? eaD   ` ` ?xb*U@  ?x" x  " ""``$ 㿘@     ":@)  n# 㿘"  N \2 `?㿘' L` 9) L! K# "`$#  \@2 2# @( E## ? $# ! K#  @` # . @ * $`?% \ $# ! K#  @K #  L@  L\N`\  `*  \*  \㿘 K# :b    K? * @"@$b 㿘 K# :b    K? * @"@@$b 㾐 f! Kc'  KN  K? #xb* * %"1ϐ  #pД  !x#4 @l  #4 @-В`( @*b#p 鴔 @Đ 㿘 K#` K@ ? *@* x"#@\Q?㿐 K? **@!:"" `h @H  ` L" 4` L" 8$" 㿘 K#`" N ! В`@@3! @0 /  V#а 㿘x|J@  2 H `"|J`   ! L!Ȁ :!8 h5!@5  L. !Ȁ  L 0`@  L@ԧ   $!@' А  0 L"`0!Ȓ@ ! ! L@l!'!@Կ $!ȁ㿘x"|L@! ` "b|#Б* :  [ \  L@p   _`L Y L@ ` * b|) L$!Д =' L# Kc   $c " @ԫ 2c @'Z 쾐 c ? 5$c ! K#  ِ # 2  . %!А?$̀ $c # Kc  Đ c b| b|@hx*@" %b|А  ̒ % J^" J]! 2 J `.`:`=2  J ]   J]2J 2J J] [J] 㿘&@&#xb|J b|x"#L5 @7 b|0?J` @ (&b| $b|b| @ϐ  @/  @<#@$&@ &@ ?*:  g2 `$b| & 㿘xb| "b|J % J*: @b|!x#T`%b| #T%b|b|*J :` %xy)x#D` 7 ! K#  T$# " @ӯ 2# @&^ !# ? $# 1 K# { ݐ v#%#D?$T $# 1 K#  ΐ # | | T* *:`$|` `J `\'b| T**@: $| `x"`b| e"!x ?6 K " "lJ?` 2 &L b|=J@ #D#D` # Kc   #H$c " @ 2c @$Ȑ ,!c ? $c ! K#  G # ?| ?%cP?%#H $c ! K#  2 # g  $ ߣ #H@f? @Ȓ R$?cP < # Kc  $c " #H@Ò 2c @$r ֐!c ? $c ! K#   # ?& ?%cP?%#H $c ! K#  ܐ #    M #H@e$ L ?"cP  < # Kc  $c " #H@m 2c @$ 逐!c ? 0$c ! K#   # C?А ??%cP?%#H $c ! K#   #      $@2 `M! ?   #H@e#H !@@*@!@ @*`  㿘xx#LcT -x+x/M &A \` `P" , % K  cH$ " @   @#  ?$ %P?%cH $ ! K#   # @M @ xH`*@#TMP M 0H 94G?Ѐ4C* @  P"@@ + % K  b$ " cH@С   @#P 赐 ?u$ %P?%cH $ ! K#  ː # @ @< xH`*@3#T )# Kc   $c "cH@e c @# 8%P?%cH $c ! K#   # cHȐ cH  *@#T cL% & # Kc  $c " cH@/ c @"ސ А!Ac ?$c 2'?! K#  [ # ? ?%P?%cH $c ! K#  F # cH{ cH*㿘% L# LbX! L\  "Td*@  *`@$bX \$"T*` * "ː\*"T@ *` "\*"T@ *` &  $\@"} !H@˰ @Ϙ"T$"T$bX㿈 Lxx` c< ?  Lbd? Ő!X? Lb\  x "bh܋  Kc  "\ "c H L("T@*`@  "   2 4.   `"  @ "`"  " @?" ?@" ?`" ?`"   "@  ?" #`?†"\2  : * L"T(@2*`8:@ @('`'`*'  #@ #` #`# # # x"` L "`?d%<%"`%b$d $ 1 K#  F #  {  㿘 Lb\ ??!"b\) Lb\* @*`"T@ \@ ``@ \c@@γ@\??$\x#< Lx"$\ L"b`""d㿘@/xxxxxxx(xxxxxxxxxxxxxxxxxxx4xxDxxxxxx\xhВah@N "ch'4   /#!+ e'%;7 L'0,8 *'* @€ '4!  '4  '4   %h $cl$#tb@bR`$#t $cl $【 "|@@5p?ѐ? `a* & @ @|  h  Вa@D?  Ѐ a4 Вa@D3  h  2  @S?"cp@] * 2 cx'cx@]`. @ L@&7$#(Вb@D   @e & .  L*&,`0$ &@@? :b ?Вb@H <  0  ?@y?( | 2 @h  @ @@@@D@<    h  c|   @&@k㿘@h / 2N  2  N /"?* N /2? 8@fB   @ߒ -: " ` `0``!`@" @ `@"( ;) LT`6 2``"`$``Ц" @+)bH "`` LJ`$`/"L? / /,  Lc$#  ,А"P@ݔ ˰  @@$,#@?`8  L$` 2`@<  #`" ``@@# 2 ` #`@@50 @2`А"x@#`@<`  @gӔ 0<    2 `@`А"@#o `@< @   @N@AU`@;(@O` @L`?N #h`2`#|`2 ``@R"ؒ@g <   #@Wa 3Вb#@ <  ( : L" b@ #h```@ @o`? #h` ` @B`? ` @/@ 2 @f 2`8 Вb@ 8  " @8  `??8` @= 2`@`@# ` - L#l``@z`2G#l`2B#t`9 eВc#@C e b`? "`@>] b  $b ? e"`? &`@>Ib  $b` 2` y Y@[r $  &@=?2xА#@Q'#X )А@ @ @@##@9 ` `@1#  @[u@[r 06#`@ 2#  , #p @ @? @#z o*@ @=  А#@ @[E@[C А#@ 㻐 f!Ԣ ' @>ٔ#?` # , 3 L@c А#0 cc@ސ А#@@ʰ  a#` @ @a @_#P㿘` 3 L@c  #0 @Yc А#`@c  #` @( 㿘` 3 L@`c  #0 c@l  А#p@}c  #` @ 㿘 !  /6 $#X #X@G#$  #$  $@@ $` L@]#  А#@Pc `  @   :%: c @|%: :" `А#@4c  <! @6 `  @<1   $ @ѐc А#@c $ ` D@OC  0@|c   - D А#@c 㿘 ! L @G#  :" `А#@#  㿘! ## e"Вc@A_c"Аc@AZc@g 㿘@TŌ||T| T||LLLLLLLLLØØØØØØØØØØØØØØØØØØ`ØdØØØØ°ØØ(ØØØØØØØØØØlØÐØØØ ØTpØ |ØØL #" f?aԘ#x?'%#"c$c$' J g ' a Ѹ!?#xђah@'$cĀ 2cĒ  $c"$J@ u ?J` n?cĒ` '$c?#x@'ap  @'ax " ђa@?  @!Ӕ !?#ѐ!@AR'#x '@#|''є `@:'  !"@ ?#x #,`"@ђa@? !?#|  @:֒ᨠ#x' `??#@,`"``` `E!Г*` Ѹ! @! ?@!#:!?#xb@$ J@ ~bb@?J  t"ccĐ o"cc j"cѸ! @!Y b #̒`cĔ "##U#c Q"cN"#:"$@!>#F ђb(@? ?>"c?#x#:b'J . ./' " b@! " b('` " "Ґ"@`@d@fF c "c e 8@c@f: c "c@ @ єȖX@ ?Y? `!* @ ?# " ѐ"P&@&`cȀ !"c "c  J@ -2J`  ѐ"P#  ""  # р b`@> #  @ 7̐@ ђb@>t c?#"c @a" 4  @ ?` D !*` # "ѐ"@@c8 0  %! @# . 2 є$@Aɘ#8  @@ 2   @<  2 , !@`"@ɒ̐ @<  #Ȁ !(# ## "##ސ"!#Ā -#Ȁ  @ ͐# - ђcH@ $)2&#Ā @$ 2# ѐ#X@v0є$@AR#ѐ#x@f0@y+c`? `<  `@ R`  <  3 3c #Ȁ #   eѐ#c@>#Ā ""\ @@  0" 9̀ 6 @@k#Ȁ .@ )c &ѐ#@ג0! "  @ :" c c ѐ#@0ђc@ @` 2 8#   @ @d?cp+ faԦ'@8Ò     # Rѐ#@ΰ "@8  # ?ѐ#@~0:! # @Z  # (ѐ#@0##Ȁ 2  # 2 @KN  єc ?# ѐ#@F@V@V #@ ?# ѐ#@(  2?6 ?# ѐ#@ ?c€    # ѐ#@ @VL    # ѐ#@ #  ?@8   @ #  eҐ#@=S`  a# ?  @a @Z  (㿐@v   !`!  @2     2  ?cp- fԤ'@7   # &ѐ#@?#  @Y #   8 +# Ґ h@@Uٰ?c   Ғ`   # ѐ#@G@U #̀ ?&@7a ?# ѐ#@0€  ?# ??@`?# ѐ#@  2?6?# :" "@ ѐ"@:"   ?c€    # ѐ#@ c ??# " ' ' ' ' $%c!# ђcH@# 2$#? @U    # ѐ#@  2%# ?#   ' @# ?  @ @X 㿈!#Ȁ # #`#`@R''` #`$@L''@k耢 Ґ @_#Ȁ " `@TO 8@ a, @TG4 0* 6`` @v`  :" "`Ґ @?` 36``@ Ґ @3`D` @w Ґ @'㿘 e#@X:T  1 `@;?P`? "`@6 ?P  $?P ? y e`? "`@6͐   "`  e y`?㿘J` !`L@@  ' MX  , X@"&   ?,  , `L@ 2L@ 㿘֐  @W$@ Ғa@" Ғ a r.  . `@! 2.? r. 㿀 ђcH@! " !#  # & # eҐ! @/cH@[v!@#  h$## $ @ * @!p@c  @ d @C @/ @1 җ,4 4@0 @ B  @/s? @0 , 4` `4 @0ݒ @#`Ғ!?@#\%'@ B 㘔B@C ;<.<# )`'  e!@cH#cd@ @0D  B@0?҅!'#\@ߚ㿐#̢  e!@c0/#Ȁ 2@0vf"0 B@0o? eҐ#a?@:;@#ĠD   eҐ#@:&b㿘 #" eb8@:#@`x㿐 `"r N@ r w :N` : !: "b ^  @b1 P  @& D&   & $& (& ,& & & & && <@  H& @ L*`:  w. Ґ"Ȓ 8#\#`  ? @1   @& ҔȐ ?@h 8  @@–! & & :"b  LN w &@q @   @ @  㿘  T?! LN w`@M   H@y  D @p& 2` &`  LN w r@ 7 `@ ``@`H&@ `D&` &`  >`  >``@R@R@㿘   LL w"$ : "b #?@    2  %  %  @@?$ $   㿐?#@?* @ .`@2@ 6`@'@Δ  ? 㿘 < ?  2 : @"b @4 $  $ < ?$   ?$  @`$ 㿘ݐ ڐ * Ր * А* 㿘  ƐҒb @ r   g`e:Ґ`D`@&  `&* `&`D  & ??`?`` c@.@`~`D  & `2.@``l`D  & `"  <][`D  &  < : : O"b ?p ""# f ` a/'/ဦ`/// D666  ////'&//耦` ''@X" @&'܀`  @? ?a @T"Ё㿘$`$`; `@:`@"b @; $` $`<$``@ 2#`'H`@@" $@`@ :  ` : "b ?D@ $`<  $@ !`< "`! H`@@" `$@&㿘$`$`` !` ``@@@l@ `$`$`@ "`! H@@`$@&㿘@BH|TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTpҒb@  #bJ o`?#cJ g`?"J m`?##J? f'Ѐ`?"к?'''ܪ    )% `'9:57Ҁ 00* !@€ +  (  %  "'ܐ 'ؒ '؀ @*?J`-JJ  $@@?ǐ?&*  @@܀ Ԁ `Ғb@5ɐ 2 `Ф Ѐ 3@' @?А   @'" " `c0@ J`"'c0@5 _ @K耢 cH@5  8O'耢 2@ ?А  '" @ "  "'" " Ғc`@͐ J`"'Ғc`@5h ( @4 'Ғc`@5\  cԀ @@ɒ : `@@Ò . `@*@@@'@@`@W   @ *? ;* @€܀ ؐ@Z  ؀ +0u  @ Ucx @؀ f  x @ B @0XЀ U؀ RԀ OЀ   @D "D @D "D @ D@qN 61 ؀ 4 @@?* 2 @  ؀`" ؀ Ѐ Ԁ  @Ѐ  0 @pЀ  ؀  @,〲 @XW 2s 8" Ғc@ @[㿐L ?@L " @r ?Ғc@ސ J`Ғc@4z 㿐L ?@ " @O ?Ғc@ J`Ғc@4W 㿘#؀ ##Ѐ` #"#Ӗ  e#@5;c0# #b @Ӗ P@ eӐ#@5)`@[ 㿘@ 㿘@ b#    "  ( *  :` J "   2 㽐 fL0!Ԁ'"$Ӑ @W  B 6+ B+ 3` @; 2* @ * <"`4@@A   = b<9 $ @@ "(  @R$(@  @>   @Q", - @ 2         @Ql 㿘"̠4@.  @  a8  4  4  (/  6+ @}@ 2$  `Ӓ`@'S @" `@6 "@. . .  ,  ~B?< W$   4  Q   M I @ $   @ b !=< 9   3  /@/ *  ! # ""   <b$ `<  Ӓ`@& @`@ 6  ,`  @"". `*41 2. 2 `)   `` ```  `J@/`  &J@J@`?㿘@㻈 f!Ԣ'Ӓ@4 @t@ $@%`"@ Ӑ @a@_@! <  !!Ӑ!@aӐ @a @P<!㿘 @8.`T >`  @ LӐa(@ 0F#(   <  2!! N @ː!0@  ,`T : Ӕ"@@!@b|  J!̀`b| 6 b|@ @!Xb| @}!pb| 2  @!!  "@t4 㾈 f!Ԣ ('@R , /`  `    " 67 4   $"h쀢`4 ! , ,  ,  ,@P a @O!㿘 (   ,@[  "h `$! , ,  X f!Ԭ  ???????'@u<  `?`"!!@!@]b|  J!̀`"|    "| 2 @!!  @Ґ!c( G @= ! Nb   ''/'@ -$(@!"| 2 N@ א!؀ ! N $ @  $( @Ґ   "| @! ((@ "| $(@ ( U!@(< @@ 3@"(@ "H  N $ (@  $(("X N @  "X@e#b,c /','`*`:`c2@(# (J Ӑ"@d PԠ@8(@j  Ӑ"@S @0" <#.  `?22 !(@8"؀ "(@I@(  @4 (c* "`2 @4 Ӓ@"c.`  2 "|  @   @N]#`  ? ??Ȓ`?/'Đ'''???@H'@P f!Ԣ' E"A`?@=  ????ؖ  ???/'''''@!`  B*2 @2 2* @ * @>`@Ò  $@#t@@  @ a @M#㽐 fb !Զ' @'/ P ` 4Ӱ -` (@  ˦  @"ǰ @"z 8 `+`$$ 0  ; B> `  0 h: @& h` P*@  :`   @  `0  e<eD `L @@> ` 2r.``"@M@/0` c.``@M"``0 % N(@Mߔ  "`0`   ,`` .` `P*@ :`     `0  e<eD `L  @ ` 2.` N``(@M Ӑ#(@"|`"@#@ @ܐ#P  @,` .` $$  0  :`@ c > 0 h:` " & h@"v8 ! @L#X㿘 @]"h`" N N @ X&` &@@b`4@ ( 3@ML ``4@ # N`(@M> b`4 @  . @S4   3#  @2+ c @? @ː  @@c " "  *c J@  #.  ,2 #@  2@ @  @4 㿘@ @2 @㿘"` @  ?$, @d 0?,@  #,㿘!" ?"@ɐ$" f!Ը@' 2&@&`$ <>` ('7 e( :`֖ ` Ѐ`h h ɰ @` Ӗb> @#@"c$ h @Lx`0p?  ;`; @&@ @ [  5/Ӣ2  t<@ :@L@ B 8T @# @ &`  8&`@`(N`0 23``&0`` @!;$@s@xȠ 2"`@` 0@{<: > @@@B"c$` &``@  N`@   8 &`  05ӑ*` * p:  @ :`c /@  &`@6 "'N`0 2ⴀ` @ $@@Ȩ L  `t @%Õ;  d Ъ` ! @KJ#㷈 f!ԪM`0'  `@ 2` f"`@`  !"  0@` 0` : t@%<`? " `t @%v; 8"2 " `t@` Ӗb: @c@"c$r F@B@% `  @**" `t6%* @@1Ԯ   `$@0s@ ޒ " $- *bx@:59 `%`@` "M`0 2$` @ Ӑc@A@F#Ȣ`f *  ?% f! @Jx 㿘# m@j" `@@z.``@z), ` 5@z @z, `@H"``B@z``@z , `Ԕ @Ɛ ( @y @y,  `Ԕ   @@y@"`` @y @yޒ,  `Ԓ @ ` ` x@  㿘 " Ԑ @s# ) "" `x 3#" @@y @ * @y   @ϐ@ x ` b*  ?"@;0$b`x@@y%c" x@b * 㿘#8 ` "#8" )Ԑ @#H E!" %@`@$@@yT` `@#H* @yJ`@y#H@x`* d@, @B #L #,#H0#D#H< %#Ha!#4@)#4"#c "c㿘"8e<`H ` 4"#"cH#"@ "D##8@$c<+@A%cL!* "0 $#, %cL$#,"0!#4  8@c< $#4@ 8 e#8#8`㿘!#4 "$#4@$#4㿘 0 ;  @ C@#8 ` 8 `,` $ (@ 2@\!#@ېa* `$"$ $ $ $ $  ,`$  ( $ $ $ @I5 $!@ #`d"a@Ɠ*` $a@.!8!aȓ* "  &!㿘#@a*      2 Ԑ!X@ 㿘a  !ȓ*`   @aaȠ?@Z@Xa$a$ * 㿘g <  2!x!Ԑ!p@@O 3b| @! b| @ѐ!?"a @Hc   *㿘 (  2   ,@H 㿘 ( "  ,@  2  " 8 &   㿐Ԑ!@ 8" 4@!@ p "@y! p@t!@p!b| "  @R@e!  @`! @'Ԕ`!@V`㿘Ԑ"@m@J"c J@ "    # 4  0   *@*@# J@"㿐"   # J@  " # J`" Ⱂ J@ 2Ⰰ" `@`@w3``@w.. ` ` @b@"U@  "Ԁ ""Ԑ"0@" @K2 @"U@"\ " @:  *@ , < @ ?@ $ (@ 0C@  0?  *  $  *@ b * @  $ (#  #*4@$ d"$ $ $ `4 :< `4": $ h`#""h`!ؓ6` `*`  ???Ȗ,???? /''А a@G9Y#  *⤐?"⤁4DL㿐@p+ *#'%:;9)75 N/#!K-Ԁ +B* @€b| ?%b|Ԓ#, b@p "p@1, cc@@b ('!"` $%"`",X m@U p&$@Ő#`@Ԑx b,"  ,b ",b ," #"Ԑ#@ @"?? `!*@  & @QG  #@QA b| #"0@Q: #@Q6    ?@@#`  @F ?cP  '@On㿐@ "J Ր @f㿘 @̒` "   @Œ` 2  @`( "   @`0 2     x f!b| ' #b@P֐ "|@#b`  "| @` 8@J?v  "|"| p@G Hm  N  "!l*+b Ւ`@ h@ "@ @  @laԀ  "| J!̀`"@ @ @"| @!@R"| @!(@ Q"| @ݐ!P@ "| @Ԑ!x@ b`!`'`Ķ`8@u"l@!. `* (@* `. ("2`*@ *:@ @= Ւ!@```Ⱀ ⤒"@" `$@!`' /39P;b #,@t"  l@4@ &l@dl 8@t&lc l"@" `&l@f"Ԁ @`"Ԁ  %# @Xb@ 2 @RHᴀ @L"Pᴀ  %# @Db 2 @>H$% %c b @  , aЀ &bL  #  `,6%@tW```@tR. ``d x, @ `,&c$ 2.@N@V#c @S'#c@O'c c 9"c"| @"c$ N @"@ "!Ր"@HH "|H`@@ Ր "'''@b˖؀   "| @"@n  f  f! @D!"㿘"!,@s#Ր@)@`"`, -:1 N ``@sɐ``@sĒ, `  @s`  @s,  @@ @ ``:c*$@ +@`@* ``,&` 4?@@ @@  ``:c*$@ +@`@*    ?? /'?????"lR"⤖ `," &!h  %    @ b %@` @   `,& o&!h㿐 f!Զ'Ð@< 1b`(@N͔ 0 b8`X@NŔ  @ ` ` Ր#X@ @#x  Ba@C #  * 0` ;  B`B #c` b|"``v9`#@` pb|  <@# 2` 4  ;`a<`4@`0`? ;`@  E@;  `-"``?9Ր# @l8֨ 2`@@((n9"t`=`` 7 862`h`;1`h ,"d` ?d#`(`aĕ* @| "@ "#"`` ` , `#` @&` @C`("$`h e(`:` `` `9`h `B*2@  9   "`t@r0?   4`(Ց, ` ` "@ߐ#֠  , 􀤠  "`t@   `X֑, ` ` "@ ֠  , @  c"`. 3T``@ǐ  2@  (@ H 2@9 ֐ X@ ``!""!"# `` @#   *@ *@!ؓ5 *"t`"`?"ܐ<c``$`p$`t4`e4`"#"c&`` 4`$@q:` &`$`h 1֐ h@ u| @B 0@f "`$<" h֐ @ Q#  *@R#x # *@a@B " @A ȁ㿘     ' `c  "c @ ' "|`@  @ H  @ ֐ X@ Ԓ`` `$)'+-/57ր ђ   r   #:`K *$:@ `2  "l  %"l * @ +  Ya ` $ @ ֐"|`@ʐ`H K @A X@ `@  2@ !(@`H 9 @/ X@ x`"`" "!Ԗ"@""@Ԙ@ ` "@@ `2@@2 $`2  $  & $` 㿘"!,@p#֐@&]x`   ?? 'Ą/????? `, N#  "c"h +  `@6+)ⴀ %c  # 'J@  5 ` @  `,&&!h㿘  3 3  2 c- )+֤  " a $ " $"" 2 " @ Ң`678`8H77CEdDDCCĝ㿘 c@%Ё㿘 c@% fԠ# ' ?* : `l*` ! €@ "@"(   @  ֐"8@ gb@ !퀢 X# @ ^"H@ "h@"    ֔!퀢 C# @ I"H@" ;# @ ֐"8@ =b@@ k"@o" Ր   !퀢 "# @ ("H@^"  @Ր ֐"8@ b@  o@ *2 # # J@ "#  *bh #  *aؐ *#!a!<@ ! aȒ * # N?`:?  "/' h?????؀r$`+֨0531  `a%`a "$ @" ? :    : 6 3 $@ J!̀`  cc(@ И"# #8c(@ ՘"#b| @#` b|! >`$ @#p       :   @J_70  $  ?8 @?cX ' '*! "8&hK%+)#1/  :%  "7  2?0   #xB$ @vb %# y  c*` ?2  0@db # c*  3  c* ?3    @$ *a&h!ȑ* @  `"   " ܐ $  $ " *o  f! @>n#x"t fԮ  ( `'" $ " !ب  @ , $ 2 $ (!֒#@5 2#    ֐ c $@" " "h`"e $  ` c T, 휒c"h `' // /#@L!  ?  ֒c@ א @2 $ 6, @ @( $ "7@>_֒7@>X $`& $ #* ?2 @I;4@" "  $ 4$ "h`' // /+֐c@! $  ?   ` `@@v"@74 $ & $ #* ?2 @H4 c@y 2h U$  Q `p ,@0" "F E ֒c@Y   xא @?  ٔx@ ?$ $ ̔x7@=@" "  $ & $`#*` ?2  "  `( $L .2%!`2L  엒`$@А" "   .2 쇒a$@" "  & $b  ג >"h`!  2    2 `0  $,@" " `#  @ * : `  !*` € $  H:@m!( $ c J `2 !X"|` J!̀`|ה!` @P!(`r`<# @ @  * # *`2  ) $ ,h ؖ @$ @ޒ$א!x@"|`@}!4 @ !(`/` $ h $h !! J @   뾔!" @ , " #*` ?2 *א!@:``2$   @<!@$$"@㿘 a@!@㿘!ȓ*`  N"T  V"h- % H? )# J `@# J@ :?  J@ 2 c@  (` `  # J `@$  < #(c*$ $  ?3   $  $ " #   *靐Ș&!hJ IIIII؝㿘 c@!3`    N?, 8?   /'#ah@????V?# "`' * : `? *` €`#,`R `5`!`02!`"  @*#!גbؔ b9  @ 2bגbȐĔ `*א"Г:`@@$h㿘  `B '+   4   c:  J* $:@`$ Ԁ  2 & @$Ԁ `  :#* $  * *+ bl%bl`ĠUPTTTTT㿘 `@ h0?b fb"`  ' ?*#ࠒ @F?aА#("຀5`X $ !"| @M#H"| 2 %$@ A#h "X%$ ,`"bX $   #  ׬# $ %$P@j.*  ณ, @,: ଢ@@j |@|Β , $:`0@@j*`@|, , :`@! "|@!א#@H%$"| @ ߐ# ?"| א#@ےP@i*  ณ,@: ଢ@ @iג|@| , $:`@*@iȐ`@|v, , :`@@L % * "L? ". ?#4? T#0#"`"@"U%c?P#(?# :`?" ,?%Pa#$"![#%`Tഡ,  %`XP@iy഑* %`\ฐ`,`: %``?ଐ#$$@"@ig@|| , :`@%`d?$ "@ " %`h$ * @%`l@iL|`@{* , `l:` %`d@`\"U`d?`T%`#,?"@ c0?#" @#4#@ "L@ܐ#?#8  @D?"t  "  , 0$? 8?#  ? #?$8 @  6,   :c*% +@ * ," cd  N#ah@ Y" @h" @h֒/@  ࠒ @  @"U@ " #Ԁ ؐ @༒@h$@4 %` %`,?@2@15`5`&%`$ $%`8@{S %`p%`%`$%`%`  (`@6%`(%`( ,`@6%`,%`,U` 0@6%`0%`0`@"U@%`4%`8%`<%`@%`D%`H%`L%`P`T`T@?#0 ?#,@D @ L2@"U%cฒ@hd?c?`@c #@`@/`@"@ @* : `)#L*` €` %`` ? %`  `@"U@:@`\@   ? % *@  *( ณ*ؐ :`@Дศ Ĭ`%@"U    ` :`b@`\@   ? %*@*`  ? %` @Ȩ @"U8 3 @"U @ :`J *`" : 28 `:`c@``@   ? "+@@* 8ז@8d ``%`@g|@z\`@-T@`T@ `"|@g@0j@zD@g@g@0_@0]@g@0XP@g@z0* `-  @`X@ @gr*  4$`$>88@z &``l:`@8@z  &` ?"@  *@ &,$`$ %`$ `:`c@``@  8 " %  : :@ `4@  8@@>$ 4 `l `p@`h @@  @  $4*   #  (  `p 瀋@ %?$4*  # %?`$  ' ` @ ' `   @ ' ` 'P@@Bw 8ؐ@ `@  `$@`"$ `  $ `$$ *b @7_!"?4@BP ?`@"U@`T`T@ @"U@ T T?#0 @B7 +?c8 ؐ p@ Ԓ`h "?c4@@@7* @"U@ T T`@"U@`T`T@?0 @7" *`J!̀` ?c$@@ F?@"U`"@`\@ " \ $ @"U  "3أ- ."   \ : 2  @f(@`   ?#$&`?c @@ 6F`@"U# `` @#@``@ $ @"U  "3أ- ."   \ : 2  @eݐ@ʐ`   ?  €`@"U@b`\@@"U" \?, @A[ $?c8 ؐ 8@ `Ȁ @ "U@" \`@"U@b`\@?#, @@b *`?c@,@@&L N?"h?(%P!?##@A  #8ؐ@ `@  #= b=--Ґ *` f! @5  N N p x Np Nt㿘 e'H'L'P'T'X#@EH@> 㿘   N x` N p@v!0@N  N x` @v!8 #" Np@v!@@>Ȑ 㿘'H'L'P'T'X ԔH㿘'H'L'P'T'X ȔH㿘:@b ؐ!p㿘 'H'L'P'T'XH@> 8@~ / @| <   L` r`@8$ `@?㿘@~Ӓ / 1$ @2, /,ؒax$@   @$  x N" t!ؤ!@|  !@vg!0M8@|  @ؐ!@vX>'< @@#L@ t % t@|؀  wؒ@v;!!  ؒ@v1!@ `wâ @ `2 㿘 ؒa@ @2 ؒa@ 㿘`ؒa@ @~ ؒa@ڐ 㿘@K ؒa@ϐ  f!Jc?*!"x '@|$(  0:@b ؒ@uА# <   ؐ#@# "  @  "a:@xb ؒ@u# b|  ؐ#@uJ"` |@˒   &bx|?`&bx#@u#| #@u #!"c("#cT?"$`$ , $ ,`$`@$ @  $``aU @Ȑ "" ("c"d@U  Hbp A | 2> aĐ@ 6@l 8 1 @D@cw@cr,@  ,$p@* "`@ل #\ X`pธ @ua pِ!@> "`` J@u!h  `р| !ْ!"!x? 2!  $1 ,5"c  @c  0*@ *` t  :` :"Ⱆ  @ <` @ E   `!@"`2 " ,   <`cА"@Ԑ"  "`<, ` `$ @Ő"8| ` "`@t"`| 2 T@" 2T* ,`   @ ّ*@"p | "@tm"`|   @" 2 T* ,  `0`H ْ " `0| "`H@tJ"`|   @j" 2 T* ,  `4`L ْ ]" `4| "`L@t'"`|   @G" 2 T* ,  , $H0204"042"| `:%0@s"`|   @" 2 T* ,  %(`<# | < `"(@sߐ"`|   @" 2 T* ,   H8%8: @ %< "!%<#P  H8  |:;%8@s"`|   @Ԑ" 2 T* ,   L8%@: @ %D "! %D#x  L8  |:;%@@s"`|   @"   T* ,   &"h8  ::8 L8  ::@&"hЀ 2 e,.| 2 @# H #t` "t ",` <:%0` "(`H8  ; 88`T L8: ;%@*`+`Ѐ ] eLYT| 2 @P   N#  " "L  "P #\"eT %`"X P@aG*  , @,: @@a: @s | , %$:`@ *@a+  ` |@sؓ*@ , :`@T L%@  $ * (TL` "p`  `@1`hbx@  @<}  "cP cP 2``@r 80 4 3/57 ``0"4cP`8@`ݠ ``da@ܕ* 2 `p@㸀  @. wx  0  ժ`# ` &`:   ? @" @<   "c"ڒ`!@rD*`0/  #"a" @;$c!$!c@; !`"!cڐ!0@r$*`0@ Ӏ` *a*! @   f! @0y!X㿘-p # :` @= "aĔ @4 2 ! % % \F!T@ڐxa`, 4ڐpax`ڐia@`  ఀ  `,`@`?` &`hڐVa!ڐOa#@_`d`4 @r-@ $#@rp`B% ,%@_ݒ  ,T  @_Ԓ*@  @ h@@  2-  @  $"``+@q!  h ?'  $ @qq:`  b @  *!̰ 㿘 "|`" A@qT"`ڐ"hp㿘 @G?" J ? (J? eaD   ` ڒM" @L? eaD   ` "L`* :@ `` N *` ؔ"ڒ%"e %h@:Ԓ  &4 &8 &&$`0&`,&`8&@r`(&|``4@r8? @r @_8?&`&?<``* &@"* &|?@q8?@q@^&@^@q&$@q?@q&,`&d <`` &d`( "#㿘e!`e@  6  :  @Qb "ڐ"t` 2v `  2q ` 2l ` 2g ` 2b ` 2] `, ,2X `0 02S `4 42N `8 82I `H H2D `L L2? `P P2: `T T25 `` `20 `d d2+ `h h2& `t t2! `x x2 ` 2 ` 2 ` 2  ` 2 e\%\  㿘< @@"%  (@" 4 0@" 0 @"`@  "``" @oސ#X 㿘"|`#pڒc@*ڬ`?@oȐ# J"`"x` ڒ@o#U*aJ"`2 ڀ   eJ"` eڒ@o#D #H+) e@oc@,`$@ n  $ "  ` "     e`? "`@ Q 2 y Y n NΒ@og y€ Y*! 㿘"`0"b@w" 2`=#"?" " " * b$ "b԰ 0@p+($  /ڦ ?!آ`$ $ $" $ $, $ @6"@G @C`0  Ԁ`"" 㿘"Ԗ"Ԣ %"`d.  "t 2 b` b  2 bԀސ#@tb  $t" "$ b$b"`$b  $ 㿘"`d .@ bx@x`"xĖ @& & & 㿘N` A` #@o` 2 8 @`Ɛ ``.`` @]&`"@# `  '`#P@@\ 8   0"@ d x* @>` 0  㿘"|`2@nn#ې P# P h㿘"x  @(a0 bJ!̀`')b# :`:  @@ "x"|`2x[  #: @o $x ,kx!g"" @u7" +`)5@"ԤxS`@a`@_ x @"%"ے"@  %bb  `р`"|`    ؀ " b` * x*`` !#x#*` *  ct@n* #x @mct@(@(x㿘# >:`@ @* 6ې!0 ے@qmW #!@* 6ې! @7]@m!  : )9/"d@qG"d * <` D @ :C  @*_ "d `@["d@nJ@nF@mV!P @n>@mO` "d@@Ͳ@@mF#㿘 _# >:`@ @*% 6ې! ے@st <"c!h@*  6ې!@m !p $'+@sQ @ < D @ :C  @) #@mڐ@la`#@@l#㿘"  "`8 4 c  "   ``8  "!-@  #: * J& : 2` 6` @ : * H" : @6`e`@m@Zː``@Zƒ, ` ` U " `Ԁ ې!`@# .#U% ` `:*"@ +@ * `; c` ` ` ? #@+*@*`bl 8@ $bl?$$"$$` `8"o `  8 "@ &^` `?w`  Nadېaad   #  `` ېa@0L  ?? $ad/'?????# .#'̠̐!''Ȑ 'V'  "@-f&@@* / @ .@Ȁ"ےa'''8 $ad ?.@|@*" 㿘"t`N @3 㻐# faԠ'۔ؒ$@@-&@q  "cP @5' a @)"㿘@,  @5  @5 㿘 '   !#N 0 U " "|` @k_"( & "8   & &="@p N!h f:Ԩ b  ''$ !ې"`@e   N!l'@, 'Ԑ ےbp'''@,'ڒc '' @i@%m!$  @)"x㿘 8 Np/  +-.`۔Ȓ쀧  '; ) @@2  8&/@/ 8 /`/  8܀ 㿘 8>0#  @ `?>@ *  @ *  *@  `?>@ *` @ `?"㿘 8 >  0 .@>@ *` @ *` * * .@ >@+ * .@"㿘 8 >  0 ې .@>@ * @ * * @ .@ >@+  .@"㿘 8 ">  0 @`?>@*` @*` *   `?>@>   g"㿘@X@F  @א  eܐ#@ a@1 @j "  eܐ#@ a @1 !8 @۔ @z 6@А!@@+!` @ǐ!h s &" N "b@ N "b<!@ܔ@7逤f `!"&@!& Ē @P   &#\#`#d     @C *     @; *#Ȓ @6      #\#l;p#x #`'#d#h#|    @B  @1N   ?''' @3  @3 @#А @#ΐ @#̐  N@"@@1X 㿀  ?''L'P'T'X'H'`L?`' '' @3”  ?`? #####`:   ( ("#㿘 'H'L'P'T'X@H@@*) 㿘'H'L'P'T'X @H@xܒa 'H'L'P'T'X@' @H㿘 N"D `""D@㿘@iܐ!@) @Q㿈   ?'  @1 ? :" @ޝ?!㿐'DD  ?   D@1 ? :@ށ" D"㿘㿘  @F ܒbP@ސ 㿘@u@) @ʒ ?ܐ"Xa@QR @?ܐ"pW@QH 㷀) f!԰'%ܒ$@&'ܒ⨔$@   @_< 'Ɛ"' @0" '' b@)i"@A#ܐc=''@7c4@)I @Q % N+#0? @  ?A&$@ ' N?@ ?@? :" %#`〢  #@Ԓ ?@ N"@ 2!   ݐ#@) @P #&" N '""<8! @&Y p@^ 4?  ?ؐ ''' @2>  @2: -" N"<1ݐ  ('耢' 0 '' @/z !ܒ@"ݐ @"~ (@Po ?ݐ `b(? @\  ?@( [1&@R ?@R?:" ݐ ba(B1&׀ ݐ bR(@4 ?Ր?Ԑ     N"@*#@?'@C0͐ : 21& N"<! a(@0P1) l"㿘1# "  @ :@" !0    @ &#  :" @ !P㿈 D# '''' 'D  :D@"  !p㿐 # ''   :@ܯ"  ѐ!㿀D# '' 'D  @% 㿘@(S 2  @* #ݐ@a $   a@ . $  㿘@   " @@   @@ @㿘 ) /  +@ , @0Z , &@( &  @ݖ᠒@ & @ `  & ("#|& $& $$`(㿘` @@`@'`@'@ @p$``@@ \y`  $``!`@ $``  ` @@`^$`  $` `!`@v $` 㿘%|    " (_ (^ 2 $|  1&"`g 2@l @n&1*!,㿐@\?  ѐ!0' @- @v 6 "  @@ @"@ @N 㿈@/ ` `? @Ɛ?w?@\? `"pk? g@@ip  @?0Z@O 1`  R$`  O$` ")`@` @!?:"   2 ݒb@kǔ @@N3 ݒb@k @@@&k ` $ 4 ``;"@&^ ` h@&V ' @- `@7@`@"`@N 㿘#c| 4X /   @/ 5 $  $` ("`($c| (` $"`$n0P?2$ *! N"b@@v $  +   * N "*  N* N @ @㿘! N$"@  #|@E & Ð ( "1 N  2 (?2& *!$"@ 1 N @~ ?""@"@ ? N"@㿘'| D  ?&  ( 2 0;  ( 2 @` 2 (  &  #j& "     ?& !  V!   @5& 0ْ@j |@l#| "1* `2 (`&  @  ( 2 1*!,| *  (2 *!,  〝㿀#|       @$  ( 2 #ܐ! P@c@1ݐ (@,ђ ?"> @Z?8 )  ? ''' @.v  @.r e" @+ !ݘ `  (c@@I"ݐ#P" (c@@L @ 䀊   :  2  ݐ#4,  @??#:" "$c@ ? @ ?"cc :" ?:"    $#p@1&"㿘#|` `  "` `(`2` ܐ! c@@هP ݐ#.  @W??!:" ""1&$#@s ? @@ ?"#A# :" ?:"   $K#p1&"㿘@ (   @*`2 㿘@⪐  @. 1'݀ n L  o  @: = 2*`"@C 2   @2    &*@&c@  @㰠 2L@i(8hx <l(X`0 f! #'@Ւ`` ?'$   O"`d"8",@ ސ h@>a,  ަ ?#? `c"0@"@?Xc' ''@@"@X''?' ^c'''(@!:9 O%7 O/-;#@@ޔ?B? ;:,* @€ 3"8 /#aH@C" )"a "@$`""p@3" O #`D"@א`@'"/' 4"@̐ `@" #a@"@0$ $$@" O "H"@aH`@" "aP"@h〤`@" &0"@؀`@" O #`P"@̀`@" O "T"@a`@" "aT"@w`@" O ","@kb`@Ż" "a4"@_(`@ů" O "8 c`"@Pb@`@Š" O "`L"@DX`,   N O"cp\`u`"@b ސ  O O"`@g"<"@∀  O O#`<\" @@bY`@l" O R"$"@M`  OH#`d@\" B"aL"@=`@P" 7%<"@2`@E" +#a0"@0&`"ޒH@鴐 2 `@/" %X"@ԐcP`@$" O  "`("@Ȑh`@` `!`*`@ & ,& ?@?c@@@Wې   ?#8 @a?0a, 3@ @ +ޒH@c &ޖ$@%ޖ㰔$&@ @ېޔ㸘$@@ѐޒcȔ@Đ , %ޒc@5   @*! $ " @. ''77''/7?''''7@h / 2ޔ$c@ah?ah@f? ސh$@caha8 K?@   ,:@M ސ@,@   c:@?b ߐ @c@ϙ   % r,c @ϋ  ,  @蹒  ߒ`@賐  ,,`T@ؒ,!',, p "@W ap@ 0{@`  '$:@b ސ@?c@@@$  H:@b ސ@H<   a, 2 @ #"@` H@@ ?"J?``?@ $$ eD `@ `  $@@m p$@+M@  eaD `@ `  `M@* :@ 2 ` @ @NM@ ` <@ @EM@< <@%<<@  a,  LM@ @0@L  H "L."L0  X0 "0@@!8X  , %X@@ !Pa   O( #a @@!p O`,?L"`,4  0J "4 "40   4` &0((*(&0 4  O ` @M`  ' 40*  4 ' 4 OD   4@`*@? &  O#`DaT  O0* "aT8  O O<  O`@?`$ eߒa@ eߒa@   O#`< O`$? O@"`$$ OX(@#ahB"(!0@M:X O(8"   "!\ ecߒa@t"0P 2@ 42 "P@'`'`'`  '!"#a(@_""" X@_%Xh@_#aha\@_"\<@_%<@@`Y$$@"!`&a:` "" X@L%Xah@L"ah\@Lے"\<@L֒%<@@LҒ$@a\@_~< " @   @ 4 "@#a@@^|"P$@Q!(a b@_\"@L@ $@`&a@@`:` $@a8  @(8  @Ē8 @@$,`@U?  @n `@& @_b@E$0K"$@?'#)%@ `@! `@| X@s ?` Z@7  ?@e` ?@% @ ?b@|ې ( :  @%ѐ @ӯ`"@m @k @n@3 @1 @/ @" O``?'`' ''!D '@L< O`' ```@: :@%b @% 㿘 e`e@ 6#3ap  ``@T}"` ap@' 00 @|" O h@#㿘!``6(6 e`g@ @|"ߐ#@㿘'H'L'P'T'XH @5u    #b @F @9 @I@|@%@ 㿘a,    #"! eb8@Ր#  #"! ebp@̐#b@ǐc O`` %, "  " c@  ,@%   f!'D''H@&ِ  '"b@@&А  "b@@&ɐ   "ax@@&  "b@]"@$ @fa,  !@K.<#\   @&n??$!D@$ɐ !H"b"" ?"e,"e(  <"%("%,!<"@\ʒ @$  @ 0`!X  @\"@$ 4 O#@\ @$  O PT`  @\# @$  O#H@\ @$|  4 O 0 0  4#@\@$n  #@\ @$d a   #@\w @$Y   @\n@$P   @@\f@$H  ; ;`8 8 H L888@ P > "`P 4 " T > "`T0"`T:  "8  > "`` 8  O 0  4 @\%:@$  L 0 22 4$%P$ t@]$ x$ |`|"`d > "`d O O\`X4?@\8?@\@J5&@\?@\ܐ@J)|&@\& ?@\̐@J?& &?>* "`@* "  0 *` * ?: ;%0 `t:`@<  e0@B:  "cX"cX @I``x6`?@](@I’`0*` @\m?@\i@IcX @\ax?@\\ @Ix x `@\R:   |@I  @I8  @\D @\?@I OD$ `$  4 $%$  %P@Iz*   ,`@,:  @Im@\ | , %$:` 0 *@I]  ` |@\ *@ , :`@?W#?!\a0 22 : :`"\;"0?>#@k`0 * "`0>cX-`* "cX@[В@I"`8`*` "``"8 4 02  8@Z͐ @Zʐ @" * `: |* # |# 8# `# 4 %P@H*   ,`@,: @ @H@[ | , :`%$ 0 *@H  ` |@[*@ , :`@8! @HƐ@HT@[o"?`x @[h@H$`7 `8  @H"`0=` @[O* ?`x@[I@Hx@[C  @ZQ ` 0 8::$ `$ 0$ 8@[/@H|$ P@Hu,`*  @`,`: @@Hh@[ | , %$:` 0@ *@HX  ` |@[*@ , :`@ @`0* ""`0`@H=T@Z"`x?@Z@H2$` `0@Zܑ,`x?@Zא@H$r` 7 0@Zˑ* ?`x@ZŐ@Hx@H "`0 @Z* ?`x@Z@Gx@Z @Y!@`` T@Y!`!@Y` @Y!!@Y !`" O 0`4 !@Ya" O 4`0 "@Yb0@!i !@ @" $ """@Yp"H ?@ZV@G$`$  "!@`@GT@ZB"`x?@Z=@G$`0 @Z6* x?@Z1@G~T" @Gr$@Z "x?@Z@Gh $ %P@G_*   ,`@,:  @GR@Z | , %$:` 0 *@GB  ` |@Y*@ , :`@!\0 22 : :`#!\" 0ePTC`" @G$`@Y"`x?@Y@G$` `@G*  `, @,: @`@F@Y | , %$:` 0Ф *@F  ` |@Y*@ , :`8`  @Fђ |@Y$ @Fʐ `@, @X"@ h "@X~@ ` a$ +@'` `@ Q  @Xg# `"@X_#0@X[#H@XV#h$`@ 3 P@F*  , @,: @@Fx@Y& | , %$:`@ *@Fi  ` |@Y*@ , :`@@L $!<d|<$$@FO@X@FG$ఠ@FC$ఄ ' 4@W#@ܐ !4  OD ,ehL @ !h L  h XX@FP* #X @F | `@XÓ* %P  eh`#\%`$%X$%T%``"%X"%T |`਑* *  8#\  cА#@W ("cXD LX "h *" %P  - #\?"L?, TP@E* 2%P cXܠ@E8 ~|@E@XQ@E@n@XH@E@E@c@a@E@\P@E@X4`,L?> - #\ T@Es* T?eL?2eX`@@*,eL?2eX`@@@L?,- #\ TP@EI *  ",@L?2T- #\P@E6 * 4`8@Wؒ@ $, $, x ` @Wɓ:  @ $  ,8 ? 4  @E @E. ༠ @D$&( ,@D@D.  @D@W8$8@W@Vh @V@| ?@Dϐ $ "@ b @Dƒ  @D, @D $N28* @|@D @Vm @O @D'@D,  @D8$@WD@W@ @VO@D|@VGh ,$ , @ O  "@$ `@Dt`@W"|$`$`d`$* < a, <`d`|@D[:@DU?$`"@@V! ,# p%D*  0  L2  # #  # l  > "`p @ #"@U!@Ӑ  O H O 8F O DT!P <L$%\$ @$ <$ X@V$ \ O`<, $ D$ $"$ $ $ $ *  *`@q",`/"|@C$`#\``"@H@U4"؏$"P#`' '"H$ H#\',?@U Od @U"@  , 8 153/ e@ O`d 2&`@C@C- ``d ,  d@z"@U] @UYbȶ@lH `, Od 2@UH"!8`, @! @R ! @V$  O\@} `T`>``0"`d *  @g 0   `,D@CC```@C>- `  O\ `d@G,`,D *  f4" ;*  2! @P"Ё㿘" @C $4@C.@B@༴ @B@B@@ &%@4?@U @"!.@ࠒ "@w@""U$ $ $ ,?2@ 4 4 &4 $ $`@Up8$ p $T`,  $XeP@B`* $\``,`: $`e$``@B`@UQ| , `:` '$d@B`@UD | , `:` ?$h`h` $`h%$ * @$`l @B~ `|@U**@ , :`$`ddࠐ" $@T-"@ %  '" @"U  : ` "`\@@  ? $+@* ?"  ') 0'  @x,  "l0 2  "@B%```@B . ` `d`0,@*x" 8 " x ` @T: Ԁ @"U@T`8`"``cؒ@@%$`   l;  +  $  * * ``$`@A |@T * `"`T`T@@ `" |@AŒ @  @Tp@A @A@ @ @A @ @A%P@T] * " X@A@TQ*   @@A@TE @A%P* @@@ 4@`8`("`( (" 8 @ K$ ( 1$@*`4  "  8@ %@'@"U ``: ` "``@@ `` ? %@+@*`$@ "$`8@"U@S`8`"``cؒ@@Ҕ%$`   l;  +  $  * * ``$`@A |@S * `"`T`T@@ `" |@@ @ ͒ @S@@ @@@ ’@ @@ @ @@%P@S * " X@@ڐ@S*   @@@ΐ@S| @@%P* @@@ 4@"`86/'*`4 @ U"    ": ` "``@@   ? %(@*" $  "$%$`9  l  p  h  `!     %$4+    "  ( @ ``p怊  %$4+   " ` $`$`̐ $``Đ $` `Ȕ$`'@'` '`$'` @@4```@@/. `  `d`0@:,㿘!, a"` "`"`#!4a!Ha `4  O # O !@$a: < !"a@D4"$(`Le@ :`B *2  $hb`d`4@* @T 㿘 " "  `` `6` @v`?$ @ a, @*` `2` @d"㿘" !d*"@"@`"U-#` 2`&# ! b`"c``@8@R:@ɒ "b 8` &`#@@Q< 0"@``Ub@ >`@ߔ"%$`b   l: * $  * +* b` "?#` # @ ? "` #` `#  ""@?5 |@Q b* @"U@"TT "" |@? @ @Qɒ@? @?@@@?  @ݐ@?%P@Q b* @"U@" X@>@Q* b  @@>"@Q @>%P* @@@?4@"`0E`4@Q "`8 "@ " `8`̘#b@ #`$4 "$`8"@*`   `8 '"@"U , : `"``@@   ?" +@@*" 8 " d*@b?c@'!& l d*@i""@"U@" @P>#@  6`\? "  `  * @*b d"@w*b""?",@>X@ #p@P@  @Q@>H @Q * @>@  @@ @Mp@Q x `?*  dc @,@  0@@M^x*  @ː0@1㿘!,` ! @>D@@0  ; @裑>  b@Ȕ @O#@#@ "㿘!,` ! @=aD@0 !8`  ; @r>  b @ @O#@̼#@i $㿘 8>># 8 2 8@  `?>@ *  @ *  *@ `?@ *` @ `? e#@גcа 㿘 8 >   e  e.@>@ *` @ *` * *.@ >@+ * .@ 8#@c㿘 8 >   e  e .@>@ * @ * * @.@ >@+  .@ 8#@y`㿐`h @?   @ (  @ " P㿘@1                                     T T D T H  T T 㿘`0@Pܐ  "b, +@)#!'%5 `79 "* a@€ %" $b$"$ $"$ $b  %,  $(@@pՔ8?ߐ?* & @ b @@@  @ } & @0@@4"0㿘"`  "$` " @   "(`2 @s 1: @m ?` K@"*` € ``z`! @@ܐ @mEm`!`@Ѡ @@  2 ``\`! @@þ @m'O M``@`@ F@X  @$` `   2 `8``@`@ 2`8    ", ",@*` @` ``@ @M`  "`"  `@l H "b0@ڐ 2u`8" `P@l| 8 m 975:3% +<;/-8@Y  "( 8!7F " @8 @l`@E$0  "` `@l4$0  ' @ "( @鍐 @*? ",`@@M "  "@l5`H$0  㽈 f!Ԭ'`  @ `<  ` ` x@l8Ԑ @0 ?@9H?P*$@w `@kϐ  @`02@    @S)v@ <d <`耤@Pc h  @  @` @`02@    @RH@ <d <`耤@P5 :  @  @2 @b`02@    @R͒@ <d <`耤@P  @ @v `"b0@v H@k` @  x"$ faԢ '! e`Ȕ@Đ#0," `Y< ( S@ޒ  "O @Β @]4 @]a O逢  0 ! e#\`ؘ@혐#@ &# e b`? "`@ "  &" `  e" ? $ @ΐ"  &"` 2 `y `Ya԰ a @ H!㿘 @ %#@T ? (J /"*@S / J .2 J  .2 J 2    @jՐa $0 `&   &  㿘 #" ea(@#@k 㿘@P@@S /`""@`@"@@@ʒaЀ  Q "`   @풐!آ 7 Q!%:!) `' Q- P/ P@@m!? f!*@`&  @ `  `@~ `? `@v`@q@# : $@ :,@@x` @  @ '@ `%`@뉐 @' 2    " @ @ 6 :" `  Q `"@i @  4 @`7 @ ' J` @b@E  '  W@  '  a@诔 b0@i  @@a@虔 b8@is @  @@j 㿘 QR  T`"V@2 V  @Jt"V  @," V @'" eH`? "`H * "HV@JZ"x0@   "  @JO $ 4"  ( ,@JG 0㿘  N  #@J8#@J2u`sN o e cH`?"``#H <* H$#H@ <EN * @:`#H` ,?"``#H* $#H@ ,* : %  e#H :?`&  @  #H* $#H @* : 4 NN 4N`#H`?"``#H >* $#H@f >㿘 Q ` "@ e#@4c0"@ e#@-c0@ 㿘@ + @s! $"<@BE$"<Eb@% @"886 㿘@h#`@2C 㿘c`@ 㿐 Q <`' Q#@̯c % <c@ @&@a $@c@ b< @X @  <,@A 2 @4 $<@ <@< @#@  ?"b8@ ,'%?#<'$ "8`@  "8?c@ژ $'"8  @Ҙ 㿘N # e*`: aD @ `  2  _ - @h'   N  㾐# faԠ'!@ Q "`8@Ra @A#㿘! Q 8 #@=`$ 8㿘 Q 8` `@/   bH@{`,`7 "H㾐 f!Ԙ'  ?!@쯐 @ a @ (㿘@ 8@NҒ@ @p f!Ԣ'@E OЀ E F AА@;$ 8@gOЀ F? Q" 8@ ܐ@J@ "*@ @@gx@!Ѱa @ x㿐b8 @K OO㿘`* :`` ,, `  @gF,@gB 㿘@㿘`@J> @ 8 !  %:'- `) p @LD 2`@l @Kؒ!@r7@@j<Ѐ?• m* @@`2@@@,` -6 @@P @?` @`J /"*` 4`@@!4  4`@@  !( @@KV?2@@f  @ @t8 +-@$I@DĐL `?,@MÒ :b  `..`2 @l   /@fl`?<    /@ @f? /`, 㿘 #" ea@ɐ#@% 㿘@ &@ & $ %p & ) * )L (8 +H ,T ;$ ;8 ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ;$ ; ;8 ; ; ; ; ; ; ;㿘!@!"!@ @#!<*` @ B* @$a4`*`@ ;!$!8㿘 -@(   ap@ h 0  L   e!D*`: ?   `   L  *`  L #"ϐ ̐@ &*  *@$L!@̭ t @  @$  + QL   e!D*`: ?   ` " L L  *`L ,2J$ L   e!D*`: ?   `   L  *`@  @$   L   e!DL?   ` "L L  ?0$$+ QL 2 a@  ,M```L@" L@` L@  2` L@ 2`La@ ` LaА @`` G#*` € L   e!D*`: ?   `  2 L  *`2   * * @$ L   e!D*`: ?   ` " $ L  *`$L ͨ  $b@& " L   e!D*`: ?   ` " L L  *`L ; Lb@  L   e!D*`: ?   ` " L L  *`L \LbH@А  L   e!D*`: ?   ` " L L  *`L Lbp@ @3$ #䠄 'L   e!D*`: ?   ` " L L  *`L bb@| b@U,`$ ?$& @!?$:@b bД@b  L   e!D*`: ?   `   L  *`)ؠ L   e!D*`: ?   ` " L L  *`L $ b@$  L  8 e!D*`: ?   `   L  (*`@ʐ$ @ b@ @p L  \c@֐ @ @9$ 2cH@Ȑ @f?@ L   e!D*`: ?   ` " L L  *`L ;/) @q L   e!D*`: ?   ` " L L  *`L ;  ch@o 㿘'D @. `:  h'D \ c@Z  DD] Dc@O DJ Q . : !J [ @JD @D @:#;D \2 JJ [2J.@# \2 JJ2J 'D \2 JJ n2 J .@D``'D \ J \2J.@'D`J".@D @`.@'D`DJ    *@J`^ *@`J] *@`J@ ]=*@ J[(\J . : = \ `*@J` ]*@ "J& `(8]*@ 2J 2Jn*@J` ]*@J]2 "` 㷈 f!Ԓ '%  @ &@@C  &@@ u " @@]@`@r @`@ *"@a @U 㿘   l ,@`$@ @# c&`! `&`&`@  N =/ : 75/*`:  \$ N@Ȳ0 "N,@N``   @#@`&&` & \2 ,@ ` 2 @` ,@N` $@%h- @"@D( 2N`@ 㷈 f!Ԧ'D' ?&@&` &`&` %# eD`DJ@8DaDJ@?   `  D 'DJ (J@DJ g  p 9 ; 1 | zDpvDl wDf値  @ b&@ _&` @DD@. &@T 'D !J  aDJ@?   `  D 'DJ (J@DJ*'DJ  2 *`@V @/!,`&`& @!? &` :@b bД@@  DJa@: D Y'D @ !0 f!Ԥ'N  \a@@  2?4ac? 2N*a  ? e!D*`: ?   `  ? N  (*`?#@@a@ސ  @  +@  (+@?O#`  +@J &@ @"㷈! f! '@r A O耢   e!DJ?   ` " JJ  ?J `\2 J " J "  *J  " $@(,`@/@(  ,@3 @L"*㿐N 9 \ 06  $ /b@ ` 2&@b @: &@ &@ &@@ &`b@@)  㿘L@   e!DN?   `  N 2N .b`@ & @@ 㿘. ?* : `#H *` €a< "a< & @I &  bx@Ր @j  2 㿘    `,` `*`"@ @' 2  @Ȋ 2  @ 2 @` $$ $ $ $㿘 ` ,`  `,` `"*` "   2  @U 2 $ 2  㿘" *` `'   @X @j/`2 `*` > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > >㿘 +O)#!:'%/ `57 e9:#;倢 /8 e* a@€ %!, "@$a(" @    $0 e#@c@T @aД?ڐ?a(* ` @ @`@ `F@  @@`@ 0@| @1@ @WH @" ch@ @ 㿘% QȀ K!  g0# #``2` €"! !5 `@Åcx€  "`:b @` c@ `  "$$`! @   c@ `  ” "a$" $ @ a   "a N #2Q N  nM "!0I ` @"`$a   J`# J  n "a0 *a  J    @ $`s@# *a  #a ** a ` # #a `*# Ք㿐 `?)'@ב`$ ";  ! ec"!$$ cx@$!$  $!$:b !@#@Ԑ `? "`@* @  "@@4 !  & a %!^  Z%!@Q `@:" " @a$c@ @n  e`#" #+31':@!`` $``!$%a$ $!$@kcx  $!$@  @o#`? "`@Ő @  "@@49  㿘@  Q" " ""@"㿘@   Q" "@" "ā㿘@g  :@b c@4 㿘  @h+  :@ib c@ 㿘#`Ȁ @g@Ŗ ͠ @$``ȁ㿘 e'L'P'T'XcL@#    ! !$c@#@⤐##@` @B  N N N N N N N N N N I N N J Jp N N N N N K N K N N N N N N N N N N N N N N N N H H I@ Ix N N I J` J N N J N J N K L0 L| L M N N M8 M N N H N N㿀"! '1-!@ "@ `?Ƒ* : `CQ#d*` €`%<  !“**@ !4"<;*`$!4*`!4 * $ " " ``O! `^K`  \"`  X0 @  J$   ?% " @$ >!–  @ 5@! ̀  `X @  ̐@ #@    @ @` @< P@@ @0  `  e`H@Ē @  @S " @  2@!0` `  e`H@آ @9 ` 2@` eH@ؕ @  2@  @  ?%$  e H@y  2$ @!0` ”` ` eH@e @@ %<  !“**@ !4"<V*`$!4 *`!4 * $` $ @` $ `{$@@t"a "p@`m"a `2h@`?` & @ !? $`:@b ` ``L `@B   J:@b ` ``; A@%̀ `X @ `'`'` '`'' $ $ "` "`"`$ "` $ $ $ ` 2@` ? ` @- @ @;} h@`m0  `  e`H@׷ @   2S$ 㿀 ` !   " `p Ɛ  @ ۰  "   @  c-P? -  @f = 88@8   8  @a  `@͒8@`` `   @  @I 8  @C 8 ` $@- @4 ( 88`  $ @  @ ?288  $@ @   `@8   $ @ @     ' " $  ''  %  $  $ " $ " %"  ''`  eH@  `"0   2, ` ? & @ִ! ? "` :b @A  ``  `  @@   : @.b  ``  ?c f!°a  '7' e?#/-, 4* @  #a@  @ևHa@`@  @yH @0% @8aґ, H `@ :" " @` !"a%a@s 㿐 Q"؀@' @$ؒ`h @  < 2$ؐ <$N p! e ؀&N@9֐  N`' e!D `@ J` ` `*: \#H`?"`` #H* $#H@X 8#H?`Ȓ \"& #H* $#H@B \N@ #H"@?M " `  #H* $#H @' @9w  N ؒ#H`?"``#H $* $#H@  $#H`?"`#H * $#H@ #H `@ :" " @ ` 㿘,  w@: & \ ?N? eaD   ` "?N?Ѐ $'‘, :  \2  N \ &2    @   P&  &  &,  4& 8* ?2 )?2 ?""  $"  * 8  #&  &  &8@ @ @& ,   @   &  &  &,㿘    $  & && "&  @ @& * 㿘?'%:?N  w"!  { s" /"* + ?" @    @5  ` " ?"& @ "&  @"  ג`& 2N 㿘 °`"!   2 y  `"]  2  "( @  `š `@l  2 _  ! ` "  U !`"Q  * $  &! @  `š `@F  2 9  ! ` "  / !`"+  @2  ! ` * &!  $   š `@   ! @ `?! 2  `?㿘  !` `4  "! J?` "?8    ;; !!@`a8@o  "  0  !a 㿘@_ 㿘 "&@a  &㿘@a  2@a @G @& & "&@ 㿘 ??`@a   a @Gސ  "&$ `2$@ 㿘 ?`? "` &@ `"@@a i j j j j j j j j j j j j j j j j j j il j j j j j j j j j j j j j j j j j j i j j j j j j j j i j i j ix i j i q p| q qH p o qH t s s s s s s s s s s s s s( s s s s s s8 s s sH s s s s sP s s s s s s s s s s s s` s s sh s s sx s s s s s s s s s s s s { {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {0 {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ { {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ {@ { {@ { {@ {$ {@ {@ {@ {<㿀ǐcJ   !#"   P ?" "@iAa@? L"ВJ`* l!H@ݐ!h@ِ!p`@Ґ!x@ Qc@ 2[S!  2 a@ L@ Qc@ C <! 8ctJ  0!@ t'! @"@@ t@@@ `t@֔ @@ѐt@@@@˔ǐ!@FDs #$' 'k$' '@b"@\/' `t@j̘@@kS@փ  "@F ; :@jb "0@F1 @8U tJ@ @ J@ /  @k 쀤   Q@k@~ `@k{#쀦`急  "8@Fj 㿘J#-#%"   P ?b b@h=@? LbБ* `@E!- #tJ` @kl @  &  @j  :b @ @E"@0@F"8 㿀 J`e3    L - L    L  n e  E`2L  k   f L -b L   \ "h6%ǀ`63X 8*` €`"p) '`%  @F䨒  @E("x  ` L`  @FH䨒 6 "@E А@g?ƒ?  `Б*   @a   А?$Ǒ*  '  ' '' {`h ?" @b]`Z \2Y*L f0  r a"O  b 0".  \ A \B*A \>* c \8*"7  t n \/* v \)*( ( $ "     А  *`: ?Д  А  *`. : @Р? \*L    * 2` *`*#< ` "`@A7 " 쀣 "@|`쀦  `':@:) 6&` @| 2 @{u` @| ` @| 㿘 J@  w`?  ""!"  v ? V "    "@fs?耢 p"Ю *  `2 ?`2ͮ ̀   ` !Ǡ#D@x@yf  ` !Ǡ"@x@yX  " @5.   `"@D; ?`X!*` €|@D,"x 怊`"" Q#@D "@D@f ]Z@D " @D# @C# 2 @C# `@C#(@C#@:7@#h Q#@Cސ#P* @CԐ#x   " Q#@CŐ# @C" @C# #@C Q Q@C#22`/ 㿘㿐Jc      r7 s e " t  "# #$ ǔ"  `"  5`9' X!0*` €" %" % %" %@ " " %  $ % " ` +,- -"@e"?Ȓ?`'@bc " `'@bZ " " ``"Б* `J`-`+ `J  ` $" ?#@@Bh#s "Б* `, ,P @  - "*"Б* `C `""Б* `64`"%@@@wX@31 ` ! "*"ǀh!    @@~B  `@ "=`@ Ѐ` `8  @x-@ "`-+1)怤-- Ā(`    @~  @@Bm"8@ `Lװ 0@Aɐ (԰  ϰ @w@ Ģ`"  `` @ "`    "@0"+-5  " U`R`@B @"@B P @B X$@B  ` @B h@  @Ap @ @A x@@@A @@A @@A @@Aڐ "8@A֒ ? 07 "  @AƐ    @A -@A - Q " Q@B@A  "@A Q@do Q@A# "@  2i@ BL5 㿈ǒ` ǐ "` ' ''   #瀊  - +`9X"*` €#X  '  # ' В@cE`В2  * ` "J`-`+2 J  Ǭ  ǐ#`?` @A/  @c @ސ ڰ 8@v`/`;9Ƕ =5 Q@ 2"쀢 'ǐa8@k!ĠĐ`@k+ `2 @kP =0$ * $ @c` @@`ڤ "5)97 =@ $@@]`@ug`<`2:`27@u˒ ) $쀢 'ǐ!8@k[ĢĐ @kW+ Q`2`@k =0$` =*@`$`@cu  Q@@#P !@@@ H'@uŒ`  `$ `" `2(`$ 2"`` $ D# ` "4 @2  `" @]=# $ `$ ?$+ $8 @@`$`  2l㿐Ǣ"  !%" t ? a" "  #X#F "@bX?〢 d"Б* ` %@t@u 2  `" $ Ӓ  ?$  2@uv   $c  ?$@ul 2㿐   @?E!`0  `? @5n   㿘   %'"  p ? l  z   ?% @ap?• nБ* `2 @F@ 2 @F8 2   㿘@axǤ cJ` `? #@>ݐ!(  Q@aZbЀ ?b * ` @Dǒ ` !@D  J `" 㿐 Q#8`+     #\#`@jW0   #` #\@jJ㿈  1 L -.# ǐ#ԓ* 2 *: ? eaD   `  @u:  2 !$ @ZaЀ ) ' #%"  s ?b" b@u  2 b !@>@ް bА@`؀?ဢ lbЀ  Ǔ,`   a@iѐ! Q@>!#    * Q#< '%@]ޒ  '?  *`" @>8  @>@   J#.` Q Q#<c ' Q%,`@>vH`` Q@>o#u  ' `'@.V   Q#8  ' ? @@4'@@4 ? ` !Ĕ  @aY >   6+'L % @C= 2& %`@];쀢 @=bP ?  @Pm  :`@RԒ 6 `:b @ϰ @=h•`,` 2L㿘 J#.`  !ǒ@_ϐ##$#" 㿐! Q@_˒"Ѐ ?" * ` I" B"L  @!J`"@=$ #`L`2b@=M u  2``?@&  'ǔ*`2㴀@    *`@@  @"@< 0M$ @_n  `? `   +// /` ?///`?㴐" !@|#  {b&#  " @d  `@} 0@~V @|@~Q Jc`?    @I ` 㿘   !#"  m ? " + "@_ c(?쀢 l"Б* `2  @ @ = "*@`@Ֆ 2   2 L \ \ \ \ \ \ \ \ \ \ \ \ \ \ 8 \ \ \ \ \ \ \ D \ \  \ \ , \ $ XHf`?㿐##` Q@^bЀ ?") bБ*  @2X   6 @<    +   "   @ " $ $ @<  x f!Ԥ '!# S" "@^v`? ?"Б*  2;@児 * 2 @偐, Ș`Р8  =  , *.  .   < " . . .? @  ǔ ""8`@8m ""8J`r`#` `@?* 2  8` ` !#  @?V  $# @T@T?㿐! Q@ZӒ"Ѐ ? "Б*   @X L  '!@85@ #*`2` :`   2* 2 `:  22 2 `! @7   ?4`a#  @7 J@ b  @Sܐ 㿐#  `!8 @Vt /  %%`*`?&@U<&  &:``$`* $`&`&   J ` #Ё㿘  !#"   v ?%" "@Zb? f"Б*  "()耤@w@ " $!x@7`  [@@ @|8 @( 2   ߀㿈@ @!@7@ΰ @7"(@@78@@7"(`@   R""$"b(" d@"k/ǪO@Ր    @ ' ǒ"@ b(" $@  ''̲  %ǀ`""P"`@{$!ǔ@b!`""p"@lȔ@b`"""(@^@b@_|x@@YX 'ؤ!" p :  @ *@@6"@6"Ȑ@YB"?倢 ?؀ "!@ %Ǖ,  @ `؀, ؠ *@` $@*@ , `$@@   @ *@&@㿘 !^?,? .`?,@#  0?,@' `` `㿘#` "Ǥ# c. ` R $L@PL 2    c R@" @!  cc"   0  $ , 4 T  $ | h P D  , L L L L L L L x lmmm#`$d'''' 'ؤ,`2@a ,, @a @5!h f ,  ''܀Zؤ V Ǩ#+€  ꀤ#  €   @ ؀`ʀ0ܐ?'܀  M `@aȀ "'  @ `?`?€  "'ܤ'@㿘` h!0N  N@ *`: N`2`@i 2 `@  `?怢 `N@ 2N` Ȁ  `#i!X*` €-N%NN !`? 2@R '4'4ǐ#J '4`?@x  @s @n @c@+@Y T <  D @M H < 8 @A < < , @5 0 <   @) $ <  @N  < ( @   < 0 @   (@   $@   "@ @  Ȁ 4߰ ̀ ذ  @T`4 '4 $ 4@G'44@’  " @ @  @11@ `? @T> @Z: @T1 1@M3@H2 @C  $ 00@*t  ,@*n    r$`-i!@*` €0, d`?0, ^@ 0,@Y W 0 ,̀@0,@M K 0,@F D @) > @)8 X@44 @)֒8 , @)В X@  @)’  @)8 8@<  `? П  㿘@)8`"`@)  <   I  ?  ` @0@㿘@  2  €  2     `?㿘@ 2   €     㿘@ "   €     @ 㿘   €  `?@㿘 2m  €   2_  €  2X P  €    2  <(/   2  @+ €    2  X  2     @p? 㿘   ``? `   "*` @`?   $  ` "㿘㿘 .`   ` &@2b"0"@2] 㿀J!`!``    /ǐ H-a` S* a*`  * * f"  a ?' H" " @Ta`?퀢 S""` "L2  `@2@  *  @ 4   @1 0 @` 2!#?@(  䀢 #ԓ*` 2 @1֐  @ : 5b vb#-+' 2 @耍  2@2KЀ2 2@2C` : @ @28 2G  *@ 2?耍 2? @! :"  @ܰ @1u!0! 2 #2 2@1   : @; @1  㿘?#!p!p """ " Rn""a@iĔ !  Qc8c "c @ "at@s *ax„  t㿐t 4#c."t RcX@`h %    Q"c,!   @t "@r  !    @t @r㿘!t`@r ǒcJ` J` @ J` @y?@Y 㿐 #h`  @N @hD @J   @U :" `ǀ?㿘@YB!㿘ǔ!`2@[ 0"* "㿘N Ǡ!   ?*:  @[s N$  *@`$  N H fp aԀ' w"pȒa`#'`(ap`!'` R'`'`'`'` '`$'' ap' ' ' ' ''a` Ӗ w$ap !x'՚ & & & Ԕ & X& '///@n/L!xap 2 ?$apL!x  L!x?& L!x L!x?& L!x  L!x?& L!x  L!x?& L!x  ?& @z  " @   RcX @naذ @!(J   J 2JJ- + 8`(8  J            `?J `2"@ 㿘@' / 2 !a0 ,`,  @<  @MΔ 0``,`2JD #    " J# * `J `? 񀠠"'   J "  &J ?  #J 2 * *  #*  "㿈g @ a  @@-  @ ,`@  @$$`@M,`` %@  J?`/2 `;*`'' @' $< , ;, @''',`@@"`@' $< ,  , @'''" ') ' @$0##`( @21Dz @   5N@ \@ 2.@  .@   N@  \.@  #<@B`"" &#<@;_ !&#<a@@. U  浒` '''c$ @ $< , 洔, @'''"@`'"@ 椔    . `2  @H @$0 J`2@( 曒` "&&㿘 @@`@%  `"@㿈`ذ @#Ǡ@P cs`c >` '''ǔD@0ǔ@+ǐ@&xc    @ L  "4@C@n!`@o  Q#@5">   &c-` Ac. * `    $@@ $`2 @o "$`$`` ?qᐐ@&   c,  &@  c`*(@O?  @r  .&@cϒ` ,`@.. &@ @' c$< , 嚔, @'''"@`'c"@ 劔&㿘&' # \ǖ *`*:  ' " ` = :24Jǖ#Ԁ! : \2  &  *` *:  ' " `倢 = 4$ N ? eaD   ` 2  N @r!h ` `N / N /2`?'&㿐\`o '   q q!p#`@  `$  $@$'@㿘` A #`@I.N '%L \2LL  "L `*`[`?`$"LL  (2L@p  L /"  L  \L  N ~ *`.@*`㿘 $ @a@ @*` @`@K@J    K@ K @" @*`㿘 #Ǒ, @ " cm` , ce`㿘`@"" (NN / ?N /"?N /2?N /2& *&㿐@a @K @` c`$< , , @&`&`&@c@I`@"@`&@@aƐ #ǁ㿀@Ɛ c  ''Ő' '耦r@% : @@ܬ@ `-" @I @ 2 @,  @`,@   /,  " @H@ה $@< ": 6%,",'@ @䀢 6@䀢 c@,  $@W @@㉒`?`,&M@`|㿘 @k!x@l<  ) ' ƀᘐ ƀ &@? @`N@! N@ ƀ 〦`?`ƀ㿐""a"#a#!"!.1# Q#,%´  !– "aĦ #(в#!#a $a$"a " ’"@"##a#! @@ !!Ȁ`#<#c#" :  *@#?$!#a 1@  6MI " %""!ԓ*`@  @  `* @*`@`  aЀ 6"!"a* * "!* @&" "  0 0 `".a0"@a` Ɛ @F  㿐 2/@ x 0/1!?? &!@C!&! 㿘✀ @ _ 0aؑ>  *  *` "J ""✁ 㿘#a!@ !! "@⽐!@⹔!a@$!$a@ 0 ?㿘!'¢@֐ ?@ "!1a! `?"@ϐᨀ  !@La8? %! 㿘  㿘!a!@   ! 4$!! @B"!@ 㿘ᔒ@@Ӑ 0 4"@  㿘 _̀ % @ """̀`@a?" "a  )L@M@ ᘒ"@@U%!!`" `4@  @|  "a@ j%! ?@L?㿘@  㿘@ 㿘@d a@㿘@[  㿘!  @@ 0IḐ??B# e!D   :  _ $ -J?   ` *!DaJ?   ` 2 *:  _ $Ḕ  Ḑ??#@W 㿘!  @ 0GḐ??B# e!D   :  _ $ -J?   ` *!DaJ?   ` 2 *:  _ $Ḕ  Ḑ??#ḁ㿘! a @U"!0a  !$!@J! !0  !J@`@Z$!!!㿘@??@p ??㿘N  * @ : N`   eD    㿘!@ 6N`a   @: N  a*㿘 ?@U 0 eaD   `  ` @ ^  ? @@ @ 㿘!a@   a 4"aa S"㿘a @    4" =@㿘!a @*# a??$a%€ ᘀ @   a@ a@ 0??$a  㿘@!–!??#!” a2J@ 0 ! ??#! 㿘@ @}  ! *@`"! 㿘c@6 㿘c@/ 㿘ađ* @%"@ 㿘ađ* @@ 㿘!`@c0 #<a#*@ * @"@ 㿘# # !@, 0"!"a°#!@!"!@"a!’@"!$a@ "a@m 0@㿘#<c!`" :"@ `x ȁ㿘!a !`w0 㾈 f!԰'?/@ )1  "J??..?# %耦*.@ #` `.!!@n  !&O`^ B?` @*@{ ``@ː @ɐ@q  !Ԓ  `@? @C  㿘!Ħ`?c  %@# @a )@<L@`^ D?0 c?:@M #?$ā㿘J@ ^`@@   ?@ ?"㿘%#*a' $ a@$a ""$#!+@"!@ 㿘ag 㿘a` 㿘@? 㿘²?"!@ 0@ %!¦a  "!# @;  # $  "@"@")a@2 a!!  a 8/!!@  ᜐ"& /@  a?@!@  a@  > *a@8 <@?" !@ ??! Lᔀ8? &a㿘1!! @p 03! J#`" J!J!6J!3J! ? ?*?!*J!'J@!$J! ?*?!*!J@!  „? ☁ „  ☁ „  ☁ 㿘!a! " #@ !@ @ "!!@ < o E  㿘a%’@B71"¢b@* @ """ * $@ @X &"㿘" "b"""?b@* @  #"!"a 0@ ֐? 㿘 !Ѐ 0  1"¢@*`@  ` "&"@!?" @Վ a"ޒ  ─ ?&"&"┑* `"@*` d „ "!"a""#!( 㿘@z  㿘P! ""#!#a *@n?  㿘#@A`N *:  ^2*@ N>  ?`  +*@`?` N *@ ”  eD     ^*@` `@ ?(*@`*@ဝ㿘   Qb@$\!  Qb@$S! ː@$M!(aԑ.  ` *` ! * @$<!00 aؑ.  .` @$2!8㿘!Ԧ` @#!@Ȱ #!  *` *   `2 @$ a0 :   ,  Ԑ@     2Ԡ   5,  @     ` 2N@iq . %!  : . *  "@ 2 ; . a*   !X@# G @@pa Գ, @ 1€` .!ؐ@ VaԔ@*!؀@ "@@ ˜!` :`*"  *@* + –@! :   ?"  *@ +  㿘!!?"aȒ!#†  "aԔ !!* !Ԙ –  + aԐ@* aԘ   #  ` ԑ*  ` @ G* `ڼ,$!ؘ +   aؓ*" +  @S  @map @gax ǐ *c‘*   8("8Ԅ( 㿘`     ` ܔ  ` ֔  ` Д  ` ʔ $ ́ 㿘!̀`@c 0!@"@"   $á 㿘̀!  "0@C  㿘#%')+a!@+aa!#" %a$a$@ $%!/1@$$$a%!%a@?! @  㿘 @j  㿘 @d  㿘 @^  㿘 @X  㿘 @R  㿘 @L  㿘 @F  㿀!!!!#\#`" "  Ԛ袒 !@͐ 0* (@ "'u% Q. @@қZt     @ 0@d 㿀!'!ጘ#\#`" " 谒  @ 0H`  "0;"    ͐@ u@t@# ` J /` Q*# ` ̤ O 㿘!‘2`@!“:`!"  #! "a"aa1"3 Q 㿘 Q耢`?" ` `J@"J``"" 4 㿘  ! "!!!  "! !   !? $!!` !`a?@㿘N€`!*` : N a*`㿘   % #* ? ? eaD   ` `,    $a$k$$a 㿐1!%!" ᐐ '"@ ! $* !#at#!    b  㿘#@`V 0!`:@0?@(L@(N "? "? ""? '"? , :    " '2?, :    " ' 0K° N )   " '!N    " '2  N  "  "  ""  '" ?`"NN     " '2 , < .. 㿘@ U㿘@  L㿘@ C㿘!a! 0!??$!  e! aD:  _ $!  !K?   ` *!0 LK aD `@ `  ` *: ` b X aD `@ `  ` *: ` c  H*`@ R`+ !J e c bK aD `@ `  ` U*:  _ $3! U*: aD `@ `  *:  H* : aD `@ `   *:  X*  R + 2K!??e$!m  㿘!`'a!  !  N  a$᠐ %!᠁                          X   ,                                                                 p    | P p x  ,㿘'#㤐 c<@1`$ $$c<@* !"a@O 㤐`x$c<c@L㿈 C!# 8``'''@ c > '''" '`"  @g  c$< , , @'''"@`'c"@  㿈!# ` '''@7":   Q##`㿈!# Ւ` '''@" :   0 Q#@ƒ#`(  'a@  @b̐ Ǵ #J`2J 2J 2@!#  ''Պ  '' (@  ' ''Ԧ?$@@:ː!. €N  !T-  €ڨ Nװ N Ӱ   ڸ ظ   $,@` (,@N ``?$@@: ,@N `4 )@A2@  ' #  $,@` (,@`,@N``?$@@:c ,@N ` ),@`,@`" ?/  @@W  @]L n?$@@:6  ,@L `\  @8 ؒ@K  @Y  @,@X ,@R!2D   # ԥ`" " $4$@ 444 $` ` %"  = #    ?  ,@` ,@ `b"( @Y ,@T T    %"  = #  H ?"0TB,@` ),@,` T@]< T@' T@@, `0@t@] @]!'؀`2@@ @ @\!!@ N '   '~ | 'z ) 쀤@~| J  l'd   J  b'؀ W䀢 2  '܀`N' Q#(  W䀢 V FW䀢 D  A   ?% `'`  ?"` `  "`@E  뀥  ? @F ?'? @C'W䀢` @ "cж 2耥  2,` ǒ #ԓ*`  ǒ #ԓ*` q 2,@l ,@`n$@`@$@ @ @ @ B(`@:(@`` `c$< , F, @&`&`&@@" &@` `c$< , 0, @&`&`&@@  @X@"@`&@(@  '  ''  ''쀥 w|ǒ #ԓ*` s q  R,?߀`]O#ܓ*` €G [`@ ,@?`< ,@`@6`@3 {`@0 ,@`*`( % '  " ('@-  @ 2  ? ,@`@' 2,@,@``,@` 㿈N@ $`N@ #cNN` _ } `@Ӓ [ % *O  * @ *O  ] *@a@ZV  @2 '$+ 2 2c @ #`+@Z4@[.' Qc @#@ +ǐcJ `   2&!@ &@7=㤰 @7N`$$@    N : ǔ N   NǨ * c@  @2?N  J  2&?&'N@ * @'  %%=##`` 2 ` Q#$@ @ +  @`$`` ``?$@$`4`  @ [ t O  * @n O  ]j  %%=#!# і` '''@`@Y  +  㤠$< , ѐ, @'''@Zo"@`'2" :   Q#$@O `@  㤐 ь`6#Ԁ 㤓, e ,   '''" '$`@ `$`$@O  @`?4` = @#ԑ* @ B? ?@Y*@Z#$`$@ +ǐ#ԓ. @2 "@@J` Q#@ += -?cJ c cJ ` Q@#@#ԓ. @2쀦 +!@㿐#!ǒ`@,: #<"`@L"@ $#<N V@ -``(``#`   "  @Tː @\"Ē   @? 0 2!6 " @N@ @?Ւ  @W  @A @^ 2@ @g@z 6 &  㿘@ %2#0Q@0L@8J.@8 A. (;*7.@8  ..?:(*$@7 2ǰ?#&@5@ @7 2ǰ 㿘@`"@@. < @` `c$< , +, @&`&`&@@ @S@"@` &@`, @’"@:` "@@9Ք(㿀@`$< !#' '!' ''쀠`  @ `@&> &@N@2|  2   2Z @  "  @  L / '< %@(@ @ b8  ? @   2. @ (*L /%< @ (@2   @ =8  ? @ @<  2 /,@`,@ %$< , y, @&&& $@@4"@`&@ /,@`N /?$@@4,@N /`@ /  ,@' @7 2,@$ @" @4x"@`@ @&@;P @"@@ D  9@ ` . L 1 .2LL +L .N .#@6  @֐ @"@@40@"@&@ @K 2J`@z2,㿘@!  :$@=@L`- &@)% (2  L  `@H 2  .@  "&@.@`&@: .@` L  &@ ݀.@@㿈 #' 'h ' 'L@?"@$ `@3 ``*@L@` 2 *@L` /"耢 :*@ @   @'l N "&@?$@3 2,  ,N  &㿘N  +@V"P@W 2 NN  2 N@V"X@V - N  @U"`@V@  Q#" 㿘@Jސǐ#X@Kw 2 @ 2   @3 c $ `$ 㿘  @0  +N {2( N   `N { }   ,?2 "N  逢` $ c$0f   c$< , ͖, @& & &&"@`L& 0B> "& 4 N { },  ,? ,% 2# `&#`E@Ñ@Ì@@Ç,f  2 .l . . / 2 2 2x 2 2 2 5 5< 4t 4t 5< 7D 6 1 6 6 6 0D ? ? ? ? ? ? ? ? L( L8 L L L0 L㿘 @s X'D'H'D   H H DR` H?D@v {@0ϐ #h`@L' DR`VDD"cD `  *`#b:`'H$DݩJ#:`1`,@T"p@U!L bh@@!!@ !"x% Q# Q  ` c@@  @ @<!` @H ;'HD` 2 !DR`"!DR` !# @g`# @"` @ͤ D `%D `#ǰ %' Q@M 6 '`S$b8` O@K@ݐ D@?* : `="*` €DH@P'0/DH`H  'HH 'H@!#  2#  @R @ #` 2DR`!!Ǡ@ @ DH@` @ @H 'HD`'DDR@ !# ` @R# ` 2 HD@k`@H`ݠH "'0DR`DHȒ aD`'DDR@ HD aǒb@ߐ c 2 @  ǒ @ѐ @/@/U" `   @3"@'  @A !#  #2@9 # b2`@d @ @:$  쀢`$   @ @P $b@  $ `$ $  @ʉ H c ?2'HDH@b0WDH %`D!H'D `D R@  `? DH H!'H04D!+`?D '` ha̔<`'''''M0 'D` "D #` #' 2@#`?  @.@.c @X  'DR` 2* `D@R` '@T9DH͒ a'`0'D@R`@T& DH a'@^ '0# 2#`?  @.@.Oc @  '0DH a'D!DR@@  `? 0D `D!u DE D Hi a0=D hD`'DD`bDR`]D '` O @1  '@ D 'DD 9DR`02DH a'D`D@HDڟ 0D @WK@'@I@.DD`@,:b D@ @w."@'@-"b8H @-  H! J#`@- @H͐ 㿈'H#J` 'P 'J`    2 ( ""@U* ?@S# HL ^"#@ 'HH A"@FHi `   J`P 'P*H\ b< <Ƕ"@3Ւ  3 @3ՔbЀ p?+  J#0`æ ="Г*`   @ 'HH `H ``Hi a8  `'H` ! H Ha@P`H H ` Hh  J 2  @ "B#Ǡ +)  $M"`(2  @Q"p@R  a@<bh  x`a Q# Q#  @ /  b@N @'HH    0?뀢 0:H@05H`JH `H ` H@u` c@V ~ c0@P H  @*ǔ :H@ub   cX@; @Es@L @  H c @% 'HT'Hh"&"T# `" ` !#H`"`(``  "`  `"( ", "0 "4 "8 "< ҟ"@ǘ#K " 'H H2 + " "'H#"2@   H P  a"b8H*:H"T }H@ #@ &$H` HH@H ?"@ @NH"`"ؓ*` €"8'0`@+@+@+c@Ր 0TH`H ` H@t` c@y? ~ c@s9  @mb3 #L `  (""@S H @Q  P @ P  QL   Q#x@H#  Q#@H H b2b"  P""@?'P ""8@+* 㿘@Ol#@Pf L "4 @ؖ  L 2 #  "?& " @p@:@tzb  #@㿘@D7@D#x `@6 @㿘#`    @D  L @D& && 㿘 @Cה  2 " ?$$, ` $ @M  `2 @Dʐ`?@K`$ $V``$ 㿘 #ǰ N = *! +@C@DScx  " "" 㿘@CJ#3 /@   q` ǐ#x@D ` @2 /`_   @N @Oy Qc  & &  @ &   ` @2  ` 2 % `0 ! ǐ#@C #`   @b     &lc  ?&  `  T P`N `   ǐ#@C & °"Ȓ &  & "4"̠  @ "Ȁǐ @+8c & &  &`@M @N Qc   @_ °bȐ & "b& 㿐ǒc@C  J`/ ǖ c  $ ?$@C 28@l  '?@ɒ `:"  <   I  ?    "&㿈2&@ / Ő 2X 0Vň"@Q@g  #' 'g ' '耦`:@ǒ : @N@$" @*@ /, "@@*@y N@ ɲ`Dz  U㿘'@%#$$PaĒ @4  !ǐ"@/Z$#l @@5pa$#l$P$ ?      -ǐJ #`    ' ' ' ''''J`"!'@LՐ"p@Mt (  @H֖ @ `O"*` €H F" J `A&  @>`@d <  2`/.-"   @ `&L@ -  L` 2 #     @ | ` (@H |b@ 3 ?`J ` "b@ $ ?@!!ǀ2|?  H P X:@q|b `0@  b?# *`R   ?@  #` *2 "@? <@ ”   (@H" :@qEb ``@ ɐ +?@ɐ'?`@Ð` ` i @   @ @@ _ ǔ @3d  㿈?''D 'H`@  ?1#  @@  ' '쀢`  `@^ ' 쀢  P H:@pb ` `@ e쀢 R?@34#< '@'# @    H@'"#<@3?@M܀ #1ǒ`@א D" "&#<@ !`@ | c&#<| @6u @6rD@'q@3j?0@ ?:@pb ` @ `؁㿘 +쀢 )'% , `2 #퀦` @K=a@L7J`@8@K3!@L-@ bh x   @K"a@LJ@ ۲ @^f 4 Q* ? Q#㿘.`@  `@6㿈   @@&     @A  '! ''@._ 㿘.`h@6S㿘   @@&   !Ȗ`@.7 㿈 f!Ԡ  ' `A`?J@ `J@ "`J@`? * J@   : + ``+J@   * `+Խ`   ".`  @0`? a  $ a @4!(㿘`   "`1 Q #耢 I E 㿘Ԧ㿘 &a8@ )  X Yt Y Y Y Y ] ] _ \ \ \ \ \ \ ] ] ] ] \ ] ]8 ]p ] ]T ] ^T \ \ \ \ \ ] ] ] ^ _x"'ؒ'@&@x'ܐ 'D'L'''@%'c @V  􀢠 *@"@%  L  Q1 @ l#@%@ ` (2ܐ '@"`"@l @ܒ ("D  @ "@L 0@J L@KD@% 㿐`C".` €  ''&"  *( )"  * @Jx  #0 @//@ *`!X@cH c` cxcc@  0c@  @% 㿘 `Y ߀ ```#@ @z`! 86& `"` `?.& 2- (& `@b ϐ`$z  @R@  @E d `:@ @602  ),`@!X*`  @`@  @ߒ  ` ` ` s@耢 ``    $   `"*` € @E  @  @   @  "@  *@  :@  @    @    @    @     ~`?   x@   t @  p@  l@ 2  $ @ `  @ `U   "  $ ْ@e `  "   8  ?3$  @   $   ?$  %^ @8   $   ?$ "  `$ @"@J6@I2&   ,`X* `@㿘 e!D`L?   ` `2 &` (ǘ cԑ* @ 4  [ L * `2 [2 ` @Nؐ 2  `  !@&`@@ "`#$@$Ô@Gv#&``[ & 6 _'  _  * #@2L #"L㤐 $@$@&` }"`" `"` `@I 㤐 p`' '&` !X @* :  ` 2  @e  M ` 2&` )&`&`㿘@@K` ` & "@IZ @H"& 㿘N 2@@2 .`* X D $ .`* X 9 㿘!# ͒`#""" " " * 㿘N`  @@" @b @I  @ "$ `  @@ @G&@ @ *@&@$  f f f f f f f f f f g g g g g h g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g g fT g f g g g g f g f g g g f fx x xL x, x4 x< xD zp z z z z z̝(        '<7`C9 ē*` € `P@} )@c @#h`X@t `  @1 ` `u@(O0Ѐ* K   2 `2"X ` J@ `@{E =  #@# `$@  , `  ` 2 `6 2  @ה @& `'@h7 `  ` 2 `2`2   h@Z   Ȓ @ @  @   ` @ @ ݀`@ @̐  `?=`  ؀@ ,)ǀ@)753+!":@0# @$!@0`@z 2 !@0`耥"`@ @@-z! c @ @ǐ `  :b @j4 `@̐ 0@ @!@@0k 耥"`@ @(@@,? :b @j @!0d @Ex!8`@F? #ǐc<!@@ $c<R`  @+ 2 `@!XD @֒  #'`$ ' '' "  $" @!"@@.d &  $@,,@(j$@ @i `@F!x@,x㿘@ #+)' @yҒ  #, L " #   @# @耤 ,? c<@ %c<㿈`#@!x`0V@2@/  #' '.  ''$@"  @!u@g@b@b  〦$ @ϐ! @ "@$@!L@>$u㿐@#` / #` "* @*@ # `+@K/# `!@)%"  !L ?   1c# " : ?@p '!@f #* @㿘#c  2 㨀  @N! 㨰?㿘c#@=! 㿘!#c #c% Q  "c c#`?$#$`": @*`  ""  㿘#Ǧc "`< ? @ cc. @@ #㨀@!?- @@a  c c@@a{ c&@ > c@@ 㨀@怦?㿘 )#'%"@< . "@@sǒ ,  %#$$㿘"`"!" "1@z 1"耢 #@|""c &"#ǒc"$"" @Sc㿘!#  ǐ "ǒc "?"c$#㿘Ǣ c @ʐ@w 2*"耢`@31c#* c  c c#* ?:""㬔#*` ?*"&㿐J#!`’ " "@BJ!@CD¦s""ǐ @yc $" @ה! g@ !’ @]$""  @  ¤` ""@耢 G@,B #\   @ ?"b ?   ?b@@@Kb쀢` @)c bb@I b@5b@@pb#@b@@   @6 $b " ԇ* "        2   ( f!Ԥc''@C %@2 ## b$@-@Ē! &# @  @= @:@ b@ @@+b@2  @<"@?  0  2? "  2?@" "@  㿘   H@`!* €@ 6`4 @`* / @`* ) @`* # @` @ `c ?  @`& a `  㿘#c$ : &@@@ "@*  1# @ # $㿈!"@ "  @) ¦ "@ )D"@ "#\   @ ?9b  @_00!#   h# #"@M %b>  > > //"///@I @ "@C"  @ %b"@ 0@㿘!"@ @1"$"㿘 Qb@%  @ 㿘 "b8"lN'H'L'P'T'X  3@q H@,aa@+ @(a@ 㿘'L'P'T'X@_!ǒL@+! @*!@(!㿘 "b8"lN'H'L'P'T'X 3@B ""b @+aa@+ΔH @*Βa@(wacP J#.`""@ 㿘'L'P'T'X@ !b(@+n!L@+!!@* @(P! @ 㿘 !#<  #T  " @w#T  #TJ- b!@+Bb !#<    $ b@@+.!#<"`㿘#'H'L'P'T` 'X!ǒ!@+XH@(!㿘#l'H'L'P'T`'XbP ǐ!Ē@+AH8@   <   ` `㿘ǔĒ @& ǔ @& ǒ @&  "c㿘@  :" ` "h㿘  @ƻ  `:" `  ?ڐ"h@3㿘 `ǐ!@' ``@0Ô @㿘@ 6"Œ &  & 㿘@@ 㿘N? eaD   ` "+NN  2'NN ?А@` `+("(  %` `  2""؀ p N  @G"&??dž"""   㿘!"`  @@d"?$"㿘Ǡb   b` @R?$ 㿘Ǡ" `  @B?$   `"@?㿘  1ǐ" `" 6"" "@?&"  "@?$   @ ?& 㿘#@`# @3 ,9 $ ($$@)@ڐ  @%S $#$$&           X㿘 P"c(㜔 "@ " R!cP@6 ) 'ǒJ`  *`   @$ J €"c0J  Q#8`# .  * $ @5 ?. J` "J` @l @< 㿘# ')<% 㰀24  2.  2 #J` "%J` 2!2   @ ϒ  @$  2  @  @  2 `@ @㰀@2#! Q# RcX@Ƀ #@[ #J` @*` 㿘Ǩ cJ` "J` @;  R#X `'!Ԁ @ $4@R€  "c8:@b@b cŐ $44   R!@5R !@, @ڈ#X &/:#8@2  Q#c8 ,   *  @59?, 4 7  c8 . @ #X:@bb c $4b !@a#~ $4@#  c8:@ab `o $4 Q"##$c84 #X` a #X 5@;a01€`"#4 Q#c8 ,   *  @4?, # Q#8`# , *`` 2` `@4ʔ ?, #J `@;P㿐` kaFǒb@ @P$@$`$``$` !#  #`HN c #"#"c @` `2$$ $#$$ $ $$$ $"$$$($0"#"c @e x` 0@8( )`@,@Q  :" `##p`  @j@` @'  `?"$` @:"c$` #J ``   `  $@` c4  ` RcX@ `@`hb@cbP  @ @`#J `` 2J  Q#c8 ,   *  @3?, #J ``@Ð `#J ` Q  @3ڐ#x Q# @3Ք b2  @   @7@v`"4#"c * @:K* @3&a`i c`@ @A `7 @ub ǐ" $0 " `" `"@ #J ` Ǡ`@&!(` %` !@&@`2`  @%!@#! @]  @N 㿐ǒb@E c `@-" @8 㿐ǒb @0c``  `a  a  @   }0@  @  㿐ǒb @  &@##  #@2 2' @  #   @ה "? @є `#8*` !@g?H@ɐ  @   &@㿐Ǣb@ @   @ #8*`  !@904 `2 @˒ ( :b @_ !@%  2  ``2  @   @    :b @_q !@  @d 㿐ǒb@\ @^   @R #8*` Ɛ!@`  ` @A ߐ!Xа "`(`o!p`(  +)' Q  2$ $  ax  !X  2  QQ#@"N!Ā2$` @# `"` @J` 2>`#4` `  RcX @8E`4#4 , R`h#X```@  ` #Xa@8-  @ܔ `h#X```:b @^հ !l0]`  ?@ $`"` =``@ N  7`:" &`4 $``   RcX @7a#4 ! R##X@ŵc8  @^ #Xac8  @ @^!$ 0 #4`` 7$`@~  @o 㿘#' #c " J` "J` 2  2  2 " 2  " "( "0"( "8"(M"  㿐ǒb @􀦠    @ ` @  #8*` !@B #``    !% !`  @ @֔ ?   "$  2 #  3 "@b@ 2  @  㿐ǒb @c 'Ǣ#L` "    @ @ ? 8 "$  2L`   % "@cH`2 @  @ 㿐ǒb @|c`"` "` @p c㿘#  !!2  @3bP  2 ,bX+ 0B c  (¬ "# 7$c)+%#  "! " @6   c a# # bx  &# @# (@#㿘   (& ` 2, & ,c",@  㿘```$``$`Ǥ#J `"`` @ #cd  "` ? @.$``$``"` @. 2[`` "ǀ` ` `z$` $`J` 21 R#4`.#X` +`  !@ #X $```($`!#X@û#8 6 ` :@\b #8b#X" `  #X``4#X @5$`#X&'`,` ` 2` `$  @5a`,  ?Q$`` Ȑ ` #Xa@5 ` `2`,` ;$``,J ` ` 2`$    Q#8 * "`$@.  `$` ``"("b$J `!` " @%!@i!`  J ``@p:#b   #”   2  2U", 2 @JF@F#  (`" `  @`2`  2 (  '''$' $" @# $ " @# '''' ` $`   `    $`@  ?@   %b 㿘 2 (b 0`  `  4@`2` ,&  ``" &  &   &  ? #Ǡb 2 0 $  0`"  @2   ? $ b ǔ @c& L : 8c 2L @r L  -c   '#!€  `"R``2 2 #0@ #0@0 @t#0 ` c bH@cJ `  #   ?& & `" @b8 f!Ը' `' 2 ,  @!Gc f   ?` ' ##'#2 +" - ( З*'; Q     `0>" `09c  Q*@  `"./  c(@g @#` @@! #0`  2 `2  `2     2  / Q *@ @g @`` (  c@@ ՗; `cP@ ϐ`` cX@ ǐ`2O $` '#hcc`@   '  #c`#hccx@    ; 7  3 )' Q#/- Q+``  #\#\@ y2 c  #@ l     ڀ` 27  Q@ Vc f! @#㿘 ǐ#ԓ* &*@Hc  , "  2 , |`   z 2 p`:  %`m k&@L`?F"*` €## V` R`0T@G̐c I  J 2 @`# 7  ( "  @Rޒ  `"`2.&@-    2 (`@E#    (`@Rה 2`` 2 (`` &@ 㿘c< "c<ǒc ! d `" & ` 2@`"& 㿘c@ "c@ǒc  @㿘##`@2 @c 0*" (€` @ @"`"@ ! # @ #<c ?"c #<c& ##<#c" 2`"`0"""" """㿘 (   "@ &? 2  , 8 , ` h < x ( X ( @ L L \ ̀ , L P7/3-ǐ?x'x'p'|'t @'h 'lN Hh '`'d%D&cHH   , @% , 7  <J@  \D `"@ ~ < " #cH &cHcH<J@  \D `"@ ` 퀦 cH?&cH@ -<`  ?"` Jc. "''`  `ǒ #ԓ*` `?$@3`` !-` € [> *`; *,d@7  @\ # ,,\L  `?$@`, , L \ђ`<< @$<\" 8" " "P%< @ + ? ! '<J` `\D " @ ( ,Q,@ '"  \ "+ \098 \<J@  \D `"@ = ,,cH`&cH t@p %*  , t@Ґp %  \ < ` $9 ,/ ,J@  \D `"@l $͐  \ "` ? `` ?$@S`  , \,,J@  \D `"@; (: {<J@  \D `"@( (t  @bp %  % d $ % @ t2 @Mp %  % % | Uǐ ,,@`<J@   \D `"@ : # ,,<J@   \D `"@ # %@ t @p %L @ t @p %=  cԑ* @ 0  , X,`?$@`,<J@   \D `"@ * `2`, ," X `?$@i` , X,,, ,, , $,@'<t  @p %  ,% J#.`Φp @ @ 2% @ <``~ ' p?2@np ,cH&cH " \p?2@Zp   ?!* € ("  ) " 'cH.  \  (  $%  ? % %  %  % `&cH%  " \% 2    %  '2 cH% ?&cH  2',$p ( )  % 2, ? % <J` `\D " @ )p?2@p,"@cd   $ @ , (,  % %%  } *p?2@pϐ  } |p?2@p Հ (0׀ ` \,2,<J@  \D `"@B $", \ " 0  ` ,  2,  \, ) (  ?Z% <J` `\D " @ )y @C 'A '  =%  \ '<J@  \D `"@  P, "t  @%p %  ,cH`h&cH8  % , _ " \ , %U % <J@  \D `"@ $  \ " `  , \, ,,+ ) | ,?p@ݐp ( , * , , t@p % <J@  \D `"@` ``?$@ S`` @"#" <d >` L@ } `ǒcԑ* @u㤐 Ӓ` L`?$ >`?$<J` `\D " @ <- & >* &  >  $ 28$<J` `\D " @ - $@$ > <  $$   > $ | @$@$$ $d!l"#2h,`2e,dl )"ذ ) ; &< ( 2060 |<J` `\D " @ | ; | &!,!!!& &$!@? J#1`<J` `\D " @_ (~!@-0zdl $ǔ o"c@Ǣb@ `@@J@  ` @,@`@ `J@ ` @$ 2,?L? J? H!@"ǒ#D@#'   !  } `- )ǐ"@@# #! <!8 " < @$ <""" "8%<`*?!㿘#b   @ c  $c㿀 r  '`cH "cH#!' 'W! ''+-  $ ` c< L@!?$@ , c<J` `\D " @`ڀL  `` 6@E%'@<?$@ _, c<J` `\D " @M` ߀`?$@ @, , $ `& cH?"cH㿘#<'H'L'P'T'X`?  H `8`? (`8"<cLǐc @$cL 4Ǧ#@^) : , @^" % N? \ @ ?@@  L  @^  ? . @L "$L㿘 %Ǡ #  c 8ǒc x $ $$ @' 2 $ <  2$ $ 㿘 @) @ @)Ɣ    P 衐 H@,ے   H  H P P H (@  Q#0 @!"#T#   ????????'7Ǯ @'M"c蚶@''@)@89N5ǐ## @ ǐ"# @  ǐ#X# @ @;ǐ#x# @ @'"` 1Ǣ`    2#,`     2$#$̐  @q      @q$@'#@) cT# *@*cT?@@_o` cT@_ia cT@_c`  # *`  @ : # *`    #`  @*   `@"c'#    @*ݐ h   p@'d @(^L /@P  @   P@2 T@ @ tJ@ @ H tJ@  Q#@( @Z@'+#@(@'& (@U @#@ɒ@(@' c@( ```А`    @ǒ &" 0 8"@@& @  "  @'@\R # " @(M@#"   @r|@g   ,#,  @* 6L @  㤐 `. @ $@$` T H. @ P%cTL %#L  !㤐 `. @  $`  @  0   $` :b ǒ @K"8`) ``&%cT `,Ԑ `h$`   @  $` @ @   , ,#` `  $` `"$`@t <   ##J `"L @  #L  @ m, L 㤑. `?cT@%""&@ L , tL , J@ 2 #L `p #L    @W L `2 # Ƕ   @K #J `   @A 0@& @&Ǡ J@    @0 @@ 2  @%#@&@  ֠ ܒ# *`# *`#J`  z@I*`@  㿈'D'H'L'P'  @  0 'y?L  #`''0''@ c @  4L @ ` @  #" "?`!*` €A ";P`"8`7 @)`r L 3#"`H" c `'Dc" @` "@"@ P` @R c" " 㿘# `"`"@@ 㿈'D'HD`  J! ''` H@ #<' '@ 쀢 "#c @  :?`.*`" €쀢  2 QO#J# `D `  D "`D QDc"" @"#<@@"c<aؐ Ǡ# %#h`@ D 8`L  D`  D` ?"` 쀢  $kD D@] BV .  L  ?'`D"  3c  I  D&c"`H '@.   L   D ` p"b8 V  쀢 c 2"c@@Z"c<8㿘  Qǔ#J `    Q#D` Q #8J `  ! R#8@ !#R`"<*` €c@  #` 2`@#㿘#c D `44  c`$ $ $ $ @$c㿘#` " `  `@"` @#R`  ` , R@`" 䯐  $` ` R `ǔ @ T @c` 'T@ !J#!`L/` "8  2  Q#8, @ @ @ڐ @b8$Ԓ`㿘#  "    ,`R@ `@M`$  $   2 " 㿘# @ @  㿘!#@`@#`Z"`@㿘  ! #@2@Ҥ  2 㿘@ / 2@X r  @Aa@ 㿘 a8= Q֐#`ǖ#Ԑ    0 #Ԅ3#J ǖԅ( 2J  㿘ǘԒ – @  2@ `ǘ#Ԓ  @  2@ ``2!HÒ !X !h !p !x ! @!!㿘 #|?!,@ϲ @?,@ڒ 㿘   @ @TҔ 㿘` `@o* 㿘 @    $  &@ $$ 㿘! . @ " @ZQ   #. ?㿘 .`@ǐ#J `  ` hX@ p "+Ő pШ!'Ф  ؑ,` "`@G$?$Р @'Т``#,`!Ē( @ 0❐ #a !N " `,``"`⌐ ``#(N Q⅐#h f!Ԡaǚ# '` J@  @K@ " *  #`#*`5! @А 㿘Ǣ#J  *`6 5 1    &c* * * !* ` @!ǒ@&$"@Α"@md@@m`@{  c*     cc* #xJ##`   +` '@S@!` )@S#@}##a J`  ``  ,@`" *  #`,@*`J#`-   @ / ",` J  -2,`  ,` #@ #aS7`A2  `o`?`0* `0'? ? ΐ8  O.  , R @.#i`s! ! `  # $J`@2`R`@ $P@I耊 !`ؑ*  `J`-`+`J  ``- ǐ#J `2* * "ؐ '؀`   耊 2  ؑ* `"'@ '@ M  @%{J` },?`Дଐ &?ؑ, `2 ‘*`($ @q ؐ*@( ؑ*`" ؔ*`2'؁㿐 @VN J`2   <#$&@  㿘 !)P f!Ԥ' `, @A@>@@+ 2$  @#5`w@W `?@p @!㿘   U + M  * ? [D  ]`2@       !"   23   ]". -  `'20 #  a @UJ  `  | )`02 `  2 *  ``?㿘 0   @퀦   ?" ` [ * kπ # 4 Ȑ_`"̰ @̐ €Ű ?    @ "   ? 2 @ "  2  } 2|  @֐@Д "m   ?a 2` @ N  F 2E  @N@ E?B  @# @ 2     ި   @* `?     !`?2        " (2 `[: 8  - 2  ]      2  " 4 @4    ]2   㿘% #   ) |?? |2  2 ` `@Sa 2  * 㿘.` @㿘&@2 :  :  [* @@ƀ ?@$@$`$@ƀ $$@2 @$ $$$@$̢`ݦ2$&@:`: @?@$$@$㿘@U "" * " " " 㿘`" @@* ?J@ ; @ @+ ` @ &`-*J` - `J`  ``  &`&@`:-" J`` +2&`J`  `&`?@-`  &@&```&``,  :` `?&``: `; `, `#"N@R 2J N :2` `&`O.` !@`!@!H 5a(`:`;:`,@+`?`J N  `&`3&@`;2N.&` :2` `&`.`L : !@`!@!H aP<``  Q͐#1 ? `#@* ?`@ &`%&`2$<`@+`?`K  ǐ#ԓ*`  &`  cԑ* @`&`&@&`<`㿘L  ǔ#ԓ*` !2 L L  *`a" L !p0/L ' !y%1ǀ`'`$ ! ! ?L@J   " *@`" L  `!㿘# 'L`s Qc, @ƒ " @@̿` ` @$@,@̫" $  @,Ǡ  `/-+ Q@@ L @@c @@&ڠ #N`㿘`' @ǔ  `@L@ "` @& "$@@ $,㿘 @ߐ6@1.㿘 @   #:b # @  $$b  㿘 @4   ?  @*  ?  㿘  #$`$@`  @c #`㿘  `  Q#N@ / .'m 2N` .``*`:  / 2   LJ@  :2`J@"@  `&  L /"" "N "@8"@@@J / /,  $'" v@hJ / /,  @ "@]@O "&Ja/`? 2   . /J@/"`J@ .2K((G(/J`"`/"`.%J`/  "((((`ЖΒ` (J@H/2J@"J@(J@ @/"J@(`J@ @/2(0㿘     Q#@~ bȀ #"bctǔ $ctct@ǒ  Q##`㿈@]c ' '^ @ ''@  @2*@ /*@`*@`X"@㻐 f!'&@ c^N /"N Y@O / $@@  N .F 2 N .2 N .  @ (:N@ /@ 3  /&@.@` @" S@E@.@ @gW# 6 .:" `" O / @ " 2N @! 0 1 1 1 1 0 1 1 1 1 1 1, 1l 1 1 1 1 0 1 1 1l 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2@ 2, 0P 2@ 2@ 2@ 2@ 0P 2@ 2@ 2@ 2@ 2@ 0P 0L 2@ 2@ 2 2@ 0P 2@ 2@ 0P . /< /< . /< /< /< /< /< /< / . /< /$ . /< . /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /< /4 /< /< /< /,㿘"!#0 `#`0 "$`,$`$@$`(@d   4`  @e@  , 0` 2@Z㿘`"`` @=   "`  `0`0``` aس    !#`&  d & !#0` 0& b#`  & ,& & & & & & & & & (`&& $Á㿘`"`` @   "`  `0`0``` a^     a (6 aO  & & & & & `& & & ` &&& $5㿘 b ,1# 0"`#   &,B B `$ @?& &&&&(&&& &&&$㿘   @_@ &?"$ ,0 , 㿘  @C@ &? ?& & & & 㿘   ` &  @} & * & " ,㿘  @"$ ,0 , 㿘! 2 0? 6b ׎ h: $""  ?@  *@ &  ;    @Ԗ  & & @ @ 㿘!   6b8Y h: $"" r?@ `j * &a ` d@$@2Z?  ,*`D   &  " "@      @  + & & & & <& @5  "@ $%: @̔ 6$    (&& $@ &  @ @& @ 4 `  * && &     & &  &㿘!2I  6bPҐ @h: $ "" @ ^ ?2,?  && !:     & " 2  "  4 6 :" & $ h&& &  & 㿘  : "b W?h: $"" O?@  ?2D?@*2&  6   `" :  2  8   : 2  (   "@& &  & & * & @ 6  :b (&& $? 㿘bh& `b ` 4@b @"&& &@`@ '?@ @$@( ?㿘b `4 `0 ?(  @!,@@} " $  4@ &@ @"&& Ң@,@㿘2 bզ   Ð? ?  $ @`$ 㿘@2@bՈ @('?"7?``@` 2.? ?"%?``@2@`@&`@` "` ?*  &` &@ &`*&@&`*`  &` 㿐@?bA ?">?@ "*`` /b2 @(:`$"" *?6` :" `@ "` (&`$&@` @Д  퀢 0 2 ` ?" ?``?&`*@`&`㿘 " ?@@㿘c `6c(  `@@`4 @$@@"&&`9^ ?23?@ #`@{/&@ &@%: @g 6$ `  (&&$&? 4 ` @@"&&㿘'L'P'T'X@6Lh'P'T 'X` c@ pȒ4 P@hȖ'H'L'P'T'X  B H@H f!Ԯ '`  @, `:  %"N@ `2  & * &  `   U`* : `L#Ɛ!*` €CA?"<@;N@7 261N@ -+ )ǒ #ԓ*` &,@: , ?Ѐ`  ,@-,* :`@  ?Ѐ` "N@` & , 5 ۦ ۑ* : `SƐ P*` € Ϧ쀌 * : `Y`Ő#*` €   ,` @v 0,@@Ğ 2 =  u< -7 +20 -`   04  ,@" 0"!#`#x`   4  ,@  x X,@ 0,@'@$@`#@5 ` // `@@d`%@ @"@@ L@`+ @`-` `0  )?"*3 0  ? 0Ȓ &   @*@`& `  @` x 0  ?*`:  `&   @*@`& ` @  0`', `2 < `& * & `,   `  ?L@w &   @*@`&  ``$@, `2 < ^& * & `4 @, Z(? f! @b#㿘#@E&?*  >&ǐ >& b` >& !&8 ?`ސ#*` €#b4 !r # ѐ# $b4 0ɐ֗ L Q"#( ~ &|1e  ̔ 0#c@ qc $c@L /z@qĒ  u@Z p<  jǐђc e$c@ ~&3X"`Qz,ِ! Q G$#, D$#,mwiО ~&i  ~&@D!(& ~@(*&$" \" `& ""0 ~&b" ?"`a&㿘 ?`/ސ#ȓ*` €!"4 1qO# bS# $"4< 0#ݒ  Q "c(1#@ q8c  &#@  01 0Đ 㿘@i` @ @`$@0$`  "` & " ` 2` `pӐ `@* @ ~$`$ `$ `$ $ $$ J@ `]"?["J  ][["  㿘 [@. #"@ޔ㿘$`#%        4    ` p ` ( D D  D D D ( D \ D D D D D D < D D  D D D D D D D D D D D D D < ( D \ D D D D D D D D D D D D D D D x D D D ` D D D D D D P D D L D D D D ( D D L D 0 D D D L D ( \ D D D D  D 0 | D X D D D D h                        Ĥ     (          Ĝ                   h                0       h      0  h    Ĥ              ܝ㿘d8$@@ q#a0  ` $a0 `$a0@B5!,(Ǡ!p @  @2 @eK @   y Ӑ @   ` a0@L ?@& +a0- + #!?  @  @o Ē  . Đ "  㿘!,` !`*` €!!+  $a, ^@o "a, ?a,ǀ a,À @#$a,  !  @ "a,@ @ a,  Ð?π # "?В "$a,Ð h*  # @ $a,@ Ā /"` "` 0 8 @  ?@  a, { @! "` "`@gk##@ z 0#   `@  @Þ`*@ "@  T$a,? eaD   ` ` *` * ??"Ð h* `Q"Ð?π "?В "$a, Ðh* Jh` l# #  6 $a,? eaD   ` ` *` * ?"!  $  @ $  Ðh* Jh` 8# #   @g$a,$a, $a,Ð h* ` "$a,  @/ ܀ J `  @%$a,`p*@  @'Ԕ ( $a,apap 2܀Ô`p @  @"` "@"" @ ې 0@$a,@ Ր a,2  "`ܐ "" E 'Ĥ Ò? pJ ?   eaD   ` 2  e!D`p ?K `  ` " ܠ? â p@~ @Ġ? "@" $  @ " ܀'@ 0 p"* 'J#7`Ę M  - * Ē`"  *@ "  Ę ^  @* Ē`"  *@ "   * `" Đ  @ C"c a,    W 0X  0U`$a,@`h "  ?5 0G? ? 0B!`" ؀ @ @ 9  $a, #$``!@l 耢 "߀   0%!`L 耢`s`c`C @   @@`쀢 @@    @   @$a, 㿘"!,V?#`ؐ  #! "a(#a$#"  @ $`ؐ@$    .       㿘!p !p 2<!`  ``@  0 ؀ ?# ؖ"` &` ?"  *  ``؀ ?"` `?#   #`@l#`  R2!  "`ؔ" @l  ` `" "` "`$ `@      "  @l  "@ؐ" " "ؐ# " ~" `Ѐ  " Ԁ C!.  €o  R`"#|؀ " Ԑ "ƒ aƐ *"J 耢 s c C `?@I@  E `@  ? J#8`!Đ @  5 !   ?@+?Đ * #a`"  ` "  @l `  "`  *@a  " ` ` "`  R"#| 㿘  %@  @@" @  @ @/ }  2"  2@!0`2@! #`"@` @k  `Ȑ # # #`@k @?* : `y!*` €@ 4 `! R#, ǐ"qN` 3ް? !0 JN`@" @([ J @c 00 ``""@  )ǐjؒ#  @a$`0,@0`  @@aj# ,@ ,@ 0$0" "  a$  "!`"(  # v"!!$ "!"a( @  ` "`d"`@ @r `Ĕ @" HN@N``c `@ @[  ĦK`  ` `@L  &G?N@ c.'N` w W) Ħ``J ? eaD   `   e`DK ?   ` 2    N` %  N@ c@@EN@ y@a" N@ c`!$  "("a   %#`@  İ? `` "? #`!$Ɛ "("a %#`@  ? 4   ` ?"` ? Ġ a$  ""(!  @  @ ` ?"` !$`  #<`$""!ư?!(@: "!e$!(!$ "!"a[#!(!$ "!"(`@ @b `"I"!!#a(@@ !$a(<$!!!#a(@"@ !$a("/$!  `!$Ɛ "("aN` `@   * !$ƒ Ɛ #!(" "  `j !$ ƒ"!@ "(#@  @m"!  R !(`* c<  Đ # | c<$ " ?"Ā  P X  `~İ @a $ !   !$Ɛ @"("a  @ `@!   !$Ɛ "("a  @# `@" `""` " "#a( !@H! ! "!r$a(!$@ Ő?"" N@ R"#x  R#x  ?N@`?`N%ƀ`?'(@V  ƀ Z?@@ 0T"! $(@$+? &L?  dJ   e!D*`: ?   ` 2J  J  J ; ?8 e!D J  ?   `   aD* : ?   ` 2J  J * J  ?2J> '* Q L ' Q e!DJ?   ` 2  J  "  J 逢?Đ  ( a$  " e!D J  ?   `   @Ɣ 2 ?@  ?  ` ِ?#` p"a  `Φ g% e#Ơ ) c' b`  J@ @ D@ `  ` $$a(#H  H* HD `@ `  ` $$a(#H X*  R (`` `??"``#!   * (" `@T J#8J#9`"?@~ @  !`  ` @" 㿘@?* :  `t #*` € `?@  `?@   `   ?@P  `   ?@*  ` &հ 0N@ R"#tN`"  R#t ǀ f Fct ct a  N@ ,ƀ`?` @   2 0' `?`   '  `@ 6? `  4 0 `   |?@ x `   n?@@ j İ  ? b e!D J?   ` S  OJ İ ` 4 2C?0A ` < : ` ` `@_J@  $  ` İ ` ??  @GJ@`"`耤``4 0?㿘 ?!%#!В` `@`? ? ? ` ?"`$! 㿘&@ƀ` "  Ő @@fj ["  { ( ) 0"  } ]  0   0 ???㿘#`! !h@fA`Ġ!h` ,"h㿘ah ah "@f-" 㿘%Ǣ e `e $ `$ @`` $ `$ @$㿘`` @D ` & `& @@&㿘 !e# e# 㿐!#" R"`c`# """`#c` "`" "` }:# Q,"@ ?!Ʋ  "!H#!@@  $!<#@ #@$!<"aD$@"!D!X`c,?@!c,!Ɩ%!P  e5&!X$!P!P` e/!X$`!P !X@fX!P!X @fT @c,ƒ"@Ɣ Ɛ  L+a`"d \#!h㿘@ 㿘`2  Ĵ@@6(? @4"  Ĵ  &?@"  @eh` "` Ē @e\ `"`㿘!  " @eK Ē&@ " "  #" ?  2 ?,? H 򀢠" ??㿘5ĸ w??t e`DԈ .`# `("EaD` 6AaD ("9 ` & 3 ą.`8  & `( aD ĺ#N 2 ` 6  ` (@"N aD`  N 2` ??2 㿘3`ĸ [??X eDǰ? J`H 2? :`#@(?,. `(2?% ,# @(2 ĺ`aDN 2  ?,  `(@"N  ??2?㿘ĺ @gdǐԞ ? e`@ `  ?!DN `IJ`@&N` @7@ (@Ķ# `@6) (2` IJ` #!D8 2`@6 . @. @ 2`㿘3`ĸ 6??3 e`D` aD I  aD` N 2` ??2IĒ 2/ eD ? ` H  2?`!D & H  "?  2ڐ?㿘 @I??E e`@6  `?DN " `@&N @@`@6` DN 2`@&N@??2IJ`㿘`!$@40?@ ("! ` `O ?%@[9$  " Ē  @b"`"! 㿘`"E?a$?@"=?"`N ^    `  Ɛ!h@!ђ !?a 0?J3`@Z`$  " `Ē @b}`"`㿘!\ƒaP*@ X@c x x @" !@Ɛ "a<*`㿘 !d"!d@ #@2a\ $ƖP* +  @ra\$$a\㿘       Ē  @O  İ ` !L   㿘 İ`      /ƪL$@2  : `Ħ @" `Ġ ` L$@2  : $  Ē @ L2`@:`$@  "㿘 `@k@ 㿘 ƪaL    /)c7 ``Dz# M - ^  Ā@@` `  ,aL`@, `2,(Ā`aLN`  aL,aL`@ , ` `aL@ `  2 ,,L`@ `@, `   aL@@@aL@ ` `  L@@L@6   ,L`@   ,L@LN@@ !<@3wL!< %!< ````  +` <  >N` L@ @ w!<.` %!<!<@㿘!< + "@w @ !@.$a<N@w`!< @$!<#$a<$a<wt a<?@&a<$a<!@" @  $a<N@w``!< @$!<$a<㿀  )! R#|     ` % \$#| "%  Ē#\#``` ` {줒 @b?0Ak  R % "|9"`5/+- 3ƀ@  Q#  2?@,`@@XԐ| `?  " ``"`a$ %%&(&` 㿀 )! R#|    @  $#|  ! R#|     `İ   % $#| `'% `   ĺ#`#\ ``` z覒 `@ܰ?0G@@԰?x{& 0s ',`@ {2 @+97/5-ư . @{ @   ,`@+97/5-@X- @z+  R "|`?97/5-`% ^c `Đ"{ϒ 2`  R "#|J?`/  Q#  z$ &&'!(%3 㿀  #\  #`z蠒  wz z 0@<?   H7     ` 㿘J#7`  u    uݐ ^ @uڐ㿘ǀ #!H !D 㿘@uŐ u㿘!!0  !0`^c $!0$`$`㿘@㿐! @( c@_{   # `@@A ?a* & @ @@N@`*@`."(N@# e* : aD `@ `  ,@p,N@* ?Р @ _`N@`@`.ߑ* N@ .E.@`N@}x@`"!# e*: aD `@ `  2N@@?N@@?Ц@m `N@ @N@ @! e*`: `!D `@ `  2N@@N@ @''  @ :"   㿘 #" e`@6ʐ#@]& 㿘@} 㿘@0 f!'#!%+ `-Ȧ/ i  $"$b  $b $"@@~Ѐ? fa* & @ @@S0 . @%?@P  <   $`@y`@Y@@\?@$#@`@5p @VpM / /-`?< @ /@ 2L ?`? ` L /"?* L /2? @V@ #@@  @]Ґ@  2  Ȳ@\ f!Ԓx '@5k ΐ!" `y@]6 s"` @]+   e#a@50`"`)@]  $@؀ 2  @M@j @ O逢 !@!H e#a @5#\` `/ e b`? "`@1   $ `  e" ? $ @1  $` 2 `y`Y2f @D :^ " `!P@T <   8@\  !`@!? @VҒ8  @B @!x/ @4؀ <   @p̐  @ !@˰ !<  @@Ȓ! @R!㿈 @/є   !&@/Ĕ! 6  !@@Mߐ @] ":"  ?Ò* @/b )@ @$  %"@v  !@q0+Ȑ@b@( "!@\@. !@T@M@MY @M!: ,  $" !@@ 3 6" `2!@3@/8 "@*D@BT$"  " -D "@ ''''@耢 "(@ @MR ! @Ԑ  !@ 㿐'D@U'H 2!DHb@H @*"8!@"8@{ @ ? "P@Ԓb8G  "`@˒b8> :  "4b8@T 2!Db@ @"!@"@{d @\ ? "P@b  "`@b  :   "b@ 㿘! ## e"b@4c"c@3b@ZW 㿘@ʔ d , x L 㿘@p  2"  @* "㿘@c   @ &  @  &㿘 @ @2   ."@, J-`?` J  eD*8  + J (J? `2 "@ 㿐  ’ 2  @6 $$ 㿘 @   @   @5ސ & &㿘 2  `?J@   Ɛ "   㿘b  Ȑ 8"b ."bL`*L   =#@ "#"" L  `<" `>`! 0 0  "b   "b   "b +Ȕ "b" 㿘c @1 㿘!"   " @"  0` faԬ 'b  M) SQ`@n "  @SS!#0@1  @h  Ѐ  *@ "    #8Ð@yb  @OR#@㿘" //  ސ  cH@1L 2` @~`& ` c`@1> @ & @G & } Ҁ Ѐ 㿘"      cH@1  ` `" & N ဤ 㿐Ң b  sĐ A -< (?` X#\*` € -@@J H @D B  /@1 3 ][?` -#$*` €  @ $! 0 @82  @2   @ 4 0  @`? @@ Ӑѐ       㿘wb  ; m    b 㿘b    }b 㿘c8@ސ `"" " `"@. `@#x0`@#Đ@Wg㿘@h   :`N""0"@@̐`M`>䀤<  & ?'Ȑ ̖Ș @X c@- ` @i'̠ c@/Ɛ  @Y̐ 0''Ȑ Ș @W c@  @N   쀢@6'  C  @"N@`>5 2 `<`* `'` ؤ`? @. Oـ  e#H`Oؔ?"`` #H*  ##H@ #@ݒ`@ ` eH`?"`H * "H@q  㿘 e`@0E#@V 㿘@㾐 f!Ԥ '#' `) @6@`(? sᘓ* & @ @'@ " @P@/K@ `0@k @{! `@@b   P@w . 2* P@t@VV 㿘 #" e``@/#@VL ` f!Ԧ'  @* )   @x  2@L @L!@  >Ԓ?@K6@!, @!,!,O@H @L ȁ㹘 f!Ԧ'@j  `m"@! < @ @ `0#$@e/@O  ( $@2@O? @@ޤ@Ox? a ,@`:"0@P @*  X:" ``@O_?,@* X`"@ђ3 "@ʒ, e`e@+  `"H@@H @G. :`@ z` `"h@ђ   S"ܓ*` J@    @K"㿘@`a@+ ??@B @B @B  $ @GĐ 㿐&:  "b ?""@W / @)`@:5Ȑ a#\($@1Y# (@)m(& ?$ `? 5(@1;$# @)O((& ?$ 㿈   ?'  @UϚ ?㿈ch@k#X ~ c@Kא- @ # 2,L@ S#p @( Jcx@  " @( L 0c@~ ` a   @( ` #c @yX@  c@$ c@(r @ J *@ 쀥 @֐@%㻐 f!Ԑ'@Mc: ?" 8c#@  .`2`@  :" `cȔX @@h K:" `Gc@K!,@  cX@ / f;9: ?- +@ @z` ,@ $#'"  cX@ۖ0@  ߠ @O f! @Ji 㿘       2N:  , ) e!D*`: ?   ` "N N  (*`:  - +s? 2No  N -"* +*:  G D e!D*`: ?   ` *.4:  .`K $ ?Ѐ`5`- @-`B2*@ *@B `5-@-B2*@ *@B  N   8@$8 @$1 N Sj>:n :k :h f  S#PcX  K@  ` b X*`@ R` 2O N  ? eaD   ` :, @@# #?@!V @  @!I  @#ז`    @!3    E>  (K@: ""b ?㿐   :%   2`` S#X@3` + @0;   S:4  S: ""b ?#X Sc0  @3` + @; +2@ + @"c   @ Ɛ `դ S#X 4 0@ @ 2 @ @  4`,  ,`@B2`*  *`bC eC (0  8   ` `F    `d`p@  " F  S2#P`( #P#PJx@.=  J#`#\@.0   f!Ԥ' Ȓ @&< "@(`  @_@[ @W!@ `@C!,!,@#8@D> @HS ؁㿈   ?'  @R ?   @* J@ " 㿐'D'H   !h-'N] `.`?: -@L2 Ǖ< 2 $ '    ?L@ "'`.`: L@@  @:  ?'  ``@ސ 2@u @H5 .`   &D@ a  Y-: U R@2 NHN D..`  L   <,@ L`  2,@L "),@L  $>   < "; "   2 "  ,@ `  ,@L Ȣ`,@@JqH 2" f!Ԭɢp'@e""( @+!p 2L ax /$@*! @*! 'J  @,Ò$#($@ᰐ@ P$ $@*@ G$$@O` J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @: .?'l@l l l@ $@ : ?L 2,? l  l%b( ?@??  @F!؁㿐b(@# ?㿘b( :@@ 㿈 b(///@찒  $@ @@ @&@  8      d   p                <    X  |                                     (     t    㿘ɶ"0 1!*"pN%Nۀ`M  ē*` €``,`` !ɀ`cɐ"pސ@t d 0,@> dɐbpР @e  0,"pƐ@>  0, "\ZN@ N R@P N @``` !ɀ:"`ɪ"p):'!:"`""@= `` 񀥠ɐ"p:1,¬ ``ɐ"p:w1,@ * @>'  `` ?$@* $@Nf 0$ @$p@ :T1㿘 z N?  eaD   `  e!DN,  N*  ?А   ` , ."*  N? eaD   `  eN?Р e!DN?   ` 2 N * @t *` ƀ: N  :b* 2  * T J: *`2`:`@: @v 1:N" ƀ? N" !`Y G8 @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0`  @0(`8 ', ' (H ( ( )< ) ) *< * * +0 + +㿘 ?`2"`0"`"`   "` @G 㿘 ? ` $ 2`0 " $@ܒ $  (€ $ 㿘"M?N 12I?8 D?2 @? & %!& & ( $ 2 %!H& $   (  )& "  `"   "`  ( ?"  `  $#d *@  "` ?㿘 㿘 "@?  "<? 7` ?? ` .  \*` € %  $ $  @  " `$  "a 2    "b " `  $ $    $`* @  &@ݒb(`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" "b@ $ " @m?   " F"" s @ `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  "bP $  " " ??㿘    "$? ? @֔ 0  ? & 06 "* $@@&  "@ 㿘 A?`2@0;  "@"` 20?  "h  @`#@  ?( "$$$ "`˰ $$ "@?㿘 " ?   ?  @ / 1T 1 3 4 6 9x :, : :؝㿘" <&? 8`$`(€  2 ( @ (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€h 0 4@`  "? ,"` + !ؓ*` €Ъ  *``` 4  `&  `-`0  `4 $@&إ4@@9耢 & & & @&``$  &`&@& 4?  &4&"&`4& & @&``$  &`&@& 4ڔ?  *```?#4* @ &"&`& & @&``$  &`&@& 4?`&  m p ` & & @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & & @&``$  &`&@& 4Y 8@A? "@`%@% &     &  *`` `?, & 4   ! &"&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @ "p  *```  *@ *`"  & 2  4    "p* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @   T hc  @, `a  *`@ ,   *`    $@ * "  & T4    @ `E  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@rؠ ?2& `$`(€ && & @&``$  &`&@& 4@䀢 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@  @/ 0 4@`  "? ,"   c&&& 4@1 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘S `( `$€ (`(`$€ $`(`$€㿘 (@>Ք (@& 0& 4`? > > ? @P AL A C D@ D E㿘 (    * * " " "㿘 0 4 @`  " ,"@` !8*` €)` '& & @&``%@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@`  T`  *    T`h+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@$@#@&`& & @&``%  &`&@& 4?`  T`b  *    T h+`  ` ` `$`$ $` $`$@4 `  T`Q  *    T`h+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`$@#`&`& & @&``%  &`&@& 4O?`  T`   *    T h+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@* 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ ""22 ` & 4@ 0 4 "@ , ,"  0 ( @ ""2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@㿘`(`$€㿘04@`  ,  Th. ((```(@( @ @ h` &@6 . &@`` 6@(``` ( @x@ h` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ / ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0@;5 ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@; @&` & 0'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#. @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@ '48- @ ` 0@ `.@(h&@&H`@*@0h'H '0?'p  '(+ '$@??Hh.(+`', M+`$  0% ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? ' .@+`0@?2[  H+ ` 2?㿀   ( ' #?#d#`#\#h    ??! ' @ 2 (!' ? ( $€㿀d !  ( `' R? \#\#`#d#h]! ?  ,??"-$ +'"@\#`#dؘ!P#\#h>  ? 2 (??"` $ ?""$ ? ( $€0 ( $€  T T"  T"@ X"" 㿐#\#`   @ 㿘\   X!JJ@2?` 8 ?"? & %!& & ( $ %!H& $" ?   2q?4l?` ` 4g?``$ `?' ( ⸤  V? ,@,@ & ?$,$L$$(  $$$H$D@{d$$P  ( $0   (┟$$8  D ( $<,@ $  ( 0*$` $ 8   X<   * X" @& ?   $ $ ,$|@U$㿘     `"E?  *" 0??@8& 0 $>( 0$@ 0@8@ 0$ d$ T @$ @ `  P@*  L $ @ 0 @@  P `*  L  < $ @*  , @  8*`2  @ <* 2@`@( 0 㿘 ")?  "%? "!? $  ?& ,& & &  $   $ $    * q$  & 0@`$ @< 㿘     " ` $ |*?.`*#@  *` * @  .`  @I  |@*  `$ |`$ `$ t$ x$ $   2` ( " (" 㿘  `8 `@7   @& "  @ "& & ""    & 㿘 ڰ?` `4԰?`6` ϰ?  X@ 2 `   X "2 `` X"?$`` O X &  *,&  ( |?,  :  ,   d* `  @u $ q&  d "  `0`0?c y $`0  " `|` 2 _? 2  @4 `  X `" ` X"?d$``2  | l 2 |`CB` |* c* `@€ "& ```` 2> "?$``@ 0  @ ؖ `   D <*  2? D <@A*` `?&  `2   2 `0`0?c  ?& `?㿘 "7?  "3?  * q"" )? `"  $€ (  <`"  $€ (  8`"  $€ (  0` $€ ( $ (€ &  q ?㿘` "?` 2@?%&` & `& ` & `& `& `& `& ` & `$& $`(& (`,& ,`0& 0`4@& 4 2& [?@6*&@   (`$&`0   (`$&`8   (`D&`<@   (`0` &``8 `< `2`$i+?  0@5*`$  8*@5`8`D <*@5`< ` @5`@ *`  `"  @ &@ &@`ijt&k(&`&k&k㿘`8 2` `"$``2@`0@ @$`0@@5@`@$`$@㿘 $  D* <*  & 42? D <@@* |* c* @  & & t& x& & X& @& d& T& l& p& `㿘`$`d~`0`t`p`!"@ `0`d`p`a`8`, 1 `l8!\  W R  L  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@$   `h@ (@ (`l?`l㿘 $~ 4 l d"@ @ ??7?2 $2? . 0@4ג h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ђ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 ??c8BA l d& l  T& d @ * d" & l`& d 0   d T" @]  d& T `"L  d T $" ~    0 # @B  d& T `"1  l E l ` 2 d T  0  ` d`?" @ d& T ``,    㿘)#ȦaȢ"" "ޠ `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8  X Q& X X w"  j f* [" 3@ ?  * a&*` + 3  4 (2  ( 2`! + )2`  2`! *  2 ? X@ l  x" `?)& l&& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d 1& d X d& X@ 0& d @ & @ ` P L*   & @ d" 0 @   * 2** `&  4  l  d`?& l& d`" l T  0   d" @)  d& T `"/  l!", l!`"#  T  0  ` d`?" @ df& T ``,   㿘+!ȴcȤbb b `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`&& X x@:# p d $"@>@8 p 1& X X`8 p  `2  p d h" ( p& X p`( ` X b ^   f  d+  l? s@ 0  ( + a&*` 2 4 (2  2`! ()2`  2`! *  2 l p " `?& l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dY& ` T  0   d" @  d& T 8` ` 8b 0 d@ *  2 ** `&  4  2 d T  0   d" @  dR& T d l & d& l 2  lR  d  l & `& d& l l! l!`">  `  0 d@   * 2@   *`* &    2 & ` T  0  ` d`?" @ d& T ``,   㿘b  X X X& ̘! )*tb&+&+&+&+$&+(&+0b6& @!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@@` @ & @`@ @& <쀥C- ?,``,``",` `?2 *   2  2 $-,` ,@  * @ `" ?@ @_ϐ$@@&6`? 2 ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘`?      @ct*`Q`1`, v t "@$.6 `(&6 .@ "&>6@(6&  u+v,  #@$.6 `( &0.@ #&>&6@(&6궺 #@$.6 `( &0.@ #&>&6@(&6 .@6 `.`6``( &0. '@( 4J꺺 #@$.6 `( &0.@ #&>&6@(&6  .@6 `.`6``( &0. '@H(L #@$.6 `( &0.@ #&>&6@(&6  .@6 `.`6``( &0. '@&>@& 6(&6`        @*`㿘+; + 7)+(   *v $  * `"?  *` @$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)""  *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &@[ 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 & d !d  +@ 6   *   & 2`* !?;@ 6 & & d *@ 6 &@"@ `V   +@ 6  `  *   & 2`*  " ;@6 & &   *@6 & d !d  +@ 6   *   & 2`* !?;@ 6 & & d *@ 6 &@U" &㿘 |    2@++bb    22`@     `0h@ 2  +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &`̔L@05  +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &++ `Ė @W)@ېb@ b@ (2b@ @ (#@ *`-0 b@`#@(@?2@   3 * i   3 Ȅ(2@@@?`?㿘☺@ ȤȈ@ <@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@ⴅ(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`)"@ "'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@)"@ "#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿘?c6  @`W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@@gw#@gs#񀦠,`"P   X(㿘@X( @3 㿘@7 2@ : :*:       @    㿘    b`  ?   b`  8  R  @ $D` @  $$`@ $:`  @k   @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#  "X3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .         b`㿐?X  @  ?@ `㿐?#`  Z #h B#p7ąB' B'@    ɖ @> . 6`  `6 @3 @?#` $%#p7ąB' B'@@ f #p  D'…B'@@ F #dd#dd`x B BBD# 2@  2*2   㿐    b`  ?   b`  `V  $D`  $$`$: 7 @i  @ $@D@`@  $@$@@`$@:   @ $D` @  $$`@ $:` @??#@a@? ?#@  #4@   "  d`]4 6 6 ,@ ,  @  "B `  ""€ `": .  >  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@.  @@b  d , 6 @4 =   b ?㿘>@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@@U8@U4㿘  R  @ $D` @  $$`@ $:`  @hl  @ € $@D@`@ €  $@$@@` $@:  @ $D` @  $$`@ $:`u ?n #!@? ?#   3   2 "  S Q 46, 6 +   " B `  " " € `" < . > @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ `@@ .      㿈 1: ''   @.ݚ ?`@1찒   @.˚ ? !:" @U$"  ?@袒@M  "b  " $ 㿘'L'P'T'X@XL㻈 f!+ʸb'75ʬ3/@虒$ @ђa b#!@b%b )J #@ & @ & @a  ᠐ @& !!&  @n찒 @뭔 耢J `#@"$  @V찒 @땔 耢J `@ $ 0 a@=b %bJ #"a@1 $ a@, $  a@'쀢 t$ $ $  a@찒 (@] 耢eJ a`_#@[ $ a@찒 @F 耢NJ J`H@F$  @”$!!@ !!А@g *!ؐ@` #@Z a@T "$ a@ʔ @&t  !Ȑ@? $   @ O! @#=! 㿘"`@:    1 "㿘@* " !@ " " 㿘@  ! @  " 8!" 1@ 0"!@jƒ :̀@<  : O "b !@גb $" :b @ 㿘!" @j$"p"a   ''''''@@%''b '' @ 㿘ʐ@   2H( HJ  " H?" J  H  2*? " 2HJ% W`H@$| W`H@㿘q@Rbm `9 1 *$㿘 X#( X ($ W`H@$/ W`H@$ W`H@$̈́ W`H@㿀'@Q ?''@ 耢 @eB& f!Ԩ'@ ( E e@!  : eb@#@ސH b X#tb& & & & & $@$ $  $ @c$ @(`'H 'L'P'T'X'\@!@H ,@*`€ $$ @w  $  e#@Ғb  @"* &  &@& ! @!# f!Ԧ'@!!?  @pC/@pH @   p   @ #@`p @!s#㿘` $  !㿀@( $` @j`   @;$ @a   & &   & '@T$ & &  & @\ `$`@2`8  $`''``@4  @i @ ''  €@X "  @$`$`@&$ '@H``@㿘 $@   @@ $  @@ɐ㿀 $`!@ @  @ 2 @ߏ#( @$a  `@$; W`H@ (㿘!:$"  @oP ?2" 2?  @_ ? ? 4 ?JJ2 @(*`*$: W`H@$6 W`H@  L 8 @ \ p p $ \ \ \ 㿘@`@ @ ` .`  А  *`: ?А *`: ? `*`: ?` `2` ` `  - ,` €?, ?".` ,  ,  ,   , *`$ @$.`.@㿘 ʒ  @ "  @"2    @ :, @ Y  .",   @ ` :  , ,  , @ 뀤,"$ W`H@$i W`H@$S W`H@㿘!:"@͢ @鍒 Ġ  @  @} 2 Ā @       h P 8                   Ȁ` `  ? eD 2&+` `  `  `  `? eD  +`\ @ +G` E.|*` \+  nv+ \+  rp+ \+  bj+ \+  ad+ \+  v^+ \+  tX+ \+  fR+ \+  sL+ \+ Є 0+C + >+ ` @ ` \+0  00+ 0+ ` 0'+` \+  M+  eD `    ^+`  ? +`@+ -+ +  +㿘@N@:`4@*``2`"*㿐@* ig) e  ` !D@  ` ***: "%.:  :  & :  !D@  ` "`.:  \  @2`*.?  ``:N@͔"@ @@*  2.(&@*`"&`N@:`@"*`&㿘 N@`N@8N@N@ "*㿘'L'P'T'X@L㿘 #"! ec@#`@##@c@'B㿘@M>@  $>>2 㿐  ?  @( ?? $  W`H@$ W`H@㿐1#7˸ 5;3&ؔ&a&d"#`'a#Զ  .( > @?* ˔㰖` (@ (   (. @?*? (˺ ʴ   .@/@.?$@`ʴx  .@/@.7$xਸ਼ ./$ ߅, `'``,`  , "''@#  x#ˆ@4("('ˆ @4(@'@(#ײ`` ʐ ʮx ``  ``  )˒! "@  @  !!؇(@'@('$"ʺ  " %@xx˄ @  aa܇(@'@('` 􀤠Oض .$ۖx˘`ᰔ ( ( . '   (@&@$ . $(  Y Ԁ˖ В     2*`0"Ё㿘 Y!`2 u  3c`d#`6  a"c` b6  $ d6 . @ *& 5@ *`( h5 f * 5j a, @ l #`˗-@ "` ˚n.c` @@ ˴"@b@"#dc &c` @     <` @1 @%1 )22 0@ (@@ !!`2@ 1 @  `#` 1 *!` #`3`1  @#` ` 1 #`3`  !`  ` 3`1 #` @@#`  ` +`` ` @ @$@ $$$   㿐'L`'P ˄`' '˄ '' 97#``3$3@3.`#( ., ;1 @(31  @5@ @1 @   . @ @ @@cЖ`׮``#)>' ~!~     6 . ( 0 .`@.  @6  / 00@@ @@/˱6 `?1ϰ#`6` (o ܵ.`.݆`3ޱ. c`@`? `4`4` c `+  4`, 4 * 4  #4c %/ L `  @   @P  㿈 Y!`  / / / / / / //''.@.`.`.`.`.`.`.`㿈N@ $ YN` 1@@ !`2Z * *  " (ϐ 2 N@ _k@   N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ*    N@ `z ``ŀ`Z  `@ˀ`9 `-4ґ* @ % ]  N  *` *"  N p 2 N !ʒ @ݭ"@""9 N` z  `?ŀ Z  @ ?ˀ 9 -  ?ґ+ :  z `?ŀ Z  @?ˀ 9 -4?*"*`N`"`@ `  +``  耢 B  Yḓ3  3 .@ ? 3 `.@ `? 3 `.@ ? `.@`*  3  ? 3 .@ `? `3 .@ ? `.@ ? `.@`*3 ? 3 .@ `? `.@ ? `.@.`" 㿘.`6`IȈN N @6 3 0(0.++N `! `<0(.7`N  `(.7` 㿘 2 a $. .  H . .@0 . @6㿀 f!Ԩ'  ',`2  `@`*`,2  2  (  ˔ !԰  @X P f!Դ' ``@ `N@ 2$ YN``$``a2 Y` `N` $ Y@  *  Y`@C* @2`  Y" 5@4  `  ?#@ @b @И ` @?@v `@r `@ ?#h#f 7  @J.```$ ?#h# @% ``??#h  `*`2 " *2 " *2 " *#h $ 2. . .  .` H @T@  @@@@    @ *2@ @- @0 @(*`@ @2 @ (*`@   * @2 @ ?* @*`@ ڔ*㿘&0@2 2 c@2 . #d((33c@3. #d(( 2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( $33c@3. #d(( (2 2 c@2 . #d(( ,33c@3. #d(( 02 2 c@2 . #d(( 433c@3. #d(( 82 2 c@2 . #d(( <333. #c($@ hD@&@&㿘&0D@2 2 c@2 . #d((@33c@3. #d(( <2 2 c@2 . #d(( 833c@3. #d(( 42 2 c@2 . #d(( 033c@3. #d(( ,2 2 c@2 . #d(( (33c@3. #d(( $2 2 c@2 . #d((  33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d(( 2 2 c@2 . #d(( 33c@3. #d((  2 2 c@2 . #d(( 333. #c($@ h&@&㿘 `@H*`2`  *0 : *0@`( ` 2㿈.7 6ܐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' r'k', 2`*`& `**`2 &  6 ,  2  J'C'{, 2   * *`+`&@2& ߠ / 2  ֠㿘.56㿘.6  `O *`2 `  㿘.6  ` *`2 `  㿐 3``*``*@(`@ `*`+``+ @ @  '' 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 3``*``*@(`@ `*`+``+ @ @  ''7 2  2` `2 2`2 2`.@.`.`.`.`.`.`.` Ҳ`㿐 ?  @  . ( *`*@ *@ @ '** +   '..􀢀2 . ...2 . `. ƴ㿐 A*`*@ *@ @ '** +   '?..2 .  ...2 . . @  . (  Ŵ *`*@ *@ @ '** +   'x ..2 . ...2 . `. @  . (   YH `? 2`*  f!# Y!b'@e$ | |b@ |@Z|@$||" 0/5 )" @  $"| @*`|@,Ū" @8@,ϐ@2@,ɐ|@,Ő@,@&@,|@,@@,@,ޒ@   @,?    ??@  @, < @, <   | x@s@, @,k  @ې@,r@,l @ T  |@,c@ K   `@@,W`@,Q  @@,I@,t #@+ *    % x +  x*   % x +  x*   % x +  x*   % x +  x*   % x x  % x x `% x*`Ԗ ?耢 ? @4 㾈 f!'LL'D' /:   "a   !8ْ  "  %   ="'p''@ P@ `@ @ @@ 0@  @  @  @ې %@   ?????'̐ ?'•  / @ϔ  ???''????'???'` L@DD@X~L-+ /O? eaD   `  O` b X*`@ R`/ O` c H*`@ R`/, @UƔ  O` ` ɀ,̀   aH@X5 @ , @\ p @@ P @< ` @8 @ @4  @0 0 @,   @(  @$  @  @ a "% @Ra @wka `"`4% `% ?  f!  @!P㿘` ǖ  ` f!Ԡ'`''' ''''' '$'(''` ``: : `` `K "b ?!  @!`㿘` ` 2 `@  : "b ?`?` &``@ , :   @ * &@@$K W`H@㿘 "1N 1 !ap'$@J /"  J / @1 !ax$@" J /2"  1!@|!0: ?"b  $# W`H@% W`H@$7 W`H@㿈 ! Y  #d   #\#`#@ #ȁ㿐L? eaD   ` 2  ' e@֩ @#  J@`:`D `@ `  `2 .@J`".@ .@``֠ 㿘!!  !H` f`` `#\`#`'@ #d@Y@ʐ  !@ԪaȤ  [?@z@GU G J?` '< @ ,  , aА@<$ @jĀ ' Ēaؔ@4 @ @zP@  @ʔ  @ @: "b ?  @E!x f!Ԫ'@U  !@5aȤ NX?@z@ҐR  J?` '؀; @ؐ ,  , aА@ɔ$ @䀢 & a@܀ @,耢 @y@!  @֐ @ӑ @脐: "b ?a  @ Ӑ"㿘 "':N  !: e!DN?   ` 2  b@L@ : "b ?$ W`H@$OpenBSD: sigsuspend.S,v 1.4 2003/06/02 20:18:32 millert Exp $ o W`H@$t W`H@$OpenBSD: sigsetjmp.S,v 1.4 2003/04/22 19:57:57 jason Exp $`" (0? (`0$OpenBSD: _setjmp.S,v 1.5 2003/06/02 20:18:32 millert Exp $" " " @" `&"`@>6 0`$OpenBSD: setjmp.S,v 1.4 2003/06/02 20:18:32 millert Exp $  0 " 5H P """  """㿠   @" &  g @㿘 b  @Tޔ 㼐 f!?  c! '` $: `7: @  &̐``!(a"!(" 3 !/@ *`  @ *  " ` 2 @ & @ ! @ %@  "  '@ @ X`%` M` @" E&   :D &/ % eD    ?  ` 2 .ဢ߀݀`2 @}@Ҕ!` `ؘ   @Ԓb0 2@&"` `  "`: "b̰  f!  @ "@h f!Դ;c8' b "@MЖ    @x?А@! @B OЀ   bP@)   { / - + ) L f"e4i` b2f``2c`  ؒ *2#"0  $@cX0$@\p0$@Ub0 #\$"@L@wW@ )  @@ @w~` @wv  "& 2   22 & @ 2 Ԣ``4 L  f   @ i"㻀 f!Ԫ;c8' b "@M    @?@qK! @  O   bP@y   9 L f'4+ b2($@f@v@   @@ @w @v a0@2  aԤ4 L ΀ f a  @ "Ё㿘:b @:@Y  b  b @<㿘!:"@! @v   @4  @f 2  @㿘!!   "@аb$!@:b"b㿘!! ":@D$!:""㿐a     "@Ўb $@6 y J?` 2'#!!Ȓ@ , L@ #@ # 2,"!̰@ { !*   @b , L%L "  " @ݒ ,@`@7!̒ܖ " ""`  "'$L " *`:    $@ ; , @ѱ " $,  "$L  $!́㿈L@ 0  `L@ x X2 @ ` @, `< e!D:`?   `  @9, ?Г:`! $, : ?   `D : ?.    ` ?? ` @, `ʖ*:  . `$? eaD   ` 2$?$$:  . *  x" '" "  Д؀ ?  '$ W`H@㿐 @?.@ .  ?#@.   ?#. ` '@   $Z W`H@㿘"l`   @J  $bl"p` %h@J $bl8 $"p5 bl* @*`@*`@"p*` 'h "bl@tbl * @*`@*`@*` @t$"p $h"p@Jv $bl*` *  *  "p* @h&bl$O W`H@@"?'L'P7'T'X7L@t '' ''@?  *@t "& "&@t'&: "b ?㿘@te  . #@``  ,+  *    * @ `J@  @`*J@  * .  ߑ+ *㿐`2&@2&'5+ L@ 1 #@ @U  2  `@J 2  `@ &@  & ڤ   @om` 2& 2":J  *@`*@ `: DJ  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ J`  *@`*@ `     @ ( (㿘"y@ `  А *`: ?А *`: ? *`: ?ɀ`2    E#,  €,@` ,  ,@ ` ,@`@*x $@*x   *` ZК . *@  ` :   *`*@` *@` * *@"@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  㿘@w `@0 @` @`  ``4` @    㿘@@ , ?@I@ 28 @6G @   % @r  &@ e #@xax @  @ @ @r1@&@㿘 :     @ $OpenBSD: ffs.S,v 1.3 2003/06/02 20:18:32 millert Exp $GT "2 J "2 J   "2 J  J  $< ( b("" c4" p ?" d ? l0 "  -  ? s8" w ?*@`! - r*@`  - w*@ (@@` 0 @ 0  - x S s*@`  - r*@`  - w*@ $` 0  0  - x S s*@`  - r*@`  - w*@ " `"   *@ "   *@ - x T t*@` *@*`$  W`H@$ W`H@㿘`: "b ?@pʐ 6`? -&   ,,-`@4Ȓ  6 @4 4ݢ2ت`k@4 @,` @4 @,`  # @4   @4}-  @,`  (5 : @4g@4c  6  @,`   @,` ڨ@p] $< W`H@H @ D% * @,`@@Fף,`@*` ,  &, @F̒& @? (* @,`@@F,`@*` ,  & , @F&  2?* . @F. ?$ W`H@㿐 #\.`2`@( f!'L\'D'P'@"M   @纐" L   b@Ƚ"  .``2 @DL@R,`   "@Ȩb  4`@ DL @P@F6ж 4` @h  D??@ ?? '''@x ˰? `!"@!D"" '@  #''  cv:b `0 ?X'`=" ` 4 !/#\``! @  b@Ǭ!% e c@悐 @.% `#\/`!` @  b@ǒ! c @i `  ` @ܐ-` @  e  #@Rc0 @  @Q?`@w " :" # ! e e #@:b `# #@rb@0`  @ b @+?@`@H` q`@v`  c8@Jٔ '@;!'@ 4`* @n  @Dk @ @聐@ @J@ @ /:@  e #@ےcH07@6 *   +6`& *``+ &% @   @$  :  "  e@ e #@婒cp0 #@夒co @D@р   #\  @  @ߐ OK  @  e #@scl' '@  #\  @    e@# e@!  e #@PcD@OLL @J@IPP @J @C @J@G  :@qb D e @#@+`O @Gh   @I O`   @ K @m f @@mӐ͐ @ 6 ? f!  @ܐ p  ? ???' `('ܔ@wԀ ?0@9 0Ԁ   @,   2 @$?㿀! f!Ԑ  ?  ?'//' @ !  @ 00 f!Ԭ'     @@ǁ`X `@ @Z @`2U? Z#`"N?@Z2 H  `$@@P@ `X@N@А`2㫒   # p<    T`w   ` @      ؀ :""@۾?  @!㿀! f!Ԑ  ?  ?'//'@  !  @!㾈! f!Ԣ'@!?쀢 #  > < :7 e bJ? aD  J   + : aD `@ `   + :  X*  R  *J   *JȐJ  7 *J      J    e!DJ?  J   J    ?*J  @p L + -L   @ 56 @Ғ -   @`S& L   @ ?@    @`7 @T @OL@ + -L`  @`0 # ` @`L`  @ `` @`  @ِ  ?@Ґ`?  ?  4  @Ł 2L?  @Ȑ! ` f!Ԣ !'#\ /! @~S 2;    ?ؐ ???' 'Ԑ`('̔@tږ̀  &a@! ̀  !/  !#\ @~' 2  @p   2/@̰ a  @r!0` f!Ԧ c'#\*cФ /! @} 2S  !#\ ! @} 2F    ??ؘ ??' 'А`(''̔@ts̀  0@+̀ ̲ !/  !#\ @} 2  @    2/ " a@@lh @̰   @!hh`'X !'X@WƐ    e #a@? @Ӓa耢   @ 2@ڰ?0&   @C  !@7-  "@?0x   r   @z"(@) @7  @q"@@( @( @=  ":@b   e #@᭒bh@( @a耢 "X@y X J@ 2'X "'XX@HR / "X`' b'X''@d\:@  X@H; / "X`' b'X''''@dےB:X# `@ޒ 2@5X'X@i.X ` b @"@( "b&b@ed 2J@@'X@@G / " `'@ "&&&X&&@d:@hb  e X#@#b@([ @? x؀ N  :@'$  cP '':@b̒@$$   #X $:$$ @b   Z  #` Z #ẋ* 㿘? @ 㿘@ 㾐 f!Ԡ'@!``: .  /"b *?,  @( 6 ?4@c44@ @> :" `0 4@, @L?2@`?$  @r#Ё㿈 ''@B 㿐N@ ="`@u@ߒ "w @j*7@* ,`` i :  ` `Ѐ  `@iB*` *,`$ `"@hڑ*   ,`@j$:`" 'L%:L  =2 $@h  *`" (?`*`* : , *`: ,   =2 =,@ *`,   @* ,``  㿐: *`  "  "@P 㿘 [`ؔ ! @> @ !: "b N  "b  㿘  [' @>e % [ ! @H  @>Z`:"  $*` @ ؔ @ @ @>J` @>F` "㿘! [@>= @  [" @>7 x@ ` ؔ  ' e'''''#H'@Q耢  ?$OpenBSD: Ovfork.S,v 1.3 2003/06/02 20:18:32 millert Exp $ B W`H@"` X f!Ԣ>' 2 [@: 2%!P! !P  ` @  2` "`@ `@N 2 8@᳒ 2@" @<a  @#H㿘 [!P "  @  2  `@ቐ1 #X$ W`H@x  #c?' '> ''@ {? "   @ '? @ :` #@% @ʐ  @Ɛ ܐ@b  @ @ @ ??܁% W`H@$] W`H@$ W`H@ I I I I I It Ih I\ IP ID I8 I, I I 1R( +# (# %# "   8  h          !  !0 !@ !X !x㿘: "b @fې ( `&& & & & & & & & & $`& $@$$@ @ h  a@ ^?46 `.  @ K@r H`D&`6`6&` $@ * 2``6`86`8`&` &`%   צ@А@B &"  2 8 $ !ؒ r &  $ & $: "b @J@f@f @f 㿘`(`D&`$ @N@Df / @2`L`  `@@; &`( `0&`&`& 㿘  ` @fU T 6 6 @fO  " @  @fC@fA  $ `%  :"  /  $  `@f+:"" ?@f% 㿘 $@1 < `4<@ $48`&8* 2   @ * 2``848$  !ؒ ʔ $ :"  48&$: "4:*2  X`"  :$ @ 0 @" : "  " @$ 4 8ܰ` *$$@u $  @Ԕ? "" ::b  4 :$ "[$ $2@   $$@ C$Q@eT6 2<$  d $ $ 〢 2#@H * 2``48$   !ؒ 0 $ :"  $48: 4: 4< $  J /@  /*@(`@ DO$@e5 T6?2 @e/:"" $C $* T62 :$ 22&  $   !:"   $$" @$$$ 2 @? $ $$$   48$ 2`<:   㿘`@: E"b  $:@>"  8  9 27   "@y@2  $& $ T 6   J`/ $ @&  !ؒ v @&  2   㿈  $ 'H @B   HH [ :"  % U5 82 $ `  ?`  4 ''쀥'H2'@@| :H 2 : %  : `'@B<5 :'  ' $ J?`/  $B  / * U 6"@ '    2 `L` .2 `L` ?` ` `@` "%: `@ '@ `@͐  %: @c@@A 5 8 $ & $$ Ѱ   "   $  '@ "4 6$  ` $ $ `  : 4 :   4 8$ 4 8 6$  쀢 " $ `  "  $ $  D $ #4 8 $    ($ @| D D$ @  4 8* 2  *`2  $ &```@EH 2^ $`@At耢@c $   2-- $H29 U 6 2   $ C     @s?  5 8 $@U& $2 H   5 8@c:@@A, 5 8 $ & $: ?;"b @8 $``@`:    > 86 > X>> > > > (> 0> 8> @> H> Pf ``@> #!:" q` 2 &`$" Q i :" &`  > X>> > > > > (> 0> 8> @> H> P:  < @ ((&`0 &`, N`D`.6`4N`E  ?`Dc  2`  `2``0"&@`R`6 6`,  @  @    㿘 ( *@b$  2 $   "$ @b$ $   "    @A  `"`" 㿘`$ H@b,   @֐`$ ``6 <& & ( M ?& @@Ԑ D㿘@bA  㿘 a   "& @b/& : ?"b   @bP&  2 &   "& @b&     D" "  2 D""  P66㿘   @8   8 $ ,   Ө  ?% ?`0@:`,@: "b  ?7: & $! W`H@$R W`H@$' W`H@0 f!Ԧ'! "(e  "(@ٔ$ N . N  2 "0@ɔ$ /@?_ @`  "8@(*`J@ /"*`֐ &i!:LL 'ђ 2#< (@ 2`` : >N"b # H!:.@@ ׫ = "0$@~@F$ "2!:N@ / N`@ O @J@G#: ?"b  b8@$@$ :"   !:" ܐ$"    @"@   ` : "b @`# #  /,&@@-@`Ȑ0Đ "#.@`##`' . -@"P@<-`d ':"" ' ''! @"ʠ?! * .* '@` @ ' .- - -@> |`Ԓ u /-   @B/ b" @.$?#5 @B! T" L` .2 `L` `  ``@Œ "" '" $` `   `c/`@`O "&@&@@~ 2 `? /, ``$ @r@>-f' `'"  '" ``@_`@_ @= $. W`H@`   ` $  @@ @@: <  "  >(` :`@?? D8 >` > >> `` "`@^`  @^㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @L@E?@; kby@*@#?@ 2 8@@? c3> '"`. @ . "@٘2 &  : +   ; &   + : :&㿘   eaD#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2  y  @  #  @ N @  @ @ (b N?   ` 2U *:  _"P @ :M N@?@   ` 2U;*@  "# @ :4 N@ @  2 @ :) N@?@   ` 2 *:  _"  @( N?   ` 2*:  _ . c`$ .  `.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   $@ &@ @ @ 2 .` @ @.@ 2 2>, /` " `/` @>, " & q 2`l# ?#$!"\ D/  > > /   @ /  "?>&@ ,   :, :3 2"  :@, ,  &@  :: "   : 㿘 @ N * @j   ) e @ N@" `   `2  `      ,  `        `0 "  @(? `"!D `@ `  ``_`!D @ `  2 _` `$!D `@ `  `_{!D @ `  {_  {  @є2  @ @Ě]`& ` `㿘  0@ N * @  ) e @ N@ `   `2  `      ,  `        `0 "  @m? `"!D `@ `  ``_`!D @ `  2 _` `$!D `@ `  `_{!D @ `  {_  {  @2 2 @ @^`㿘 ك( >+@ @( "m M(NR?~@ Y @o@@_@耦 $@  Z"q &( v82rm   2kf e b( 2a\ 2]X 4YT  ( Q J G((@ @0@@0>@@; #7((@@ 0((@@ *(@((@   >(@/(@@.  @@(@(@0(``   ` $  @@ @@: <    >(` :`@?? D8 >` > >> `` "`@XL` "`$@XF`$@XC 㿘#/.   > @@" @ @  #$, , 2 > @" @"ܰ  @"װ Ӏ@@"ж @0ʀ@@J@n@"@@@$@ @&@ @l@e?@[ kby@J@C?@7 2 8@!@? c3> '"`. @ . "@2 &  : +   ; &   + : :&㿘   eaD#% .> @8 @"A @!@ @C @!@ޢ  @"ɶ@"ֶӢ &@D(@"| ʢ , N@: @ò` `* @@@@ @  ` @2   " @: N @  "@ : N@ 2  y  @  #  @ N @  @ @ (b N?   ` 2U *:  _"P @ :M N@?@   ` 2U;*@  "# @ :4 N@ @  2 @ :) N@?@   ` 2 *:  _"  @( N?   ` 2*:  _ . c`$ .  `.`2@ `.> @P@"Z @>0@"W 0@>@" 0@^0 ,,  @ `?, ` ?,   $@ &@ @ @S 2 .` @ @.@ 2 2>, /` " `/` @>, " & q 2`l# ?#$!"\ D/  > > /   @ /  "?>&@ ,   :, :3 2"  :@, ,  &@  :: "   : 㿘  ,@ 0 ( N` @  , @ `@雒+ e @ N@`@ " `   `2  `      ,  `        `0 "  @O ?  `"aD `@ `  ``_`aD @ `  2 _` `$aD `@ `   `_?{ aD @ `  ?{_  ?{  @ L @ `@`@@ߘL& L  `㿘  4@ 0 ( N` @  , @ + e @ N@ `   `2  `      ,  `        `0 "  @~ ?  `"aD `@ `  ``_`aD @ `  2 _` `$aD `@ `   `_?{ aD @ `  ?{_  ?{  @& L 2`@ @ `@`@@L㿘>!`+@ @( "v`M) PV~ўȄ@ d ƞ@"y@@o@耠5$@  i"@&("`8@2@ ``2@| {@v `2v@o 2p@i 4j@c `(`` ` Y@T   @ @. @@O@ I/@("F#A@ `@.`@@6/@O@2@(@  5> (@  @@/@@ `.``(  @@@/@@@(`㿘<"e @ @4"E@ `( "`    "  { 㿘 e#H@:$\ W`H@㿘@(@M㿘 e'D!D'H   ` `2 -+L  L0 L x XL )0  )`#?)  > `  $ `%E  e!D   9:G "h @`4?@  @  ?1  *'" J<@  b 41@ @  1?#? '" +<@ B      ` `   ` `   ` `H  DH"@  `*@ 0* @*  @* `      +` *`  (*  ! ` H;j&. ㉘ `v  " : "" " 㿘 (0  3`+ +` `? @@ "  > @@婐 @W  ?@S @ ?*@  @& @啒@㿀` f`!Ԑ' ''  `*2@ `?`7 x 8"  [c  k   >`P>@>`>`>`>` >`(>`0>`8>`@>`Ha  @"P    @']'5ک`x@) @ @7`/` @:1/@ cV @1 )   (@  `ې  @7 /  0os/@Đ b@ @0` (` @=_)@Ȑ c@ @7`/` @/@̐ b* @1 )  * (@ А b @7 /  ?Q/@Ԑ a@ @0` (` @`&)@ؐ `ؐ@ @7`/` @"=/@ܐ c @1 )  ?֔(@  c @7 /  "W5/@ c@ @0` (` @)@ a"@ @7`/` @?f/@ a @1 )  )P8   c  @7 /  m8  `!@ @0` (` @= @ ab@ @7`/` @0,@ @ c@ @1 )   /@ @Q @ 7 /  :m)@@ @ 0` (` @5Đ/@@]@ @ 7`/` @(@@@S @ 1 )  6(y/@ @ @ 7 /  9)@Ȕ@ @ 0` (` @xs/@@@ @ 7`/` @0(@@@֔ @  1 )  =5C/@ @ @ 7 /  V)@@ @ 0` (` @*x/@@@ @ 7`/` @?;(@@@@   1 )  /@ @ٔ @ 7 /  #J)@@ @ 0` (` @?@aB@ @7`/` @!}@b @1 )  gXa" @7 /  ?yN`  @ @0` (` @)/@bD@ @7`/` @@c @1 )  =Ґc` @7 /  /`p@ @0` (` @ &ߐ@bƐ@ @7`/` @:I@c @1 )  5;̐` @7 /  "a@ @0` (` @6u4@`9@ @7`/` @9@a @1 )  蟐` @7 /  1+be @ @0` (` @= H0@bD@ @7`/` @ʿ7@c@ @1 )  *1c@  @7 /  ?$7`9@ @0` (` @V֐0@aÐ@ @7`/` @#37@`@ @1 )  ?1`}@ @7 /  !a7aѐ@ @0` (` @0@bO@ @7`/` @?97@b@ @1 )  (P1c@ @7 /  7a@ @0` (` @=ߐ0@b@ @7`/` @/N7@b5@ @1 )   1b@  @7 /  :ᴐ7c@ @0` (` @   @  & & & &????????$ W`H@$ W`H@$ W`H@ ` (  *88 " (" 㿐 '`v$㿘 @? @p+㿘  @p# $" W`H@$ W`H@$ W`H@ t 0 @ d ӌ ӌ ӌ ӌ ӌ Ә h  ӌ ӌ ӌ ӌ ӌ ӌ < d(    " @@L!S 4x * @`*`@L$` $` $`@Lj @$`$`$@$`$` И P` `H  " "  ! $ $ 4$ 8  !$ $ $ $ $ ($ ,$ 0$ <$ @@$ D$ H@  `?$ @:   "@,  @<  @ `$ $@ T@ @ @ 4 (< DbE$ L$e& & & @ ` "`@ `㿘   @J @:  J@ | 2@  @&J@ |!` & "@ `  "@ ?  " @  "@ 4   " @ r "@ &$㿘 @?ܑ* : ` X&l * € @ @F   D`" D D  ,  " @ @J@ )} )  ,  H" @ J`)h&@ d@Ҕ   ( "( `, U"`,@Ĕ  `( "`( 0 H"0@ D@ ?  `@=6 @ 1@ - @ @Ӓ  , &@:` @:, J@? eaD   ` @ , :`@ܐ @  @?֐ , :  ? {` J`? eaD   ` ` &@ , :  +"(  ? *"  , {J"@M "@. "@A "@""@4 "@t "@& "@  @I" "@  @@ $@ T@- @ J@ ,2`&J`? eaD   `  !@@@  @o @:  J@ }2 `&@ :J@ }"   @ &J  }  @ @ @ݒ  @ " @?֐ , :  ? {` J`? eaD   ` @ 㿘 @ @ &@Ԑ *J㿘   @ J@ ^2 `&@T  `( "`( , ", @-  @  ` :J@2J`` & @,  `( "`( 0 "0 @Y 㿘J@ ``\ & @ @I   &aa)xa{`." `[`*`0 a(&0 a}a9a1a ~Z0~ `@uz @ݔ u@Bq@ m  D`" D D  ,  " @ @ `  J@ \J` ) \K )  ,  H" @ @ ` J@ \ J` )`*&@ɒ &С.` H @ `@f@x @    "`H@ @В ~  @"J *  &"@p "@Q "@d "@E} v t`$J \p`$J {l`$&@m @ $J@ ,!` &J`? eaD   ` !@P @I !@ @ ` : J@ \2  J` }2 `*&   : J` &` :J` \2J }2 @  @   `$  㿘 e!D   . J@*`А @ "   J?   `  $   @֒ 㿘@ې     a@7  2&    a@(  2 (@t  & @: J@ ^2`&  @:J@ ]2 `&@ ` ] *] ``] @:"J@ -2`&@ ` - *- ``-,` ` : J@ -2J` ]"@ @ :J@ ]逢@  @:J@ -2 `&@ ` - *- ``-,` J`]&@A   x ` 1`?,'` % e@ `@ ?D  ` "?@ * :  @ `@* ` ,`?<@` @Y- `?, @ `@" * * `" * ` ?,`  `" ` @ ` * * `?,`` @*@  @ђ@@_0@}@ 㿘 @ J@ - [    * @ 0*:  : ="40e   &@ J - ]@ @ @ @  @  `  J@ :J` ]3`@u 0m   &@l J - ]@b @ @ @X  @ ` J@ = J` ]`?&@B 0:@ @ J@ -2` :J` ]"&J` -`& -@, *`: :`@@ @ ` * `@   .`㿘 \ & @ J? eaD   ` 2" ` @  @T 2` @J`2`@Ԓ 0!L  @ `@* ` .`L `  `@@ݍ L 㿘 =@L@ ` + `@.`㿘 @ @   ` :J@J@ [2 J@J` .2J@`$J@`$ .@ @ ` J@ . J` ]`$@g . > 㿘 @  ` : L@2L` ] ` &` :J`2J ]2   \a" a@@ 2`@J`"N``@   @ 0L@ eD `  ` b X*`P*  eD `  ` c H*`P* *`: 㿐 &  ]&///& &㿘 ` `8 eaD`  ` ` * : Ւ0@z`   `4, "`4㿐 &  ^  ]&////Ȑ& &㿘     .  `yl"X*` € $" r&  "@L`Ԕ  "@(  @j" "@  @a $@ 0M "@( "@   "@K"@  @B $@ ` @ݐ 0% "@ "@0@Ɛ~0@t0@  "" " " 㿘   "    _ `& 4 @o   @DO,  "`@D,  2  @Dx` " "  ` "4 ` @D5 !"`@D 2  @D^` "  "  , `  :`@1` @$ ` " ``%   @ @㲔       -   @:`$   %  * --%% `  (  @ (*@   *` 㿘   *`   7` 2. * @% @  @ ` @  @ @@`@ ` @ @ `@ @ @ "`@ *   &@>    `@ @" * :       `@ @2  㿘`@ڭ`  @&`@C? @C 2 `` "&` @Ce&`  0"?@&`  &8    ` "     `&8   `  "     㿘  '`8? @  Ò `4 &`4,@ @ 2  ɔ 2,@  $ @ $ @㿘  @c@ .` *  @p. @$ 㿘      `2`@:`*` @E @ *`"`& 㿘  ' ߐ ,   H.    @ "@ @  "@ ` ` "@@@m* "@    (@> "@㿘   @B.` 2& ے 0& 㿘 &`  @B*` &` ʐ &`㿘  w `  >1-+)'%#@ `:0`@ "3 / &`@" !`@""c>$""`@ * @@  2`(  `@$ &`@ 2@`@ $@Aڐ  &`<&`@ &`(`@`>@ `@ `*`*  ! `>   4  2`("`(㿘<"e@& "4"E@&  $@A  " @A  " <@A < @A@A$ $$ W`H@ ┝㿐!    77 ( @ !@Q! !$ ("` @ @*`@2 @-  - @Ȥ%? А@`@- 1 L`  @L ? @ϔ!؀@*L@$ ("@5  @@J@ @ υ(85 w( @*@  `J@ @ H*@`*@ $a W`H@㿀! ] *` *  *    *      #\ #`  #h#d#l@k!P!P㷘`&`&&~@  & && ,` ( 2 :$2  2 `   \2 2   \? 2 :2  2` @0@㿐 {  }   @ " @ { @㷘@ @`2@ 2  " [ {  ] 2  "   }`2 `   〢 [` @P&@L@ [ { ,`>` }`8``@ ] 2`@ "+ *`'``#`," ` 2   * 2` * 2`Z&``@(@& 㿘 ~6 (2.?  *@`@  /2*@N   @\" @- "%  @,_ 2 *: 2`J@  @: 2* 2`2㷐'$@`a  `? *`]`?"D` `[`*C `M4J ``!"   [@֒ ] 2   [4`!8 6`[4`! `!4 `- `4`-  `] `4 4 `]` 4!&` 4!&` ` !&` ?"44 `4@- "@` 2 #"?@#  `- `*` z #H@  㿘@@㷐  #\#`@  (\`  : /6@ " a "$  /;< 9@(@2 @ 2  2  @ /? 62@ `$ @4  2 `3@  /22#\  / 8  6 /  #d#h@#`㻈\ f` d hԬ 'g 6':$ @Q 2` ` @”$ S? `€ L?` "H GaD @ /`41 )!0 .` ." @4 ` @ ? 6#\#`) 2`  2J`` @`@a@a  @ǐ"㿘`@ `@, @=ʒ@=h` ` N?@=J&`  `` *`@,&`?$@&`  @ `"@: @@=>& @$ "@@=g?` * $@`&@@` * $@` @   #@:""  ?㿘@:a `?`]@ @``[`*@ @I@"D"K  "B   =  ,  * 2  @`! `?`2`@`* - ]@ @ 2`@( `" @`* @  ˰ @*@`?㿘 ` * ?? @@ ?@<?`@< & 㻐 f!Ԣ'  @q$   a b@$` @` @@̐a  @д" 㻐 f!Ԡ'@G$ ? @$€a  @Б"0㻐 f!Ԡ'@$$ ? @(€@Pa  @n"8    (*@ ` 2  㿐`wߔ ?$OpenBSD: umul.S,v 1.5 2003/06/02 20:18:32 millert Exp $ /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@ ? ? @  gc" "" " p p x xX f!Ԡ'@ 2@ɐ@ #  # .@@  :  *  . : . . !D!D`%` 848`4 `4 ` 4 4 4 @) @ `*@ @  @ 84@ 4` 4` 4` 4` 4` a԰  @5"@ xN -    bH#\@7# bX#\#`@#! #\#`bp@t! b@d @@f!0bN  ӑ* : `K`}"*` €   0,@  ,@L@  @` "+ 0  "" "#耢 L@ `" 4 @  ,? @,@?@@!㿘`&    4 `   @ې$? /`4 / &/$) W`H@ppxxX f!Ԡ'@ 2@!@q #  # .@i@e :  *  . : . .  a\a\ % P,P ,  ,  ,  ,  ,  ,  ,  ,   , , , @5 @. `*@ @)  @%  P,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` a԰  @u" xN -    b#\@ڐ7# b#\#`@ƚ#! #\#`b@! c@ @@f!0bN  ӑ* : `K`!*` €   0,@  ,@L@  @` #+ 0  #" # #耢 L@ `" 4 @R  ,? @H,@?@?@!㿘`&    t `   @$:? /`4 / &/ @ 7'''L'P'T@ϑ'X`'''''@ L@@T8888888888hh0XXXXXXXpp  <                                          p                                  x                       0           T  <         f!Ը'    @ `? e!D `  " %! e  & &  4@Ɛ 2@ !D@  ` 2 @2   @ xc`# ,  €  4@ 2Z @Z` ?& & ޤ@ l2ڤ`פ,* Ѧg!  B Y!X < Y7!XY!X3 1 @3@* @' Y!X  ! 2u@m2i"? e!D `  gg!     @@4 퀌@ # e ? &  &@" 2ܰ aD@  ` 2  8.@# ,  €"   @@& @$`@$& &@ @ "?/ J #  ?& &   4 @Đ  "|0 L`  ?& &  p@  4 @ @X@0 L`  ?&  ,@&`@"L,@&"?" # e aD@  `    &  &`4@e "~- e D@  `  ?&  ,@& `  4@> "$@T,@8!H ?Հ`MB!ԓ*` €` ""   ]#,-`R   ]#,-`R `` %   逤@  ,@ `? &  &@ 2 @( @A  x X@5$@,@   x: p2l"8!1 ?Հ`:+ *` € "   $ !,@ `? &  &@ 2 @(8 @@Ӓ@/ @ e E@Œ @@$@,@@M 2":"$@d !?!  @Ȯ#( @^` @ `  ( 6( " * @- `]** @]6` -* @ 㿘< 2 * $@ % &&@@ϔ@@&$@ @8@Ⱦ"@&&㿘 0 @2 4@3$ $& 0& 4c  @,@< @& ,@47  @@Ȓ& 4&& 0 ?㿘?,<"D`2` @?` 2`0  " ` @ƽ E?` &` ?6` &``  6` `0  ``4@& @ "@-?&@*` %&`` ` ?߀6` @@ (` 2 `` &`&@``@@ `B &`&`<&`8&`0&`4&@.`B$„ W`H@$OpenBSD: fork.S,v 1.3 2003/06/02 20:18:32 millert Exp $  W`H@"`  `!h''@<  @Œ!`'`` `% 5 9 ; ! تШȲl'   * ` *J`|`:2 *@Ē@Ē@   @9` 2`X     @.` `X $`XĒ @ : `X $`XĔ@`Ѐ?" $`(@  $`0@ $`,@ $`4@  ^@` 4`Ē @? 4` @?2`0`,$`8 Ē@r?2`4`8$`< @e?.4`H Ē@[? 4`J @Q? 4`L Ē @G? 4`N (@=? $`P Ē0@3? $`T 8@)?$` Ē@@? H$` @ʐ P @Ő !X @ ` @ h@ ! ` a/////@?8&|&@|& @x? x & Ē@ؔt 2 t@ | . . Ē@˔p? s  . Ē@ה  ^@2`P.  *`:  p  ,: ? 4`p@] İ  0Ĕ/@? l *`&:  4   aW$`@1$@㿘@  @@x "&@`@ 2@ e!D `   > @kP..|..l.L........<....\..,...............|..l.L........<....\.., ^ 㿘 1# "@1&#"" @Ȯ!`@1C$"` "#""# @ ?J:   JJ2JJ@:  :2J0 2J J@ 㿈#\?@ p f!'X\'DX 'H'T' ?X #c @T !"@0ܐ$ "c@ŕ"' ̬@0͐$ } '܀    @Ð A' $@!#/ ^ `+   @| #T@Q찒 ` @@0ΐ@@0 D@O @  H"D'"  j '`9:/M@  `(<,L \28,!, %$@0 $@0   '" ? f@*M@@ $ 4˨ i ϶? , L " #"T@ 2ݦ`@- 2զ '܀ ܴ N܀ @0?`??x  ?L: ,?#\$ ?  @0 f" ?2 :,??K %L  : $ " ''L?`: :, '"@ !%$@0$&@ '@/ݐ Ӑ@/Ր3:@$ @Ι@Δ@/? X = X $$H"@/Ր 2:@/: "b @/? fD#@  f!  @ä!ȁ㿈@Ʒ''`?''  ? J ? ?  &@J `?  JJ|:? ?J:|?  㿘@@㿘1# "@&#"#"c"  㷀 f!c ' "$c   @(aЀ $0yְ ) #`  "S @젒 `` @Z@ $`$`  @aЀ $0I*?쀢`2L"# ?  eaD   `  *:  : ##   J?`\2## ## J?`\2" " :,@ $LJ  : \2$@"%@ '^?<Ԩ @쀥 ݢ@ @I젒 ` ` @@4 $*? a@X'@- #\?1    #  @h!㿘 = ?@.  d 2N? dmS*2Q* N :s "q*А  ?  *`* Б: @  N/7$*`*1* : `2$ #*` € * ? *? *? *? *? * ? :*???*?  2N"@.`d 2  -?@-Ӑ)? dN :  ^ \ N`:`2 *" ?"@-ߐ 2  ?@-?&㿘? = <?@-j d 2L5? d  `"@@- d 2 `#?@-?@ dL : 2*@*@`"@?"@@- 2 `?@-i?&㿘 # 2N@2? 0  `N@ x X `    +`@А *`: ?А *`: ? *`: ?& 㿘N@ :`N@ :2``@.`.`   (8 J2J " $ W`H@$` W`H@$ W`H@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  $ W`H@$9 W`H@㿐 ^!` ^!O"@! ^"@ - #)|a,  ##@@u+ @ +` *`" *" *  ** " a"@ "@    a ^!ė*` *  * ^ ^"!  "a@ *` * 㿀 ^a    ^a* ' "p  ? ^!@A䀢 ?- 2  % ''' % ^,    @ ?2   ;@%  `0ἀ   ^! ^a*  ^ ^"!"a㿘 ^ ^!a  " ^!"@ :`*`  "C  ^ ^"!Ĕ $!#"a?  ^  ^   ^    ^  ^"!" $!  ^ ? ^ $!"a#!  ^`* "a $a! ^a "?!a"@ :`*`  "㿘  @ ^ ^a ! " ^!"@ :`*`  "`4. ` ^,`! ^ a@  ^ ^ ""!  ἠ  $aĕ(  ^"* @ ^"! ^* @"㿘 ^!` ^ ^!qbm `9  * $!  ^ ^a@ "! 2` a ^a   #aa  #a ^!#a㿐@@:'X ' "`?$$  $h W`H@$Q W`H@${ W`H@$  W`H@% W`H@$ W`H@$ W`H@$j W`H@㿘 e'H'L'P'T'X#H@4H㿈`  `@''''$ W`H@$ W`H@$ W`H@ $  W`H@$  W`H@㿘 ( : "b ?6?@ܐ @2 P (    ? 2 0    : @  0f  < :@ f  "  :@ F㿘 㿘@c㿘  w  0?,@N  j  0,㿘 #8@}  #X.   @}@ 0? @ @} @ǐ@~4 @|$Ä W`H@$ W`H@@(#)divrem.m4 8.1 (Berkeley) 6/4/93@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&  @(#)divrem.m4 8.1 (Berkeley) 6/4/93@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" 㿘~ !! 2 J @" $!!J`  "$! `2 1 1 ^- #4 ^#4 ( `  @A `  N@   (  @ @-  P @֐ (-     (-  @ ? @f /  (  @   -  ( L@ < / `L@``/2`/ N@ /*$@  &,@,L@ 2ޢ`  @> @9 2   @ 㿈 ^cT! @ )  @_  "#\;``! @@!`` !㻐 ^ f . Ԑ (c4  '@: , b@4  b@.  ^@u !Ԑ#.   !@Ԓ$ .    4@(@@[ !  @#㿘 ^c@Тc , N  , @@  N   @#   N @ /  "$b W`H@$ W`H@㿘@ǒ$_ W`H@$ W`H@ 0? (?#$ W`H@$ W`H@$ W`H@$ W`H@PR@R@R@R@R@R@R@R@R@R@R@R@R@R@PR@R@R@R@R@R@R@PR@R@PPPPR@PPI @ Jg" 8o-"H XJ+"FG* ?`C*  u2?*  !00  `  `+ *`+ *`` *``*`*`"   *"* 2 㿐L [?'@`  -2  @V @% 8 E L? ` eaD   ` 8  @  0(L*  ` 2 А L   @% 0 2 0 -3  =@/@%  L g  o a *`:  u*` : -)$8 :  + - =ڐ`=*` =  ?* : ` u *` €$ ?" ?"" II -@%t &`0 ? ?@ -3 =`@ =` ="  +` -@%O ݐ& ? ?@ -3  X@r  -@%7 Ő& ? ?@ -L3 @Z=`G =` =!``=` ="  -@% & ? ?@ -=`3 @5`" -@$  &`# @$ǐ ? ?@ -3  X@AL  ,**` .@U`g"*`o`= -`X`+`-0?0<`u07*2 -2   +* )2  &2 *2 <c* 2  * 2 +-  =  *   - +  X2`2 `: J@+-X2@   `J@-+`8  X`8  `( 2 **   2 **  "J@2 ** ʐ $ W`H@$ W`H@$ W`H@ @(*`  *02 @㿘@@ @ސ @㿘b܀   @ %= %bܐ@|1 Ȁ @`  ebb`? "`@1 @  "@ ဢ0!DL?   ` 2 *:  "Π #"ˠa"a  @*ؠ$`L $`$`@$`L $`@!"` "`L Lآ % e c@h/   L D `@ `  ` ` ?$` c@h   L D `@ `  ` `  $` c@g   L D `@ `  ` `  p$` c@g   L D `@ `  ` `  X$` c@gϔ   L D `@ `  ` `  @$` c@g   L D `@ `  ` `  ($` cȐ@g   L D `@ `  ` `  $` cА@g  LL  =2 L@n$`@%L E L؀ #" L #2 ! L "  " !& L "& @~3 2,J A"62 J\2 J ""  *@'`# *&*  2 ** J "   "   J "  "  " 0 Jŀ"*㿘@} =   㿘1"܀    #@|Fc耠&"@ @|n 㿘1"܀  @8&"ܰ@  J " 㿘@%   0@ 1 `@@?` $@@!$`@!0 @l :㿘@t㿘@ @` "&@㿘@ 㽈 f!Ԯ'  耢  :<  : "b  b ?@!y @$#"`H  `X@fi   H        c@! @@!z0%@(  $@䀤c```9  @![@!Yw $@c&  5"   ` , %   `$@@$ '@O , %` @ @ "$  2``2$`@ 퀤@!   8 @ ʑ*  2 & $& @ &  & @   & && & @U& !  @ `㿘  `@ `= 䫒3%``@$@#6 $"    ,*  @$@ ֘ Т06`q`j`(qc6`-    4  $  &  4  -% %    4      4  ``&$6? "" ? **㮒-`)@` @$$@`6? ""  ? ** @3 π@0,)$` $$$`6"? "" " ? ** @ @ @-` `@@$$@ $6"? """ ? ** =%``@$@#6 $"    ,*  @$@ ֘ Т0aԐ$@$ @  $`%`$@ 2`? ""#@  ? **#@@8``% 2`? ""  ? **@  Ėݒ%㿘@Y   *`    #" # # #?㿘`*`"@@  2 "  @  " : @  & &   @6@  2 @B$@㿘  @&   22 &   2   2    @  &   @ 2   "   & @ `"   2   2  㿘  -    @t X #:"$b   b  @d ]b   @h @V b "&& 㿐 @ ئ _ L [@y Q " J``MJ  1 `M* `k`G `K`( #! ! `m`g ! !   !  % $  $!!@Y"% @ !@P V ! !8@D`Т""! X#h@  &&  &&@#h$8 W`H@$v W`H@$d W`H@$ W`H@$+ W`H@?ch?#ض  @Ҙ ޺ ?@ ?# @!?3?a/?#?  ?# !?#?󀢡?#?  ?# ! ??󀢡 ?#? ?#  ̀??  ? ?# ! ?#?  ?#  ?U#؀Q??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    L # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"  ` @! @2` @   ??  ?# ! ?#?  ?#  ?T#؀P??# #?  ?# !  ?6@! 0?#?  ?c@  ̀@ ?"@ ̀@?#?  ?c@ ! @  @! @ #?    K # #?  ?# !  ?8 @! 2?#?  ?c@  ̀@ ?$ @ ̀@?#?  ?c@ ! @"   @! @2    ?#Ԑ# @  ?`?D '#\   @z2@  :v? "" @ `? , 4 $    "?J 2, ?:#@ :E4&@ @? ?`)` ` % _ J _"@y  2 `?$  ` , `4  ` ,  "J 2L Т` 8@ `?@Ґ0#@SF ӄF @   "  ?b f!Դ' 4 @P 4    i ΐ d?cX  ]oآ   #\   @?@E F ؐ @ 06*` *      @ `( ( @J @5  @    @@2?#\  @U??@ ,`4`$`` @  `J 2,``z0d %`@?`W@ "SL "O @w " L _2  @w 25` $` ``"!  ``  ?#@ " #`   ,`@ ,`,`  ,` 2  ? ,`4`  ,`` @ "L  8?#  @K" @ f@~ f!  @!h㿘 _"?  , @€? 㿘 F ?b㿘`? "`@  "@@ې $ W`H@㿘 ?*` * cN  2! #` @Ȑ  $`@n 2$` 1  x@   @qq  㿘 ?*` * `N  2! #a @  $a@ 2$` 1 !x@ ! @q@  㿘 _`Ԕ  # _a'  # _# Ѐ`@     @  c㿘 _#@    @Ӗ`䀢@#  㿘 _`Ԕ  t# _a'  l#Β㿘  "7: '  b & 㿘 _I#@E    @`䀢@e6#  㿘 _`Ԕ  *# _a'  "#Β㿘  "7: '  b & 㿘1 Ѐ " @rh1 `" @ &    !@r,a& а@ 㿘@ 㿘! _#  "  א#㿘! Ѐ  @#`$ Ѐ`" @ $`㿘! _##X f!Ը'` u c )/ +  耢 l `  @^Đ `% @  耢 # R 1P'`쀣 `̒#\'#`  @_Р@`쀤 $`$`$) ᘘ@ Ȁ @%  耦`"% @ ᘘ@_MȠ@q% 耤  @l ̒@@d', Р@oʒ$ '@r 2L  `? "`@ɐ @  "@ q0 +L :`  \@^ o ! Y%   @^  Q 耦  @G  @ʐ@;  a@^ٚȠ 25 ̒@]@',@;a&@7a&@3a " 耦@t J@  耢@ K&I&@] @a  " @tɒ   % @k @a  &"@t  @a&@a " @t @ҔJ@ 2 耢8 耦 &Ā Ā  c@%& J ,  *"@`    ""@*"@ `" Ā@  '"@  f!  @n!ȁ㿘N  @  " @kG $ _# "#$ @: 㿘 _# " @t3 2   2 㿘 _#` @@`@ 2@$㿘%aX _ "#  (J @2    ? @]"@(  "``J@ @    ?`@D" @` " ` a"` " `""``J@ @    ?`@"" @` " ``J@ @ߐ    ?`@ " @` " ` `J@ @ǐ   ` ?@" @` " a@`$# $"T㿐N@ ' ! J@` :'`J@ `'@!&@!& @!ز [ @srTJ 2 M& @!ز G @s^@J 2{ 9` 9& @!& @|!ز - @p&J 2a #@4\ # @& @b!ز  @pِ J 2G @4D @4 & $?  !& & & $@D!& @@!& !@< _c (&  _#쀢`" 2& T   & T  &   2&   2&  `2&  `!4` _@ 0 _c? @-$ aD İ !L` !L@[ !D&!D!D   t IaH . @7 "  !!#\%#` !LaH@\P@uaH  $aH &!D@k'$aH$PaXj@ !L  ! !aHP@ J TJ&!DԒ@g̀ @&!D "J @!L   !!@aЖ@И@\ #* _c  @Ȥ!L   !!@Ecc@[c@&!D  $c䀢 "R@NaX@Z@'aX*@!p! ;`! 8 2`/8"8@@  ''@Ȑ L !! J + -J  @!    "aD "aD@0"D@h  _"c'! J  @@԰ ̀` J@ I @ @E< P f! b  1'' '/РА"@ٔ 1!4 '' Ȕ  !4    a  @q"㿈ű% _#? )` )`2#$!L` !L@Z# !L$% !L a@"耢 2 $@#  $% $% $ X f!a4 ' @ ;   "!8?57 _! J`+`-"J ! #aLaL @Y֐ 8! J   @Y!H!!H @$!H~aL   !!@!Y!H`@ $H2! @ Ē@Д @`?8 "J M!L  ! !@!H@Zh!P 1H "$H@$H`@ $H! L &'  ! !@!H@ZA!P  H "P$H@`L$HH!aP@!XaP!X,֐! <`! $`05` `@@& Ģ ` J@  @Q @! ؐ ! @p+ ! < a4 @&a4J&耥`T8 %88 8 2/А В@i  ''@Ȁ !< a4 @&a4Ӱ %& 1/@ `  В@H`''@АȠ!<` a4 @&a4 !  !  @"(X f!a4 ' @{ = ,   8@h "a8? 57 _! J`+`-!  #aLaL @Xz 8y! J   @Y!H!!H @y$!H"aL   "@"X@!Y!H`@` $H2! @< Ē@t @?8 "J !L  ! !@m!H@Y !P 1H "$H@+$H`@$ $H! L '  ! !@F!H@X!P  H "O$H@K$HH!aP@`!XaP!X,z! ;`! %`04J ` `@@ɐ Ģ ` J@  @ @!  { !  `< 4 @%4D&U8 %88 8 2/Ȑ Ȓ@  ''@Ѐ !< 4 @%4x  & 3/ȠȐ'@  ''@zР!<` 4 @%4 !  a  @"h㿘!!H"a<"!8"D@b ?$!H _"# 㿘 㿘!!4"!8@ $!4!!H`"!D@D !$!H _"#㿘 _?""D "x   @nИ 1  &!4! "   @nŘ &!4 1!   b"@  &! 㿐a4  z #1a! @%$a 2 &!! "&!@&!$aa !"! % * .`  a "  * .`  a@7  a@1  a@+ a "   * .`  a "  * .`  a "  * .`  a " * .`  a0@  $@@@   $@ 㿘@V 2  b@ & & @K P & b@ 㿘  @2 *@&  2 &  @a &b@  * "  & 㿘`  @ .`@ @F` @*@@@>㿘  @: ,`@@m6 2 `@* 㿘L@  @ e!D `?  ` 2`L@  e`L@  @ e!D  J`@ ?  ` 퀢  L   e!D `?  ` 2 L   L   `L"&  ``&@  b@F @C@* & 㿘@w  2 b@0 `$ ,|  ,v   )p    "@ @@ 㿀'X . @ @?,@?@`X''  ? 0@[@c[耢 & b@ސ & @#@L 2"  31 0  0##(#8@i@V䀢   㿘J`"e # J #^ " e D@  ` 2J 2  &J 2L ( eN &@ϐcH4?2  &J` !D@  ` "J "L"@  &@ b@Y @V@  * 2 㿈  @  #h@03;. 1 *'5 `v  ? @ 0 "` &Ē㿘  ` `@kx  `  @kl     @k`   㿈  @ L #h@"X ВÖ 1 L ' 耢 " ?:( @ ! 01 "@   "@   @ @   Ð@  0@  㿘@    b@p  N  "耦` N@  " @㿘 #  #`  #@v㿐` @" @ې"@   㿘ږ   Ӗ  ɖ   ” $ @7 "NN? ,2 N`@h㨀  @ [  @Q  逦@ Q 㿘 ` ! ``$ %  $`@ =    " @ 6   @ /@ - ` $ X  @$X㿐 ` `'!!X   #   @j $!X!X   cȐ  1 @R0@ @`  b@y . ` $  `  "@" " 㿐!!X'  ' #   @j_ $!X!X  @R cȐ 6 1 @R `@ `  `  3`  2  2 @` )& 㿘'L'P'T'X@L㿘 #:b! e"  c@#` @C# c@#@VĐ #@c@ݐ㿘'H'L'P'T'X@H㿘 #:b! e"  c@j#  @# c@`#@V #@Yc㿘'H'L'P'T'X@H㿘 #"! e `@D# @# #@:`X  N "q @1 @ `"j N@ "f @& @('_ &'@&@SĀ  cT !8 Ė ?''?'?'' ` #\ `   ؟#0     `@U`PĐ?"`h@bఒ !c0`@ }& & @5*@`@ n'@ ' @&@@*@c0@` @Tā㿘@_ @_’` 㿘 3 㿘&@&&  @*&"*? &&  㿘 ` ``!" 'D@e = ?$@m 5 `1 7 ` `"  " &N@ :!P& ? ` @N 2 @C܀ a-` `! `!`" N@ : !pϔ  ` "!"!N@ ? :"` :0^ ?` : "" :D*``"%ᘐ `:`:"`5` `!`" N@ : !(  ` "!"!ᘰ ??%N@Ā`: ᘰ??% `!`  `N@ : !r `"!  ?2'@ `2   "@㿘a! `!?  @S!Ȁ@ $!! *`:  + -"`*`:  + - ` `!`): %"$":`""' `? ` `"a"" J`!%" ` a  $! `!a!"@ " $ `!$?%!$a-?*@$J -  J 0 `@d - * `  ` $ * @  %b$`# `a?! `! !?a$!"@ " $a $!  `a?2"aJ` $`$J` - J ! ` !  $᠀ $!M!!" "@$?%!$!)* @᠀ "%JJ`-`"J`-   $᠀`:@dC 2 E?  $J  :$᠒@d*  -\J` ` $ `!`  `N : !E `"!r ?6 W25`J` ;1`J`! $ `! ` $N : !! W `"!N`:L ?J :* @$᠒  `$<`J@ : J`3 0$%bJ "J`"%b : $ `! ` $N : ! `"!N`:  ?  :* @%b  `$$㿘  h 㿘^ 㿘T 㿘:bĢ @@1 b bĀ @㿘! `"0   !@aϒa$"0@a:bĐ"bā㿘! `"0 ":@vc$"0:""ā㿐 `b0     !@aa耢 $00@aU w J?` 2'#0!!`@, L@ #@c # 2,   "d@ca 0, L "  " @c  ,@`@c"0J 0#0!p!d"`"``!L  *`:    $@bҒ " $,  "$L  $!d$I W`H@$y W`H@㿘 @j : "b ?㿈'HN@ r'D w:HJ` : "b n @ ' g x耢 @ְ 0]?` H$  `"x6Ԯ  b@Ԩ 2M  Ԑ %   @Ԑ"?  J H 2* #2HJ㿘ז $% W`H@" ( 㿘.`2v_& $ W`H@ظلبللللللللل(لللDللل للللل`لxلللللللللللللللل8للللللللTلpx #"! 'ؠ"@e bT''@_ ''@['@W''ؔ   @C"b0x", bڐ #"4` #"'@: bT'ܐ @4'''@0'@,''  㿘@W c ? . 8: "b  @'? "6 ""@ ""L@ " @  㿐%. 6  * #\  .  @?!"@:*. "$$"  H f: ' f#d ` @" ) a-1 #w- ? j ,   2a @{P# :"ȀTOLđ* : `>> H*` € H* <% H H2 8% H5"", 1"b,.""< *"b<'""8 #"b8 ""H "bH""4 "b4""@ "b@ %D  %D!", #0 $",$",L  D  "bH#\   @7??"b ʐ#P@h c 2 "? H"b("" &" % H H *` @=% H"bP&b   @#p㿘#?b   * `""` "@""" 6 Ő 4 b" * "   "@  ""  `"H`. @ Ѐ` bP "bP@㿘? (    )?:   :  ",    2 2 *   *,`  @    6 6   : 6 * 2 2@6 6 & @” 6 @W@TM 2@*6 6 6 6 &  4 `   ?2 * #@ `" 6   2*  (   # `  +@ 2*` +@*#  $@ ?6 6 `b " * "@"&""7 " `  "   `* @ " *` 6 ""@&bH#: *   ,    @1 㿘"`"0`@: "b    ",` 2 J#"D` @ 㿘"0`@"`2 j#"4` "  b#"  [#"*   ?@ N `@ !`@  "8`A@??@;,"H 1  * ?@ + 0?,@2 2 *`  2  P b8* 2 @2 @ "H`$@@   h 0M   ` @{0@v@㿘 "` #0"0`"6 #  #0"  #0"+   @ 0  *@?.  2  00t2 *  2@  `   P0e"H` , @ Е,@  *@$@    `4  "* @" 2  @"@ "@   :@ @" @ "@  * @$'"@$@@@2@"@  b2 " "* " `2  @”  VT㿘  "bT! f#d #@bX  $bX  bX$bX#d  @TjbX$bX#d @"@`  ː ؁㿘  "bT! f#d #@bX  $bX Ԑ bX$bX#d @p,bX$bX#d @e㿘  "bT f#d`@UbX   "bX  "X$"Xcd   @Dp ;"X$"Xcd @1"@`  d ؁㿘  z 0ʀ t h0? m 0.` " `* @ #3`   b" b@  "H`+  @"<` bP  $bPbP" " " b`b" "A&b ` :`@ 2@`@ bP"`" &` "@0$bP` @`&` @`%&``2"@  &` &` &@" 2@`&`&`   bP" "&@$bPɐ @ 2# a``H@+!` "L@'@X "L@!`H`&`@&` @. ` "2  &@  $"L@ b+ "    b $OpenBSD: brk.S,v 1.4 2003/06/02 20:18:32 millert Exp $ a`P@4   : aW`H@ `T$OpenBSD: sbrk.S,v 1.4 2003/06/02 20:18:32 millert Exp $ aT   : W`H@"T㿘'L'P'T'X@L㿘 a`@%㿘 a@㿘 a@ǐ 㿘 a@ɒ`㿘'P'T'X@Ph f!'P'< a @   a ##0 #ߖ#` : :" #` a @@S>̠ X@w((  (6'$@@>̖ `@ & 6$` 2` 2` #"&`` p@w & 6$` "`m x@w & 6$`   :,  , *` ?$- + :  %`%N m`% @ @I!@wnpa@wg6$@`N % `` `. . $. *` ȑ: .P@ & 6` $'@ $a '''' _ `  `` @@[@@   7@A@K@͐ @@  7 `  ! o  >@Xؐ $ $a ''''А @ f@x f!  @-!㿘?"& ?&&   f!Ԣ'2   ( ?3&  ?-a  )  ? j ?/??????????? /a7@U% h j? && a  @֐!Ё㿘 2&& "&   &㿘?&& &  `"`x888888888888888888888888888888888888888888888888888888888888888|P4DDd888@8P88D\888888@8D@8`88<ht㿐@'l `@ b @ ߠ' ̐#`  `@ɰ`  `@ږ  ` `@Ζ` '# "  `@`  `@` `@`  "  `@~` `@v`  `@m  @f`  " "Ē@Y P  L @ `@bI`@'`'` '`'`'`'`'` '`$'`('@>'ؠ  @t@V$ #  @K` `?f" `@% ` "  `@R > ``'l` $2mb d 2 n\! 2mn!mR d  !nL! !m!n? D$?@ $@?& Ζ 4` -`` -` 5-`:  V g  `2   ' d `a@ !``` " ޒ   ْ  `@` `@w nb b ''` '@hf' '` dΐ'l `@jQ` 'la@aH`( @r@` D`  bc4 @ @c9` 5`$`6  ! ! @Qp <m <* , ,  < a@#  b̔  . L    @Đ!(㿀# faԠ' @s^@ a  @!0@ `@  (*@  㿐 !АÒ"@'̑"@* "@*`@*`'ݒ  8`#`? "77''''@t9*@   L $ 8X\    ` ? d@  ` e ax@pc#:b : "h"`@$`X  `2@Iw *` V`6  a!L$$$`  $`  ?$` $`$``8$`$`\$`T$` $`(@rQ$`$ '''''`X@H @G +``<`€$`P 6$` '     ':" : b"b"@H  b~ly$`@F$@ $`  㿈`'' #\bp f!'D  ' ('H\'L'P'T'X?'`@'' $' ('$ 4 * P P@ `` @ '' 8& 8`€ P X3€H D@ € PL€ 2  N & , ` €''  X   :" & 03 & , 耢 :쀢 F:""X'L7:'< T'@'P'D ~?/ b@!b?' 2`* `*  $ Ԑ   ?% X `  '  '?'耢 '쀢 ސ & ,  M~l "@' "`'@?@'@'@?'耢 '쀢&  & ,r  ':  \'i  " #"& 0& ,Q (u X `@ 2o @F 0@E .@Fe , , D< `€ @  & ,& 0@  %@E} D@  @  ܔ' @E''& ," ,6 , f!  @E! ,"@0"`4"`㿘  " 8 8@% ("$"($"(""" "  "" """   㿘   " < < `@ 8ڐؐ,,,,,,Н㿐N !:'$" @Tה " `   J   8  ????' $ $ $ $ $ $ $ `?"V  2z? 2v? 2r? 2n??h? "   "]?$$  $ $ $ $ $ $$ ! ",`", 2`"    "/? ꀢ    2/' ' ' ' ' ' ' '   $ @’ $$ $ $ $ $ $ $  '  ' ,' ' ' ' ' ,`n'$$ $ $ $ $ $ $  U"   O2N @ "   D`2A @ "   7`24  2 $   2  2$   2$ @`@` `" `` `   n2m? ,g? V,$$ $ $ $ $ $ $  =  5 22  @ "   (`2$   2 2$   2$ @+`` `` `     2 `?&   "&@.&㿐;c8 b " @  u  @*?  c@MC @M O  c@M4  aʷ!d`* J@ %J@ f" y b  2 @ @@  `J@ ဢ fʌd`@R `  & :"̀` "ؓ*` €???`@.x& '   :" `1 q@ 2) @f  "$  " ``@א  $  @А $  ?@  & @-` f!Ԥ'&'ܦ@ܒ G @. @ @. 0@`,?@ $#?@  @r   ` ` ܰ &܀ !@-!  @#㿐@ 2E @  2 > @O{ %   .@Hʐ $'?#?,@t   2 @?&`2㿘   @H&` ? 㿘`V &  $  $ $  $  $   $ `$  @$ `  *`@$  $ *  ` `@0 㿘@ 㿘`"L    2F         :?8?6?t  "/?@,?c %?     # "! a!l@L!l`؀`2     2  2     ؀     㿐N (?`@? ?@?@  ?@OL & !:$" @P &"  ? J  ??c( f!? 'D#"  ? 'L'? Ⱥ?  ? `  ``D 2 D?Dc @`#@??Dc# ` : |"b?D@%#@ `@  : e"b̀`@``?@  : T"b̶'L? " *?#@ $??c?@@#@D @% D  "?@@'_* 2 `@'Z* `4 @'U* 2 ` @ ```4@`(`?c@D@@%$ `@耢 " @5@ 4 @JH @```@耢 (@@ @@ LcXH %o@``@8   c( %6]@`` 2W@`` 2Q@`??ؐ @6 ?# `!?#` ?#?c "6@?c@@`2?@ ?###### `     ' ''' ?' c' ?''   '?ca ?@*# є & @          2  @m ?c@@`?c@#@   ?#@??c@@` ?#L?#~?#:"̐ :#"̰  fa  @#8  ??????????''@  :@ 2 `:?"bT     0! 0@ '''''''' '@''' @?''Ȑ@x % Ā   $ `     2$ 㿘! a!h   #@Jc$!h@J㿘! a!h @_4$!h?ch f! aah ' ?  #@Jxc '!h c@) ?#!h@H v M # c@K   ,@KcȠ ?,  L  *`:     "@KՒȠ , @6ؐ  ? ?L  ?`#`#` #`#`#`#`#'''' ' #' #' '   F ? #@$@`K ?  2@?#a  @#Ёx  ????<  $ ` ` H  8P  ? ???)  @KJ `*@ #@KJ 2*@`^\ `J@*:    `"  @K1#Ȓ " `*@``"`J@  @` `'` '`'`'`'` ''' 2' @&@`  2@   $` ` P"`  "`?`??? @6 Z "\`"\ ` $b\ .' @C"` c@6 !' ` @'` '`'`'`'`b\?E'   $ ` ` @"`b\@6 2b\)   $ `` 㿈;c8 b" ĝ @ 2`:?"bn?   @$;`:T""̀`;?#`)@ $`` ` ` #\#`@ #d  `@@  4@   2   2   &`@`2`"- €:  : : : "bS ? :"bL0I㿘;c8 b "  `   @#::"":: " "bN    J .Jd?`2J J .`? 2 d@  "dAd2  ? @^ 4Y̴   2 D 6`5"1D +D@@ 4; =4̀ "   " `2 ``  2`""`  `" ?@ ?` $ ? $̰?㻈 f!Ԧ;c8' b  s" 耊` @#`:""2?`@$  ?N .2@EƔ @@ $ : "b ?@g$  @g 㻐 f!Ԫ\' "?2?   @    @  *`@ а? @" ɰ?  7`4`  a!l.``2   P  X@E !l " @7 @EQ .` `2"@f@% s@E?   0: < @ 8 22``2`*`        ?#@2` 2`  2`   `? ? `MK``2H? 2@29" =?@ɐ ! ah!l@c!l``@@ (@ ?@D̔ "?  @   aԔ@1 ? a  @o h㼐 f!Ԡ' @1" (?@t`@@D `@!   ? @ %@.*`   @/ x㿘 ? ?  ? ?    @D+ " @.  `@e  ?㿘*`$ #   А :``@G{ 2  .2 N .2 *`  ` f!;c8' b " '''Ā  "#  f  ?  c 0 '̀' : !`1@#@ ͒b@Ԁ `:  @Բ @'Դ %"##b"""b # @ * <2 @ * 52 @ * .2 s 2r3 0   ,@$ ͖‟ Ԥ%@^ Բ @'@X!`1 #@ @  @CnԐ@'%'$@|$ &Ī` "`@2!1"  @ 4` @CGԐ@'' @ @@ `Ȗ %R :`07`0@1Ā  Ԓ` %7!`1@/#@ &t`Ԁ  m` %  ,%?]`@Բ @U'㐠@1PԀ   㐒`Ԑ %J @2 @  ؀` ܀  ?#@  Ԑ @%Ԑ @'!  " `1 '`#@ Ȑ  'x'@ @Ԥ'Ժ``" ̒ '̀`!`1@#@ ͒b@Ԁ 2  4 %'@ d  b@(㐀 @? ! 1" @   @BUԐ@%'@!`1 @ْ:"":"b̰  f  @}!㿘;c8 b "   2  @`?2 @h 0@ @   @ 0@ 㿈;c8 b "    `@9?`@A&`:?     : /""  #" " @E0 . 2N@j 2 N?  eaD   ` I-N? ."DN! 4@#ݔ D!  0@A!$"b& b"& " $!@' @/:""J?  eaD   `  .2 NJ ?J .!N?  eaD   `D: "b  @D : 2NN :2HN $N? .@! 4@#x !  0!@AM!$""'#& "##& :"l#`J?  eaD   `D 2 + :  : . J 逢?J .!! @) O   a@A   9 L f"( y b %2#`2 @En@  @@ Ԗ萐@'`2L ̀ fx f!;c8' b "P    @? @!`? ?@ ?@: "b )`&    ?#@"          : /  :ꀦ耦'!    #\  @aĒ$: :?" "  1  2%@!@@a  ! @~J O   a@@1   r ;7!M f"^ y b \2Z2W@R H@@%@@ G  @0@ ` !X%@@?  @@  ܖ 疐$璐& & @}44'b" "  @ @O  & & :""̒@1 2 fM  f f  @{y!`㿘! a!   !p@Ala$!@A a"!㿘! a!  a!`@U $!㿐;c8 b  " a!` +:  !p@AAa $ ?@@  %b J?` 2'#!  0@{, N #ߐ@B # 2,  @Ba ! , @!e4   @!^`4  @`4@ '  ' c   `4"""""" "LL "  " #"`&# @Bbሠ "&$@,  "!$@L  `*`:    @$@`@BHሠ " $@,  "$@L  $@ @0$'#@h%b̰#㿘;c8 b  T" @@   @ 㿘 0 @-      @- 2 㿘#" "      @-Z 㿘cc  " " " #c  h " /􀤀a  @Aa Z ,%@Đ L   L "  " a@A  cL " , c  %c@C   ,@$@`ð $cL    ,*`:    @$@`@Am  c,  cL  c c$@% p fa ##'`  @, 2 *    #\ @_I #b b$b@| a@-P܀ Lb : "b!  @y~!㿐@|   #` #@,A ! !" "I@|x$" aȔ@- `" : "b́㿐@{  .@?` .@`.@`@{ 㿘  % !   & &   @ && @ $&@@$@ `&@ 2@㿘P;c8 b  Ô" 5 ahal ad @,`@ah @al   `@   2`  0* P@ &ђ ?  +`+`@RR@ 22""蚄?UUUUtUU㻀 f!Ԥ;c8' b  W" ?& ` @:G""̐$#d#` #\  @Қ   @$@d : )"b̐@ 6: "b̒ ` 2Ԁ`Ր *` €:  : : : "b̰?  @x3!؁㿘;c8 b "     @::"":: " "bN    J .Jd?`2J J .`? 2d@Đ Und2  ? @d 4_̮   2 D 9`8"4D .D@C 4>b =7̀ "   " `2 ``  2`""`  `" ?@ ?` $ ? $̰?㷀 f!Ԥ;c8' b  :" 耊` @`:""(?` @zz?"N .2h@y ,@ #\($@\$  @w8!㻈 f!Ԩ;c8' b  " @2x  @Z"l 2p l @=b f@ ZJ?` '#O@wu, L@  @? eaD   ` "`;,@@) 0 e!D`L@?   ` 2`L@ "`1!J ? eaD   ` "*$@: H@Q_  H@*` a ?$@` 'F'$]?2[?$Ԑ@ ̰.2 @u.2  @o  ?4` <$` @ @Y  @U @U  @M 4`  $` @.` ,` @A2 .`@=2 `@> /`2 @6```@xW4`&㿘;c8 b "Ė & @)?  )@.@?# .@ 2  . .`@   @ @ `   &6` 㿘.`  .2 .   ,,`6 2 n[6 , 4 nS6` ,`6 㿘@Z%?'")!$` #c4  ""2R@Z2`P`$` " @Z2`T$`  2 !" 4 X! "2`V 5"3 a-"7"1 a4 X X y*  `@Z#$`oc4 $``  "0 ,,`2   , ]4*  2` , 2  m` ,2`x 6Z 6bHgd"J @d ` ? &\6"J㿘!" g d abH!/ " d \ !"t!" ` @ZR$ ` `bH 2 @/@ $ `a -""" V`X)` Pɐm!?4 P`"bH" TPZ@ 5bH"`R aJ . 6 ojoopThjhopT a  a 㿘;c8 b " :b b$h  ,` ` ,`㿘;c8 b "p   6 M I ?#̐ @ @2  @2      ' @  ""   0?#   @ @2 `"  @2  㻈 f!Ԕ' %@$ $@@Q* `4 @L* 2  ` @&ϒ "   !  @t"8?㻈 f  !Ԁ '% #? @\$ @@* `4 @ * 2  ` !  @s"PX f!;c8' b'D'H " D'   @>?:?  'H"$  '  <''Ā@ '   ސ' @  `   @? ` *@ a"`"  ܤDH⠒`ؐ#$*` €   )4?   a" `'  % a a"` @ %J" @ܒ   i$ $": *b 1:&" [  a *"  "bJ@\HD ''''"  H` : *b  7ֲ"{ְ  ֲ@"@*` 7ր :@" 6(Ā`% @'k @* 2 'آ 77@"7ր"L ր `:" @c; "b* &7֑* 2 """, ֒"@*` 7 @  "` a % a☀   @ " ☀ @'ܒ   $ $": *Ab  a"" $ 1 a  `" 1 a"  D"܀ # &"D "@ HH"   /'7" :&""b D "HH " *u@* `' ' 4' ''"  @}2  ^" 2 *@ +  &@   v  :" `"0D! @'':"b " OЀ 2' '@" $ (X " (2 DH "    2   *@j@!` "@    " @['@  `a a@L a"`  DbܚH`,ؐ#*` €   )4"? Dج `@'@  :Ȁ`: ="b  <"b "" ? f!  @q"h㿘! a"  m_? a a a$"""""✁㿘 Қ 㿘 @? @$㿐 R?@p `0`  `@@"$`0. $`0T` $` $`&` 3\@n `  ?ٶ`2  `C  $`4` $`$`$@2(" $`4` $@ $` "$` $`$`K@z#@yzxzxzxzxzxzyzyyy(zy4zy@zzzzzzzzzzzyLzyXzzydypzzzzzzzzzy|zzzyzyzzzzzzzyyyzzzzzzzyzyzzzzzzzyzzzzzzzyzzzzyzz zz$z0zzzz<zzHzzTzz`zzlzzxzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz{4{@{L{{X{d{p{|{{{{{{{{{L<<L,LLL<pL|  d|<0<<<<< <<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<@@||||HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH㿘`ܐ"*` €1 "1 "1 "1 "1 "1 ~"1 {"1 x"1 u"1 r"1 o"1 l"1 i"1 f"1 c"1 `#1 ]#1 Z#1 W#1 T# 1 Q#(1 N"x1 K#01 H#81 E#@1 B#H1 ?#P1 <#`1 9#p1 6#x1 3#1 0#1 -#1 *#1 '#1 $#1 !#1 #1 #1 #1 #1 #1 #1   1   1"  p @T  p㿘`+ݐ!(*` €1 * (1 ' 01 $ 81 ! @1  H1  P1  X1  `1  h1  p1   x1   1"   @TT  㿘;c8 b "f !`C    ! \`@Q !`  @c @  @* 2  &!`  !`?` '`@ * '@ @ 㿘 e@cH㿘 `@Qc  ;#8#  " @>@QS`2 `?`&`@ * &@@f 㻀 f!Զ;c8' b "  2`@?i`  ( ``" ` `2`  b b" `<"H+`   `@Q`& * & @$` ("`?`&@ ; ;* &@ ` ""@` `@Pߐ2`` `@Pא$ `@PА" `@Pɐ! a@P  a@P @ a@P  a @P  a(@P` !"`  a0@P !?# a@ @P  aP@P   a`@P` +" ?`& * & @  t@`  "? ap@Pf? g@- + ) `  @@PW@8 `   @ @ $ @ `u@n `  " `@-* @2 @P*a`@8[ `   @* @2 @P!` ` "? ?`&* & @&?<`@0  !?c#\  1 '@  !#\ @# @  !#\       @Oʒa @OĒb  @l"㿘w"㻈 faԐ' @ $ O ?`&@ .* &@  .@a  @lj"(㿘ǔ"㿘@  & @om J?`."   '  @0}b8㻈 f!Ԡ' ֘$  @sa  @l%"@?c f!Զ;c8' b "ږ    @ :""   $ @A@ *  2 @ *  2 @  @ !`*  2 `d"!` bP@N!`   ! @ɐ! @N"X@"X@Nߐ`e1ݐ!l*` €``2-%? @m   '@ ߒ"X2'@  @ *  2 b` ` @N?`&@   "x@ƒ9 6:5% @3  \?`&@ \* &@ ?` &@  * & @ `*?`&@ " "* &@ nM H bx@p6:5% @2  \?`&@ \* &@ H?` &@  * & @ 3`*?`&@x "q " 2W @&" b@MM?`&@  * &@  L ?`&@  * &@ o  @"@   @Mb@ @  @Mb@ @  @Mb@ @  c@M@ @۰  c @M@ * 2  c8@M~u @ v* 2  c8@Mt   ?`X&@6UX  "x@9 6:5% @1ǐ  \?`&@ \* &@ a?` &@  * & @ L`*?`&@ " "?`&@  * &@ )] "?`&@ "* &@ 9 6:5% @1[  \?`&@ \* &@ ?` &@  * & @ `* "?`&@ "* &@ ɒ ?`&@ * &@  ? @ߒ"X?  .@ Ւ"X?` @ ̒"X@ m * @ h4 * 2   @Ldc@!  @L\#H @LT#H#H @LLC@ D * @ ?4` * @ :4 * 2   cP@L5,?`&@  * &@ Fʔ  ?`&@  * &@ . 2`u ?`&@  * &@ @G 2E@  c`@K;  8!? @k   ' @.֤  ch@Kǐ  * '  ``x@ "@ ?`&@ * &@ Œ,`*?`&@ ) )* &@ ?`&@&  * &@ @ o* 2   @Klc  c@Kf c @K`?aH ✒$@g @+ 1 `?2@KI#L?`&@  * & @ Y`@倌`?yc@ )*  @2 ! @K$   c`@K@  c@K@ "  c@K @ @  @Jc@@  @J@* 2  @Jc ?aH ✒$@ @"+ 1 `?2@Jђ#L?`&@  * & @`@倌`?c@J c@J@f> c@J?`& * & @& c@J   @gp ( 㿘    @ 2 2 &   2 2&㿘   2 2&   21"   @L 2& 㿘   2 2&   21"   @L 2& 㿘   㿘  0 㿘@"K1 "?1 671 O1"81 21 F1" 11 A1"61 .1 (1 41"'1 /1"'1 !1 %1"1 1"1 "# #########      (  Д0@LH ( Ё㿘  1"  `8@*ϔ (  < < < <  " ` (`$  P  X @@L $ 6r" n` , d$  P  X `@K $ 6T" P  ` , C $  P  X p@KҖ $ 63" /` `25 22 2/ `  , `$  P  X @K $ "   " .a*a , , ?,㿘  2     a* 1" d dӐ ! @Kq ! 㿘   a L* ?К  L?  eaD   ` +` .*+` L? eaD   ` +`L Б*L ? *  eaD   ` +`LЖ +` *  *   ```@:`,` 4 * $ 㿘 eD    N(кN /` eDN 2.8 eD  eDN(ЂN (` eDN 2.8 eD v eDN(ЈN ) N.A eN eD 2 eN?Ѕ/ N( ( eD  eNЅ(N(  eD  eN?и eDN  eDN 2(82)݄Ї(/` (. (. ( (/` (( (( (1 &(& (82 ݄( &@ &@&@ eDN " eDN 2#㿈''@g2' @  / /   /逢`  2 쀢 2    J@ - +`'?J@ +4`'4444 4,`J@*`А @ 'J? eaD   ` J@ .2-,``'J`? eaD   ` J@`?', J@ *  eaD   ` ?J  ',`@*`@*`@U&% ebD 'J?   `   4 4 4 'J?  eaD   `  :b.` eaD/'J?   `    e!D'J `  `  :4.`c eaD/'J?   `    e!D'J `  `  :.`5/.`.@.` .`.`.`.`.`.`.`.` .` .` .` .` .`㿘@ H'L &% @Hw0    *` +` @ * @@  @  *` +` @ * @@  @  +` * @ *`@ @ @  / /ސ" ??ڐ!@  N S/ /[0# #[) <' <[" < <  W/  E/[##[  < <[ <ݒ < dZ dՐ"l @#;+ a "ce@#4 "c^@#- "c #`#\#tL#d;h#p;xȖ###@GӐcЀ ccЀccЀ@㿘@e.   L ." `@ &L L * 2?J?`.2 㿀'@1"gl   #\ #`!0#d  @G㿈`B  !(   `2`*3  *2  `? /// ///ꀢ`?/@j??@j@j`?@jT` . . . .Ğ`? ///@ * `@    2`*  2+ 2  //逢`?/@j ?@j|?@@jw !( `. . = . =..?㿘 H !( @(Ԑ e "`   `9N +`3N@R"@* .@*  `I"@@: .@@**`  ` `9"@@: .@@**`   @+"@@ .@` N  eaD   ` `2N= =B N     ; 86? e!D     ` `2N=2"?N  e!D   ` "?N ` @ ?0?㿘?   @`G  .&`)?0C@ @??(@`@.` , \ . \2 (@@:)?(@`(@`<   !`?( `@ &  ? ` (@!㿘@    @ 2`  `B ?@x  ;:,*`" 7*  ?@$@`$@ .񀦠\  ,  $ "? >*@*,2$? $     ? " ?` eD `  ` bX*`P 㿘D`4 ` "' 8?, ., \" Ȑ  < ` "&`."  `?*  @ `Ц &*?J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿘N * N  .   㿘N  % ߀ ] `.`\ " N`  ߀ ] `.`. J߀](J    ( ( (*`  2 *`*@2 2 2 *`*@*`*` bX(P㿘`` &`` 2 @@[ : "b &?@``"  @]Q ? `@?&`*@``&@`  @]: ? f!;c8' b "H :b b $h@  ' ''| & 2 & 2 "&  5 .6. &@^͐d<*@ 'x &d c&  @"&`|#  A%  @B# ;`@"v!N` '&DH" \ "NN` ` `.  $  '| N`` 쀢` NN    2 .$c@$ ' xc@"6 /h't#d@^d , c@% .O S c@  ( O  #c2CN "  " N 5 3`!@! @%Qcа 2.&'|cؐ@i  2@ O  : x@] x  N    L y b f*  , `L y b f *` "`Ӱ c@$  T O  Oc`2N "  " N À `!@!@$ג 2.N` &DH \N  `. " $   N    N   2 .$ '|c@ ˔ 2z O  2t p N "  " N j h J ? eaD   ` "*  ??  ??''#  5@B{' .` 2)``*@]2 !*`@h ` *`@]   *`" " " " ' "@ `@ L   O   ; eN "  " N 퀢 뀢 ;aD `@ `  `2N N`  @#x 2NN`;瀢`N.@ Q/ h"   cx@#ג 0l.  aD `@ `  ` * N``;`퀢*: .@ʒ $@@@{' $@@@u'l"@  *` % @% @^%  @] X / @*` "  ####Ƞ@## ̠###.  aD `@ `  `  N``;`퀢*: & ./ @5 @  ?    4,, *,``  .`@ V   O   `@m@!<t 4& d **` &d@6$N` |@  |@" .  `@!|#`N`  &DH&H  PN  .Nd`2N @"ݒ . $ `$y   & @>  @`0 & f!  @[) 8 㿐;c8 b  "N x#' % *`:   N "  " `H@   ' @" MJK? eaD   ` @ :+ad* < 0$adP@   *X@    ```@   `$`p@ x  ` (`@ n  2N` $`N   2 N  0 ???㿘 @"< 㿘  ` ki 㿈  ?'  @dǚ ?? <dϜ㿐@ ?㿈 e!D, : ?   `  0   N x X    e!D, :  ?   `   ,  ?Г:` ":  ?   `D , :  ?*   `  : . 􀤀E $ =? eaD   ` < $:` `2 *` €?#!耢 * #?#耢 쀢`* *`  耢 쀢`*   *` * `2&@ 㿘   :@  @G /"b ?㿐N  / (   Ȑ@!  " @* @*`@ $2,@  ,@ .2 `,@ N ް   .@.`.`.` 㿀 f!Ԡ' @d N :   N :"Nt L N  `E ?#  ؐ@    @   ",߮ )N`:`.`2H N ΐ ˑ4, ,   6  @2h  ,!N`   8! 4, , `$   ? % **  @Y:  !  @X!㿀@[' ?''@TJ ? * ``"@  b b 4 4`" )'L  ( " a@  @  b)4'L% (( ` (@  @?` f!Ԩ' #v  N : /@ / 2  b8@ 2  N /@Ӓ .   2N "@ ""?N :" N /`?% "P`"?@[B@[? #$@W bh$@$@@ . 2 bF  2?5 ?? TSא 2ٰ?D`A`>`&@;` &`8`$&`5`(@`, 2&` ` 4?` ar4?``24? 2? 2?*@ +`*` `  @? *  $@ $ @&? 6``, & ` `` 6`e @*` Y`` & @` 6` gL֐`& @` E&  @``@& ` @4Y?`  `   #L@ @*`   `#L@*@ 6`!L@&`& @ ` ` gL" "` L@` "` ?` `  gL" "`L@` "`?` ` !  @W"pJJ Ѐ ,-+2  " JЀ   ((+ Ї8   JЀ  & "@ 㿐 ܖ $* "@*`@*`&@N :  ˖ ; *@" * @&@N :   < 2@  &@㿘N -   + ’   @ &@㿘N J M &@`* !?В &@ `   "0 N .  ` w  "$ N . `      &@` !ma 2N  / v` &`㿘 ` N d 2  Nݒ! 2  "  ""   * * "@*`" *{ ;xT!u* * "@*`" *k ?- @ "x*`@ ?* @*`" *" *  N    &@ dd dN,`@*`@*`W  :@``: @.`"@Nh  &`@ ,` +`- @* *`  x  `& +` * "*"@ *` X '@X!'$>?L :ݒĠ 5? " 2&@L 'i$ (!?L  , ;  2L?Đ1'L 2L` "L , ;j  ࠒ "?L , Ȑ "?L 2?Đ     &`&`&gL&gP&g` &gT&gd&gh`eب '9  ĔՐϔ$ $@$@,`$@ ,,`$@ ,` "؀ M d 2  M! . .*@ *`" *" * Ȩ&` 2?  `@e gP* *  ``gL   eؔgP@gL * @*` ` @6  * * ``  @1 eĄgPg\gXgL` * *  `(  `2*" %% #* * ` ``@ۘ Ė   &gL&g`&gd&`&gP&gT &gh  &`&gL &`&gP&gT&` &` ` "8?#L@@ @@  㿘! "0 "0 㿘1c ?"c!" Β!@ !@㿘! b#,#,㿘 @7# #1۞c 1"@ 5@W)!@ $c1"@@!L 2#""@"@) "T"""P"L b0@."0a@ L :a@E a@C㿘! b#,#,㿐"!@``'`  % bgP@ *`` e% b`    * 6 @* , 'L@@@k &  #L@@ 4*" &(㿘! bL#,f F#,㿘 b2`#< ,> " 㿘# b.c01c !* "c %c0 @,` b# 0#h&(㿘 ߔ㿘 b2`#L ,  " 㿘!2ǔ  㿘  ? D+ !L!P +  2.   4  ?*      ?+    @2   @     @??ɑ+ %TaK&@ T T!  ?"  `F.&Ke.? <& <K^&`KY  & &0',!m`&* @*`@*`@ <  d$! <  d $!$$@`Ѧb؀ K d 2  K! ,  , @ , @ "x*`@&&&@`*``*`&$@ @ 6`&$& & 㿘̐@h@ "  2`㿘@ &88@"&@`` ` ` `@ ('P&@ `'H`'L'` '`'`'`'`'` '`$'`('' ' < K?В < C?  <?ܨ 4?'l .?Ԁ )!n' w? "ؤ  ܤ  ؀ JC d 2  J=! ,  , @@ `'Ԁ!n(+ ؤ  ܤ  b؀ J d 2  J! ,  , $@ 'Ԑ2  Ԁ!nݢ' "@ 'Ԁ  ''ؐ   ̰?ؤxܣ*   I d 2  I! ,  , * @Ԁ@ؒȶ 8 ?Ȁ`;8''l'4'?ŀ ?' ;'w''Ƞ 'IH#H@*"!@ ? |,* gPP耢@2-? (, * 'LL@耢@ " L'Hǒ 2?耢@?전?줄Ϩ?C?LH  4? `?' *"@' *@'耢`   @' 2?'LH P"@?㿘   㿐  & `" K && #H@*"!@ ? :-`* PP @2-? (,* @  L`?"@  && `2 "@  " `?&& ޢ쪅Ϩ??㿘! bڐ#, cHҐ#,㿘?" 㿘& ` 㿘& `"@ @L*` 㿘'DDD&㿐'DސDD@'ِD"@@ `'D&@ &􀢀 ?0'D&@ 4􀢀  㿈  #H* @ #@  * #H @ #@   'l P#\ #` #d#h@5"  㿘 b2`0# 3 " ǐ㿘N@ `@RxN    2N@ 2N?2J@ "J`  2J@ ?Ѐ 8?Ʌ(8㿘 `Y @:W% e' c`.I`+G`/E`J D@  `  H*  R  ?D  `D `", Đ  ۰  H*  R  D@  `D "  ,  .@`` ` @ `. 2P 4  6%* . @ 0 07( @ ` 07(*& @*  cH(P㿈 '12#\#P@4' #P㿘   :@  @1 /"b  x f!Ԡ    '#\@3  : "b  @a  @N@"0 f!Ԕ  '????  4 :`*`$*`#@ * * # ?''  ?,` ?'' ' ?@$'''', ?@''? ?'P ?# :/  @ 2: :Z ,2 :Q ,, ,  , , @$ 7 @P@$@3=( #6(   @    @ :,  ",: "b  @!  @Md"0         @ ` "  @ @ @`  @ # 2 @ 㿐 hD  ($ @0( ?"- h"  #  '''Ē '@VQĒ@ F& hFlF"̰ Ȱ     ?   ??//'a'b  @ 2  @ː!8" n #   c @" ^ !8'''' #\@!x DЀ  "   e D#@-laH `€ ?f& h @ `* @7 `/# 2 & H"W S   & L. H. I& P& T ` . J ` . KԔ A. L `. M `. N ` J. O6 X& h@TD c!8'̑2`@:`' ` ? @& \a''b H / \ & ` @8!& h \ c ? @!a8&%a8`2&@   @Iܐ!㿘 ` @?& \& `㿘z 㿘<!8  @  2 ` @`$@$80 8㿘12#l 2#lA!&#l#l㿈 !i ``€@p !@/" ! @L$ 耢`:#*` €@ @.3  8@." @ @,$ @얒  @.H  @.ߔP  @.֔   @.͔x b. @ !0  @. 㿘 e #@,%b   !* 㿘 e #@,bH㿘` :, "`  "`ې  Ԑ @0  @.z!  Ő  0@.o! ,`,`㿘ː e #@+Вb   8* 㿘2@cp`W  R d 2  e b@+#:b : ""` 2@ǖ *` 26 gey  6#$   s &@4     :" : "bb"?O D=K $ $$ $  $   L$  $  :$ @-~' ''''Đ 0 @J @ 2  P  # D `€ P$ H``@"a@ c!L$@$$    h 'H'P\ L 0'L'T  @$ `$ T   @ 2 `   0&@$ $%`  H ``€H " $ € PL€   $  $ $@ے q $@ג  $ $h 2@d   ` %: $ $Y %: ,&@'`'`''@q'耢 F@  $ "'0<Ȁ2' @Y $ $ 2&  T  $ $$ (€   $ ؐ $ $؀  &@@e $"  $  @ 2g&@ $ $"@("`,"`㿘  " L L@` `"  `"  " " "  "  "" " " "  㿘   " PB P `@ L2 $ 4 *  ?@RI xx @RB  9Yp  Xhb@'X'\+: 2`*@ `*  $@   K= b 9; ph"@t'`l"`'d@?` `"@ d'P"`'T@?PP'X '\?`? ?  @& $s)?b " & (@& $f?@"_ђ 2  6 & $& (?b  & $& (㿘#: 6?&b ?$ $$ ( @㿀!3 p 2  < @Q @ 2$ p+  < ':" c"&  ah&  && &  &  & @3 (@1 @. @& <  `@㿘3 p  ` (<   !!d!p!|!!㿘@ϒ  ``@ !㿘@Ĕ 㿘 @` " `    ``€ @`  @`㿘@ " @   @`  @`@{` 㿘@ @m` " ` 2   c` ဒ`@ۘ  㿘 &`&` 2 @f @J` @\`  @W` @R`  *  "@ "@ "@  "@ "@"@ "`"@"`     "@ "@"`"@"`㿘    &@  "&@ @ ڒ@ &`@ "  " 0 " 0 &` &`&` &``" c c" " " "    " " "   "@   "     # d? *(#d d*`  *` *`d#@ #  #"@d 0#d*@  *` *` *` "  #㿘  " $ @D  @$  㿘 @ "@$  @Dٔ  @$    "    @ " "        " "   㿘@㾀 f!Ԫ'`2`!'쀢?2`Y?@O     '`  ': ."b C? '` ' ) .`*  .@ '䰒 +$:  $aA !:  " $&  &$" aԐ@ 쀢 &$"  a  @CĐ#p c o6 a?a!'''#\ab7ڐ J! / c!'!`'''''  #\И#x ڀ  : "b b`  ڀ 2 : "b @܀?"6 ?X6 ځ㿘@/ @*`  @%` @ `  㿘  D  e #@&e`x05@ @$ <@ $ @  $  e #@&Q`x 0 $   2 $   c $ 8a& & $$ $ $ $ ,$ ($ $ $ $ $$ 0$ 4㿐 4 ,0"  @&@4, ", "4@%   &@ 㿘    &  & & @- 2  & @ "㿘   4   8 2 @b 󀦠 8@: & 4"$ 4@㿘!    " 8 @C & @@$  @$ @  2  㿘`   @A  ?@  "  , ?  "  0" &㿘 ?&"   0  "    $  , 4 "  0   ( "@ $ 4$ ,    " 40 @  @  ,0 # , 4㿘   㿘 @ "  8  & 4@ 2 4   4 4 4 8 " 4& 8 㿘 @ "  8  & 4@ 2 4  4 4 4 8 " 4 0 , `?㿘`       * "@   # ? " `""㿘 ` " @? ?"   "     `$ $ 㿘 0 (  $ "  ?" & ,& 0 㿘$  0 ,     4@A ,&@& ,@㿐    2 & 8& 4  㿘`$  0 ,  @ ` 4 & ,&@  c(/  ?p f!ԠФ' ":N " :@DE'$  ` ''ܠ:b @5@D7$$     $:$$    @A  㿘3  |9  0?,u  9  0,㿘  @  c#$ .  !  @6@ #:?  @)@ Đ@X : "b #:b @$b 㿘? : "b  ?"   㿘? : =  @ @7   @.@08/`(@ @ @?@4@08/`(@р 6`6`@؆@67P67P7P7P7P7P7P7P7P7P7P7P7P7P7P7P7P7P7P7P7P77P7P7P7P7P7P7P7P77P7P7P7P7P7P7P7㻐 f!Ԧ' "?N @ / @w^m 2   @#ڐ! 2  ! @#Ґ!@  !HJ B  ?* : `(3 !*` € J@  4 @ 1 *`J@ ) @ **% J@   @  *`J@  @ **    * * L  :`%*@?2 L 2 L ?  @?!P0_ ?,ݒ ;x$?#\   @J ;l?2???#@ /  && ̐H?㿘 `"@ J@ "@ 2N@@Bt  @ *@`N &*@㿘@& " @  2  @’`@`㿘@  `@   㿘@㿘@B. Ő @?0 㿐1  ?&㿘@  @` @(` 㿘@c @㿘@\ @㿘@/  @"` @`  㿘`@ܖ$㿘@ @` 㿘`@Ɩ$㿘@㿀 ' 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿘`"   `  0  `@€ 㿘`"   `  0  `@€ 㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 @ €'@€  &@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐`"  ` 0 V@ €'@€  6@  㿐`"  ` 0 @ €'@€  6@  㿐N@'Ȓ  .@ 㿐@'ڒ  .@ 㿐 "    0@  @ '€@€    @ &@  㿘Ȓ㿘$ "      3  `2      2    c c`?㿘@l "2  2+ "   0"   z&@   e #@ӒcX    &@㿘`–$㿘 "   @ "  2    €㿐 @   "7 @?' -8+ `  ` 0!  2 &@   e #@fcx ,1,&@  㿘?FDF<FLF4FLF,F$FF FF  (             㿘<b@ @@  b@ `b@ @ b@ @㿐@c   3: `" ` 2`22  @ @&b    (+  2 2 " 2+J " ?㿘`6 "@"&&@< +, @ @8e @2P  @ ? 2 ?  : @ 0d < :@  d  " : @ DE      "b 2 @6 h €dL @2 T &  2  <   (4 ؐ$$L4 2T  Ȫ@B 2#0 @" P  @ ? : @ 0d "< :@ d0 " :@ D8<" @d  "@@d   @2'L4$L@@@D 4%@2L@%@&0$  $@"$0 $0  ?T4 L  :  @ @?2"$0` $@@"$0 $0 @ ?04 @8  @ "@$"$@7] ?@?20?0`@@"$0q $0 $ ?4 $ 㿘 ;   J   J H ? 2H  J  㿘 e!D @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0   ) #0z $ $   e!D  /:) "J" &? ? % g"  #?%  g  @`?   ` `?Π?   ` `?   ` `??`&@ 㿐@$    "  2 @ 2  @y : "b x   ?''D'''  ܘ @AϚ      #ܮ  ܘ @A ܚq  h   2c  ^ T`  T ` ?@` ` L`D/ 2 ` @@B>  : `   * @"   ?     + "    ? 2@`2@@+ * @ ,`D "͐0ɐ"*  ? @B:ܢ @    2  1 2  ) T %` %` @7) \ . %`  T@7 T   ?@`` ?%` @7 D`%@ h`Df / 2 ` @?"Y  T`` %`` %`%`  *  @"   ?    .  @"'   ? "%` "%`" %`  @A@@6@Ց.%@ܨ *a 䀥@ D%@"" 㿘J@   J@J`  㿘 e!D @?`  ` `2 @ - +L@  L@` 0 L@ x XL` ` 0  x??t̒ e!D  -:: "   "% ?? e|  @`?   ` `?ޠ?   ` `?   ` `??Ǡ4 `2&@ 㿘 I@8 : @ @o@ @8o @ @o: "b  ?D" " " " " "   а  ?:' ' ''''''!  ! @   "  "& `& . ``& i& &`D9:'"   @3 ?#` `" 2``o:  &  b8@ f&  @"& (#l) & :S   &  x 2K5:@  !& '+(*,' adؖl @bT& & & & & & &  @R "'5:`  2   "` @ؔ @Ԕ !  )€??5:0: "b 5:  @`"& 0V&  㿘  `"" @ & " (:" "b ?@F: '|'d 'h'`'l't'x'p ?"@:  t  'lt  |&x#8`'t&#'x| "'||&&#8c 't'l'x'd'`'|'p| ဢ@d[:"$ \ @?e"$?$a| $$a$at$ax$b$a J$`&& & & & & & & & a'b  $b '#'#bT⨘ ܚb& & & & & & & && ` ":  : : b  $b q $aaА` :@`?$ab  $b aВ M4 ?`aڒ `̀@wax  • :L!b@b ?F$b \ $b X'\ T/ P/ L/\'X/ H/ / /X'T/ `/ `/ `T//'P///P'L////L'H/ / / H//L!b@:  O?"@~:_2z:'pb  $b $a$bp `؀!'p"'pp@ 8'p` b  $b b $aԐ $b $bp$ad p?*  'dpd* @ *'ddaزvlv??* 2``4aܐ 4aaЖa@ +$@b  c@@3?b  $b  b  $b @b  $b : : O"b ` ` "aaЀ?.} 㿐 @= :  2 2   @: "b + b 2+? "b @ "@  `2? $4 $ $ !ڒ 4 $ !ؒ @=@  @ 0?㻈# faԠ 'P 2 @"  " $@Ր?'@;y @?s @;m a  @2" 㿘  `"" @H & " :!А "b ?㿈  `@3 $ : "b '?@  ?  @@ 0#\  @ 8!Ȱ" @ @ @0@$ P" `2@0' ` ` `.' .. . .' . .  .. '... . .. 7...7  `?2 .O.* 2   ܄ؚԘБ.`2 7 **  '. ***'**** ' `* `* `**' * * **`*`2  ² 0ki* 2  e ΰȞĆ.`2 @7 **@  '  . * **' * * ** 1'****'****' `* `* `**' * * **`*`2   P" `2@0 ? ``U2 * 2  Ģ+ 2 @  '``. +``+`+``@' +@ +` +`+`` @ `@' +@ +` +`+``@'+@+`+`+`@ 7 + 2`*@ *t`Ģk* 2  f ܰ؞ԆЄ̪ʑ+ 2   '``. +``+`+``@'`+@`+``+`+`` @1`@' +@ +` +`+``@' +@ +` +`+``@'+@+`+`+``@'+@+`+`+`2  7 `+ ʒ@2*` *`' . . .'. `. `. `.'. . .  . . ' . . .7. .7. ..t#tp * d * #p* l t`*  * (` (` ph(`  #l  * (` (` l(`  #h * (` (` h(`  #d  * (` (` d(`  #` ` `* (` `(` `(`#` f!Ԯ' ``"b @@ $`b : "`(  : `  : "b ?`aܐ : (`@È? ''ؐ @9 `@9 `aܐ @+̀?Ր ''А @9͔ @9ɔ `aܐ ΐ2 a@ @` "?(`  @Ȩ 2 @Ȩ ?  Ȁ @@!  Ȁ "b "@t?2 @@  ?`@   ?  " #\@;+ doԐ,* 2 2`   , "*@9X  ,  6 "@6  2  ` &  $ ,@ `@9A`@9<`(@ @@ 2 a`@2a`  4`a䀢 2@  2  5`?2 ?@2@ $a 4a쀢 2 @`2@ $a4a$a@@  2b @ b   $b   @.<#h㿘 @!袒 2!I&!& 6 `@`` ` " ` *7!䀢 2`` 2/*2 2`?@2' @ &  6!6 6!쀢 2* 2 @ 46!쀠 `?&&!@*  㿐  `"" @ $ " :I  :B @K@   6 " =  @k /'`?2  2  @/ 2*?  @L`?2     @  ?`?@ : "b ? "  $" 㿐@ @@ " @@`"g@ ,@   @ "ް ` ?2 ? =@ !?&! 2"- 2 `@@  ! "!2! @u&!@ݔ  @g @ϔ 2 @! "!2`! &!@@`2@ y@D @ "y @ i`e ,@/   @ "c   A@  !?&! 2""- 2 `@@  @ @n `!"!2`2!  &!@ @U 2@  ?@ !"!2`! &!@"`2@͔  @5&@`?㿐 @ 2z x? 2  @n`?  @P 2&` @ 2M" `?2  2 @S <?0L@ H ? 2 @ ئ ` ?2  @" ?#@Ӕ?"%    4 @  " `?2  @U  @M  ?@H ?@ ?㿘?r# @  ` - @  @ + ?"u`?2  2@@   4`!ڐ 4`H$` @ 2q?@ > "D!i?`` @ ?$ @6x`?@4`*2  ?#  2*`2  `?2 "?* `+ 2  *2*` `?4`@ ̔ @! ,@&! 2@  @   @  ?@6  @ ג  㿘 (@   @  .@r 2m?.@  `` @ |` ?"^?` " `@` @ p@ ?2`P?@   ?&@ @5א@6*?#2@   3*`2   ?2 "?* `+`2   *3*`  @?6 ( @ @2    2  ?6  㿈  ` ,`" `  `  #\'7 @( 2 7'@ 2 ` W,`?2 ?7'@  ` C,`2`"@ < %' 2`7@n 2 `" @  ?2 ?2('`"$'@  /?'7@M 2 ` ,`@   $@4`@  '7 `#\  @  `  ,`㿘``"`@ ݔ  `"@ i ``" @ Δ 2`? "@ X      ((((㿈 ``"@@ : $``#"D*` € `( @@&: "b ? @b#\a@0ab  @ @ 0$`㿐`]#"h*` € : : "b L?@F    @ @ ? "7??2  "  "&@)6` @  %   * @  @  @  "??2 `" &@?2 ?6` 㿐  `  @WS @   D "" `D6` ` ` *?2`2 @5  @ m  @ Ӕ " &6`   `,`&@` 6`` ? @ O 2 @  2??2 ?6`&@ 㿐@ 2~ "[" 2s' '@   @  ' ' 7  2&  +@ @   @ k 2$@2D? @  >??2 4  4 @ @ @ ٔ  !& ?2 @2 @ ǔ `2 @ + 2$?4  & &㿘  " (Q& &  (&   . (6 㿘 ,&! @  2& l  2`*`    , 2 @6 @,   "@!&P, `?, 2   +" 2$&-`    @Y 20 4 ?2 @2&  @# 2 &6  , 2!,2"!2`! &!   @ ,㿐 @ ` ' 7@Ô  @  0 @   & & & 㿐 @ k` '  ?2 ?7@  @  0 @   & & & 㿘@`* @\7    @P 2n?$`2" @@ %   "T?&& @2&& && "B  `   @` 4?0@`2 " @"$  `  (@   B 2'@?  '`@`  @1ے  ' @'  ' 㿐    2    * @  2   * @    ' '   !@!̀ "!?'!€ `8 @  " ` `` @ @    ``@㿘` `@ؔ $ @& ?2" ?$ "^" 2?" ( @@"! "\" 2?@?"?p `` @ $` 2 @ |  t 2 €??"k?  @$̖ @2c?$ '' "آ   24$$n 䀢 G   "$$  ? '' ` '   $$?  @$}  ? @Ȕ  ? *@$  ?㿘 ``@@ $`@0 ?"+?@@?2`$? "a$` $`a "a$a$aaȀ "a$a$aa!  ?㿘  ``@ޔ $ `: "b ?" `  `@? ?@ " ?$" 㿀 @& L" !ؐ!b!Ԕ " ?'''' @0@  ?㿘T  : "b +?` @$  `" @  &? " 0$  0` @@"$ 0 $ 0 D "$ $ D$ 4 $ 㿘%    3 ? ɔ @1m  r 7㿘  `@B $ :@`2": "b )?@ " )" !€ @|  ? @> "   @@0@$ 㿐̀ Ȁ q `2B?$$'3'Ƞ `? "`@ @  "@?2,?2,` @/@ ̀?*   !$ 㿐bK ba#a̐@ 9?D?2.a̤!!a$à &  ` $a. a`? "`@aa@  "@?׀aȀ?&''`Ő?*aȀ b  !$b 㿐bà aȀ  `2 b6?b  !1$b $a$aab'b'b$b b a* 2" b@/C @ Ѡ  ဦ$b 㿐bb  b%b*'b  !$b   2 &'@Ж  ? ߰ $b Pl㿈  `"" @͔ $ " "-" "*8T:!̀ :!Ȁ * `?"$!$!@. !!" "@.Ɣ" !'"''' (* . € (  : $!"@"  @:"@ :" R : "b M? 5" )2 "!€???" %" "" '" '"'@.p " "'@( #?"`" "@  "$ $"  $"  @G p f!Ԧ' @ܔ܀?/ܒ ?' ' @  @Q  "@@?2 @ J?`   "@ @,`2 #\@/ 4 /$,`* 2`2 @  .` "*@-,  .`  4 "@4  2   $  * @- $ $@    @"N!㿘  `@ $ :$ @`":"@@% (  " 2 $ @  $?$ $ "b  ? "  @$" 㿘@ 2@?`@ @9  @4 㿘`. @   " @& ?2I?``@ ?& @,. ``@ " @: ?6`?* c2  @ 3@*`2  ``? ? @" : ?* `+ 2 ` *3@*` `` 6`b?$b㿘@  ? ?$  @`$㿘  @ 8㿘<"D`@  $ 2 0 : "" @4 G?"  @  @? $  ?4 $   4 ` @@" </  <$ 0 $  8 &$  2 @~ ,@  |  $  $  ?Ȑ*@$  4 2 @ 4 4 $  <<<<㿘  `"@H $ `.,"0*` €@%:(" ( #  $    ( " "  $?2"G " )2"!€??<?": "b 5?" " )2 "!€ $" ـ8 @P   ( , ($ $@"   @@0@$ 㿘'L!Ā ! B  `; &!&!!L@+9  &!& "@ @`* @   !@3!̀ 2.?&!" @"#!̲ @ !Ȁ  c`2&!? &!!Ȓ@*' !'''  㿐@* ` @*& :! א 1`$?&'!?@' @ 8@*@? "@`' 㿐` !@?@@j %? $$ $ $ 4 @4  @* $@ &ۦ@  㿐@*s `@*o  @` 2` ? "!@   ? @N "'`'@ @ 㿘&`!Ԓ&`"  @&!@&" 㿘!Ԁ`@'   !&@" `$" $!@ 㿘 ,&!  @  J: $@& 6 m   ?2  !*`2 @`*+@   @( !2 !&! В*2 ?@    ?*2 ?@    # @[ @V " ' ,` *`  ? *`   #  @< !?&! ` @@ ߀$  8% # <  : "b   @*$(  &&   ""  &$ &$&$&$"$$"$"$ 㿘$? e cp@Ő#@'@. , $ &$@"&@" &$   *   * "" 2 "" "" " @2 &" & 㿘  *  䀢@ ""`@ "@@ & "`  @"@"`>  㿘@O ?`  *  @ `"`"` ,@"@$`$@` 2@"`" "@`@` & "` ` @`"`$` $` @2 &" &  ` `T,`&"@@ 2$I MҐ $`@$  ? :`@)Y : "b $` ,`` `  `*  ,`  $@$`` 2 "`" "@$` $` @2 &" & $"`$$``` `*` *` 㿘 @ & "`  @ &"` 2 㿘   @f?2  ? 2 b$  ?㿘dd @*;d@"7d  2/  @A?<    *  @@  ""` @ "@ @ $`"`  @ "`, $@"2 d    d@( $ , d $d 㿘$ "$$$``$`L `$@($ "$ ?"`$$``` .``("   2 2  㿘'L'P'T'X@L㿐@5  6n  ``  @: "b  @ " 3  `K!3 KKLL#|cД3 # $# ,# (#  # Jr  wa: :        &  "  J+b  J +    "@  4: /  #8*"@ J=2 "  J JJ 2 J=ې    㿐ƒ㿐@3 ?㿐 @' ?㿘  @  㿘  @   㿘8`: "b L 2 $?: "b ^YL`X  0,^^ ? L X `L X`?#@ Z˒ 4GA,? `L X` ``%<'+: L/2?,c _, `X%b 8L`*T!  &@K , A, a,:" `< "  ! :" `. ֒ :b  $`? a eL` `Z" , D `@ `  `ő*:  z p    %'' !8` ,`'l  l @% ?`] $"@? .` `.    @.  ` , , . 㿘8!8` 8< *@? #!8**<㿘8!8`88 a<a<? *a< ` `,  w@, ` - - ,㿘8!8` ]-8b@88<< (<   ` + *  *<  (< ,   ` + *  *<  (< +` +  *  *< (< ( + *  * 㿐#\#`  @&  @'P'T`'X#?"77'P`''''@`*ӌӨӰԴԬ,444444444״״֨ܠ ״״״ְ ָTۘܬH\p         `<hp<@@x|㿘` @e&`&`&` 8 faԤ    ? ,$ 7'''7'''''@ @ 2? @  @4   !@7 㼀 f!Ժ'H'@' ` ` 2 ` @# : "b /?`   HW` H!H4''0 ''P'X'T'' @  4 %'' $$XT@ 'X 'TiP '   '''?/J@`'?`X3!*` €O  /  L ?Ѐ 0, L** ?Г:`  L $ 0  '0H0@,0 .' '.'  '  +/J  *?'L ? 0, L** ?Г:`  L $ 0  '0H0@k,0 .'.?&g?f?Ѐ  , * ?РJ@`?Ѐ ' $?&S?R?K  , * ?РJ?Ѐ ' $2?'0 7'0H0@,/, * @J l2% '! 0`.@/   ''0 @ `.@*  : `.@:  6q  -/`k ? g   G  "  0`.@''?`".@''?@2  !  ! -/ ! ( @0  ! 0 (#`!#\'@8 g G  ?@$ g g E e e f' `@s'( @ (`  O'`@ @  O'``4  $@ O' D  -A/  0`.@:`:  `.@ " @ 0`.@2`.@"   'x'|x 0 @ `.@  `.@  0`.@ !`8 '  q x0`.@ ! P   @ "@$/@   'p'tp 0 @ `.@  `.@ /  ! X ! 8  ''h'lh  0 @ `.@  `.@   2 / '?쀔`S "  7 !F p  4`,  `4 0 , 806 03,  @ `0,   ` `0, , 4`  ` 4  ,@   %@ / / @''O `' '􀥠4O" . 3 e`P $$XT` 'X 'TDP ? `P$$XT@ 'X 'T.P O   $$XT`  0//  $$XT` 'X 'T P 4" . - e` $$XT` 'X 'TP e? 4$`$$XT@ 'X 'T֒P O" - - e` $$XT` 'X 'TP 5? 4$`$$XT@ 'X 'TP ! e$$XT@ F !ఁ BV  !  $$XT` 'X 'TP  (@  $ $XT` 'X 'TfP ߤ(?  - e` $$XT` 'X 'TLP Ť? 4$`$$XT@^ ``( !  $$XT` 'X 'T(P $ $XT` 'X 'TP   - - e` $$XT` 'X 'TP u? 4$`$$XT@ 'X 'TP _$($XT(@R$($XT( @ 'X 'TɒP B ("@ - - e` $$XT` 'X 'TP '? 4$`$$XT@ 'X 'TP   !  $$XT`  $XT  @ 'X 'TyP    !  $$XT` 'X 'TcP ܤ$ (" $( X" T@ t ( 4 R   .//  $$XT` 'X 'T6P  ! B($(?$XT( .@ ? 4 - e` $$XT` 'X 'T P ? 4$`$$XT@$$XT` 'X 'TP f`$$XT @ 'X 'TْP R 1" , 3 e`P $$XT` 'X 'TP 5? 4$`P$$XT`'X`'TP !0 & 'X P 0'TX P 0'T0耢,wɐ '0` @? f  !@  f!Ԩ ?X'/*`\ * \ *`\ * \*`\* \*`N%2   N `X3#P*` €N ?X %L* @ L*`ДЀ @LN*6 N ?X  L* @ L*`ДЀ @L $@  @ \@X\ *@`@4 \@ X\ *@`@4NЀ NЀ   +  * ?И NЀ  $ @ X@\@ڒX\ *@`@4qpN X@\@ȒX\ *@`@4_^N@\@X\ *@`@4ONN@X@\@X\ *@`@4>=N@\@X\ *@`@40/NX@\@X\ *@`@4N@\@zX\ *@`@4N X@\@iX\ *@`@4N@\@YX\ *@`@4N@X@\@HX\ *@`@4ߦN@\@:X\ *@`@4ѦN X@\@(X\ *@`@4N@\@X\ *@`@4N@X@\@X\ *@`@4N@\@X\ *@`@4NX@\@X\ *@`@4NX@\@ےX\ *@`@4rqN X@\@ɒX\ *@`@4`_N@\@X\ *@`@4PON@X@\@X\ *@`@4?>N@\@X\ *@`@410N X@\@X\ *@`@4 N@\@yX\ *@`@4N@X@\@hX\ *@`@4N@\@ZX\ *@`@4N2N* &#\   @?& )\+ " \ `3# *` €`@?``@? ``@?``@?`` $\ !uH'\!  !@i 㿐@ *  #\  @l?&@@#\ ? @\ @@u@& @  @$@ &@㿀?"\ f#   e E   ! Ё 9/ -/?#\  ?@耤 g G f# fJ 02 @ !`Ё B  '@@ ! Ё B3'@   0`*@@ '`" "@ X f!Ԡ'`, -,   +,  쀦` h  0.R? ` `0..   Ԑ 0. `0. ԰&  !@ ؁LLdh㿘8"L.  ` @ " ,, {> "`"`"`"`  8`L("@ 㿘? #  ?: @?64`4  *  $ 2  ,   * @ ː, " & 㿘 Q  *`   "`"``   N      &N    ?  * ?<* 0*  *   @, 0"@& 0"@" ?  0 0 0 02 "@0  "@㿘&  " " 㿀 `@6  `  ` . ' , `,`% *%@  ''@ L@ @`'?c '? c>H @  >A4`4 444 4  $@? #>( 4 4> 4 @   4 $@  $'  "' 㿘`  e t*  >``#!8"```"q$" $@ 2^$@"`" >`U>``2@㿘>`@ *  Z `` "? * ` " * " 2@ ` " " ?& C`(` " ?8 㿘     H     ` * `@ (? # @  "  22: "  33 ` :`@  ?# @  : 2`@ 33  :`  ? 2 ?   ?0  :  4?8      ( ;``"##㿐  * ? " &@ " 4  ? "@ ,2   ? " 3 ,  ? " 4+ @ ?"#㿐T ?. . 6  `''`'   " *@ $ 2 '$   $   $ ΐ $ $   ` 5͐@& "@ Γ. @&. "@&㿐v? o ?`  " * " *#??ā`@='H  ! @ "0' @ e!D `  2`M@ - + '2M@`M@` @`0 *  `M@`0 @`O* : + '     -*   ?4`+  *  ?Ъ`M@ /9뀥 :`E` =M@0Ϫ`M@0`π 6e ' `(``   -*  4+  *   -*    +  *    M@Ѐ Ӓ`e EI 2 `2"ڪ`M@+ -І `M@Ѐ .0Ϫ`M@0"`π !Ъ`M@ *  `M@?Ѐ/9*%@ "" 2     `H &@  ' !"8B?   !?a(* @ $'%H  !"8BD? >'@ 2:%`"_H%`   !!(.` ?$%% B"@ $% !a(*@?$&@ .`% B@?$% B  !!(*` ?$% ?*%@P  !!(* ?$% B?4$ : e!: ""b 䀢 H   ! + @?$% B?: + ?,$ ?%( B?   e$(#a?_]   !!(* ?$% ?K:4 !  !b + ?$% B?: + b@?" !#"0 D(?)F!?()BD F? !"0: ""b 䀢`|H 4?@?r  4'''o  0[5 # @  I ?   ?  2:?8 ? ! ?"0! B0&  !"@!+' !  !bH&1'?  !" ! !"H!bP !"H ! !bX"XB'bXB &'??@?Ѐ B- %?,??? @'cD?   #" eD? !"H  !bXB B?f?? @D?   F#' € !? ! !"`  !bh 0"p ``` *@ ` ܒ `       $@  ?3 6" @   4`% & $@    4`( "w & X  ?H 2"?"쀢 #㿘 t -    `L `1?#  8 @84`4    "@ @2 @:`"44 3`: ('  "'  0?#`  - @4   4` " 2 @:`"44 3`:  ('  "' h8"D'L'P'T ?8"H *@  ""8""DȀ`6'@ '@ * ' % ! T#"@̀ !?  !P  ! !"x""\`N    \"⠁ B T "\ !հb "  /Ȼ2g Ⱥ| ?* &' d2`   @Ȑ"̒*2   ̐"*@'  !"B?{͔ ? '? !" !' !b" D ! !HFBL ' B# ' !!(, $ȇ%)'#?    '% 'L 8'LL` 'L L "'> * €?'? 'P'P`P 'PP' 'P``' 8 ` ""H  ,  `"HH8"bD ` Ⱥ  '  ! a(* @<"  # !Ƞ "  ?Ȁ  !! /`@ &' B<  `ȅ!?Ȳ !`a(* @>`$Ȁ %B? !!  /`@ $ȇ%B?ȡ<  `耢  !bЁ 9' 쀢  !b؉ B ?' !ȀF"?0D'@'& !"  '$% ?ȅ)  P?䀢 I !a(* @`$ !%" ȑȍB'`0-@ȍ…&' Y?ȉ" !"Ћ#ā) 0 @6T? !"ȑ DDB?ȅ'`0.Ȱ …&' 7?ȅƁ)} 0`@4?Ȑ* a(@ $ !% B"Ȁ@B'`0.Ȱ ? !"D-Y 0ȉ&' 9?Ȱ?N 0"? Ⱥ`D??Ȥ  ZX !!(, "P #     !b腣 Bȁ  1-@ Ȁ@̍B'`0 L.Ȱ  ?ȉ"#B  ?ȅ$%L` 0?N 92?-@ .  !"؉ B !?"D`'Ԁ ! L ؀d3 6" &$' %  ` @4%%&@䀢`` 8 } t L̀ 2'?@2 '   ''  *` s '@ `` "```@m g耢`    ٔ 쀥L  ˔ }  1Pɤ8 1-@`Ĥ``,܀'  Ը* @     Ԁ   ' 'Ԑ  `Ԣ 06L  *f` L` ̀ `9+ 4`f.& ``L`̀ `ƒ  4`2N.`"K.``:  9E. `9` 9., ;..@   ( ` 0.@  Β 4 ??`N  1?N 9  .-@`N 0"?   Ԁ`@ ߐ2. 0-@` .T"\2"+dd !0(# eL$8 e!       $((()(*(+ (,!(-"(.#(/"L eP  e" "` "`"P␝㿘` ` ` 2 @@ : "b ?@`  ` `, $$ ڤ`" $&`ְ `s "` `@  @2` :` ``#. ` *. oƒ` ``&@$`$`$@$`` "`*@@`@"@$`$@.@` @@@@.$@ 2` `` `,` $u` ` @`@"@$`$@`" $&`b   `  ` @( "@  `@ ` `@ @ @@@@$@ +0@ `,` 0   @`@"@$`$@2`@   `" $&` ` ? @4` 㿘<"D`2 @+ 2  " "  0` @@"& 0n͐ & 0 &   ?6 &  6   2  " @b?@   &  &   &  㿐  C & & '&@%n_  K  C  & 6 & &@ #@`& & & @GV  2` 6 8T  &&ǒ  &<  ؐ`?`&$&@( "&@$ L ( (L @"$㿀. * "* n  *   ? # 8""? P? ?    ( 0 8 @ H88888 8(80888@8H8P?X㿘<"D` e@Q e#   R X 2 &  ?2 2 """""""0"4"D"H㿘@ e " `  ` "@` 2`} $㿘L@!|㿘K@ #@< "bD㿘T G  P > B< P ?Đ*@4 㿘 ! V  @-  ?Ē* 6 V I㿘T   @?  2  ?Đ*@4   4 < P㿘bV 㿐' "  hؘ 0 ?? #\ @  ǰ ࠒ hĖ 4㿘 2 L@7!|   :@  "b ?㿘T` `  ` `@" $@`$`` ? @4`  $`` &  4`, 㿘 e# ? T` "??`X2㿘@" 3<3H3h3|33p3333444 4,484H4T4h4t44444433334ȝx? `}'L"*` € G  9耢 ~?|z d W  7  9 耢 n?l ,  )  C  #     : !              '9'    '1'                    $? ܖؘ @  ? ܀ ?: "b  ? ܖؘ @  ??܁` f!Ԡ'# "  ag ,  @ 8@ a g .  "@*!(㿈 faԀ     % ?' Ԡ     @ f ?2` Ԓ * ,Ԕ * * 8 f!Ԕ '?''Ė  "'''''a0 @a?' @ 8 mi @ '''  ѐ BBg& *" $OpenBSD: bzero.S,v 1.3 2003/06/02 20:18:32 millert Exp $ `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿘 `"  `  ?2  㿐@H 'T f"B8 T 31?T2 7耦(7耢 2: % 4`44`44`4`ؤ45 5 ȕ4'5 5  B'? 8' `B`=Β`*  A=Đ`*  A=`*  AT  -`=T :-`-2 ,`- ͓2`   ` `" `` 8   đ. ?2@ Đ" * c'Ā@ '.` @ '  @ @ @?   '/ @   7@', A=N '.. 2, @ ( ?#   ?#/@..  ?-'$$66`% @"6``4@  *. ?  @26`@4@Ā2T`#@  " . @?* :@ @2. 4@*  *`T@ :̑* Τ Г*`@  +    ?( 8 2 + ( 2X@V+  2     " *@ `2 "@ `2 *@ `0* @  "2 2  "? *@2 ?"@? *@;`` (` `?#;```0  ?2 `2 # "  J` ? `   ?J@"J@@  " *   J@"`   `(*`  $OpenBSD: strlen.S,v 1.3 2003/06/02 20:18:32 millert Exp $ J " 8`  : "b @!!ܢ  ?$a$aڋ?$a:"  Y a   ̀@`@  ` @ N: f " f$a #T$a aA!?!:" p!:2 O@!a@2 O`?   "a  €"`@ "` OX!:`(> $a@ 2V ` `D* a8` `*@ :@ *`$a@Ē   `@$a0@@$a0  a @ ?$a$$a4g $ Q!:" @֐"$" SQRRSR"0`T\㠘#cH & & & & & & & &  &`ah$"  㿘 ?@ g " ? ?:  ?8 f#T` ! @$ $ $ $ $ $ 4$! $ 8$  D @O  Ē @K @` C :  @$ $ - " @ *@@@ $ $  2$ 4 2$!  2  ဢ@ d"$ : "b   $ @  㿘 4>  & @  *  D# *#  * ,& $& `@ " ?!.`2 ? & ,& < & 0=& (@w , @4& @㿘!4@ג   :" !؀ !!ؐ?* &! g9!??&!g2!@W 2!:" ! 6!!8, @ "!g! , ! "!g! "!g !?g: "" ?㿘`: "b ? "? !4  @r  2 ?@  2?&!0 㿘!4 1aa!  & "&  "& @!! @` ?!? O:"" &!, !8 đ, ` , @ @  2?  ,  㿘  @=  :"" #!,?㿘  !  :"" #!,?  @ 㿘      @   :"" ",?㿐 @ @Җ ?P ` ` -` G`   % 2  `@ @ G`   @ "s ``݀@u +2 `'@* 2 `@ "W ``  T?` ` @ ~ F?F ` `C `! ``+00 `6 `,@  @  & "@&@  2 `@ I  `?@   ?0 @?? ` ?-`㿘    :"" $!,?!$   $!($!$$!  ! 2!$ $!( ( @ "m?$! @ "  ($!$?$!$_ !(*  `2@ *@ @ $! $!(`  @ `!$$!  $!$"! @ "! !**`     @ޘ  *?0)! ` @ @ &@@ ? " &`! ( 2  @& *@ 2" &@  !$ $!($!$$! $!( 㿘 (  4  0& (!@   @  *`*`!@0 "+?&  @X !ؓ,` "  ?!! `&!&! (@    D*` + "&  ,  & ,& 0@ 㿘d  @&@> d$㿘! € , (  0㿘 @    &!  @.@   !:" J$" ?6  + +* !ؐ@" ! `&! 㿘   "   "     6@ !ؐ?*@ ,  ?!0    2@$   `?@   ,$ ! " "@!&& $! "㿘! ! ` "`c     @c $`d  @ ! |?z&!@"``@"` 2` ` "n$` `@ *  ? ` @ ǘ 2m ` "``  !ؑ2*  !0  * * " *"` "=$` $`  27$`  23$`  @ *  ?     @  21 $  , "` "!`$ !$!"  "@ `" $` $  `  `" $` $`&,` ,`!Ē!$`$@&!`" @ :@`! "!""!㿘! 4 !/   `   @ - 2?`"  "  @˒ cK  " cC"!2  @"``"` *` @`"!"`!"@! ` YZtZ`ZLZ8Z$ZY`7 ``22`V(* * * * * * * * ؔ   (  㿐<"H?' @;  fc\   `     ` @"\9=^!  @  @ 92^ @6 $OpenBSD: sigprocmask.S,v 1.4 2003/06/02 20:18:32 millert Exp $@2@  0 W`H@2"$OpenBSD: cerror.S,v 1.4 2003/06/02 20:18:32 millert Exp $: b ??㿘@ f#l`<"H``? ` ,  "??, @[D`2` 㿐<"H@`     6  @   6? 2& ! f#l a b*$#l#\   @M??H 2$  $ $ H2 $ $$H  * "  $ @  ? 㿐<"H@<`6 0`    ! f#l a a$#l#\   @??2  $ $ $$H@M  $ @E 㿈: `    '?   @ ? ? ```aaaa$aHa,a8a8a8a8a8a8a8a8a@aH㿘 @U  N:`2J:   < ; <" #`8@= <9    1 ",  ?`#W#*` €#?###    (",&  &: "b ?Y V+ 2     " @*`2 @"`2 @*`0*@    "2 2  " @*2 @" @*㿈'XX#d#h#\#` @; Łx  ??''쀢' :"b  ?<"L *@ @  '؀ ?؁㿘  ` ?7ߒ: "b   $q`W @ (" @ ` ?  2  㿐#\#`  @К  $x W`H@$u W`H@$Ą W`H@$2 W`H@$1 W`H@㿘 e!D   ` `2 -+M  M0 M x XM 0  >?ΰ? ??   ( O !:@ @  : ""b ?? ?Q<@ B    eaD   ` `ͦ eaD   ` ` eaD   ` `  `  '$Ƅ W`H@$ʄ W`H@$J W`H@x@\  7ސ@' @ 2 ? ޒ"@6 * 2 b    & , @ & $ , @ Y`,b  @ ?y V@:?``,Ba @ W  7  "  "  0= 9 ; 07   5 ?  a `( ?  *   2`*`2  (" ` ? ? @ @ ` '' '@' ?:      "   @q @   * ޓ2   * "@ *e    6   "  "  0 @ e0 ޔ"6 *`3 ޒ*  C}$  ޔ"6 *`2 ހ*  & &  $   ,  ! `[  @ݐ? 0Sހ ? * @      @` @ؐ$@$  ޔ"6 *6 ޓ*`@ &,$  ? * @      @` `?2 $@$  ޔ"6 *`6  * 2`&  $  "@@ 2@b @Ӓ?@?@3 @/ a?$a  @ @ 0@ @  @ ?@  v`㿐? a  4`$@4``$`@$`` $` ```?2 @  &`4`7&&C]Mؠ 2Ԕ 8  ` @`$` @ ``$ $ 4 4 $  ' 2@]\ & ӯ @Ɩؐ"]D&&㿐Ւ В   $@$@$`$ $ $`4 4`!ڒ4 4``  $ $` @&&㿘!ڐ?6`6`*  2 `@?2 @$$ `6`6`*` 2` @ ?2 @$ $ ` 6` `&` =  㿘!ڐ?* 6`6`2`&@ @ &.`  ' 6  ` " 6`6` * 2 &@@&.   `"`  @C?2`  ? ` " *2 @ 6`6`m&`   ? 6`&`   x`!ڐ?2 7'T*`* 2`'X2`     -'7  ''`'-`2 2` X6  "-  -0*  -0$2 @ @ `  2 @ @ ` `  ? `-2  @   2  @ @   ?V-`2 7   /`2   :/*`2 -2`@ $* "6 2  'ܐڔܒ`@*`2     -`-2  `-` 2  @6    - @@-`-2 @ `22@:# # "2-`- <#T@"2@ *H`--@2 <``  "*  *0  *0@ @ `  @ @ `   ?*  @ @ @ ` -`"2`64 Q*` `-`2 -@6 6㿘 /     " Ѻ  ?` (0 `*`0`@*`0  㿘,` ``$, @2 `,`2`6 $, 2 `,`2`,``2 6**`@6$ 2`2`㿘`. `@C"?. "  ,"* *`@`2 `" @ Ő@4.`22@22*   @4 248?$8``.`㿈  A   9 2 j?- .`3 3`@c Y  - `  -`@<`` , @ '2$'Ԑ2%* "@ , 2 $ @ N@ "@44 @ '" ('`@ʴ@ "* 2``**`4@@% 2`@* 2   - ` ?-`p?*2`@   ?* 2   #\@* 2?܀؀*,`2 ` 2%`# + 2**4' 2*`* 2 2` c  @T   l  i,`,`2  ' %@ '`' `# ' `2#  * @  `@  @Ӑ "w #. * @  `@ c@ 2"?U .`* 2`@  *` `8,`,`2  *F @ْ 㿘`- *2  "3  * @ *2  `%*2   @ ` N @ ?͖ "\?``"    ϖ*``ˑ*  *  @  `@ `@= 7 `  *  @  `@  Ҕ`@< "`?@Ҕ`  .` 8` & 8 (/` 4 $ ?㿘 4@@ `2  & 4 & 4``@V.`,`2 `S  &` ` *`*2*  2224`㿐!  6@  ?6` z6`  <?*  D@ 6  *@  <?   ?*  D@  @>  .? J?: O"b B?6@`2  @ 2  6@ ?6` 26` ဢ@-`"@ :  &@?'  .@ .`.`.`` 7.`.@@  `@?7 .@.`` 㿐!? @ 2h?  ဢ@,! "@ :  $'++ + +    @ 7 **  < ?*  D@ 6  *@  <   ?*  D@  @> c?:  O"b ?㿘W !!<   , &! + " %?* $ ĕ.2 !8.`" $      (㿘 D, `$* : ?=@ 1 8. @@e À2 * ?  $* ? @  :  ? ?e` *` Ց. ,D@  %$@   "@ * $@ g$  #% *` ,$   ?$   * ?2% ``m #, Y  2l ` g $Z #% * ,$  , ?$   :** %  * @% , ;V  :**$   * @%  *` $ ?%$  D D .  4  ?* D@$@ g #. .  6 b8 2 1: "b  㿘`2 ` '*  D@  $&& $ !8 : +`*`   @  :**$   * *# ;㻈# faԠ ' 2 #>"p  #" #$x?' ;?&!+Ґ!    ! ?a  #P"㿘,``$4, @2 ``$ 6, 2 64`4`` *`$ @2`* 2 㿘!@6 U .`!8$ .`     9  2U  ?*@    2@* *@ 㿘`*  m* 2 *`*  4`$ , 2   +  +  42*`4$ 2+ * 2 4 `|%0+   &@2 @ ,$@,`4 2 I4 5?%@*"@2* 2  2` `.`*`@`?`*  H* 2 @ @"**  4 $@ ,`2   +  +  42*`4$@ 2@*  2 +  4 2 2`?+  4 `` .`*`@`? 㿘`  * 2  ( `*  ` * ?`*` .`2`g ?`   +  ?  `22`$`%?$`?2  + *`2 "  2 ` *`@ 2` ` ,`   8 ?$ 8㿘`,  " *`2 (  `$*, 2  &  $@``" *2   **2  ?,   ??㿘 @+  ? ֐ "    +  @  `+ &@  㿘`.  `2.*  ? 𢡄 "s?`  .  `*  ?  ]` ?* @   2  "?~ -,`D?  &" !&  * !$  &!(&!$&!  ?a (&!  &!(`@ 2" !$&!  &!$ ,`2 @?&  :! ! & "b ?㿘`   "@(`! SSq @&!, &!( * ? /&!  `,!$&!  &!$*  Ĕ $?,` 2 @ :! `8@ 0 "b ?㿘@  ?&! &?㿘```? * 2 "@ ` ! S<S /$!  ,%?@*  ΐ ,` 2 @ :!``ޒ@ 0 "b ?㿈\'P 2d?=@ P* 2`` 4 Pf $ L?$  `"`` *``/`` *` 2`6 *2 *62`6@2`* 2 P$$  `` *` *  *` 262*`@2`P  ?6P"$ $ 㿘٨%s: %s not compiled in instbinUsage: %s ..., where is one of: %shostnamedmesgexprmvsleep-shshkshsedmkdirmtrmmount_mfsnewfsinitfsckfsck_ffschflagschownchgrpchmodgzcatgunzipgzipcpedhaltrebootmount_ffsdhclientftprouteinstallbootmknodumountfgrepegrepgrepmount_nfsmorelesssumcksumlsifconfigcatpingcpiotarpaxdisklabellnsttysyncmountdfmount_cd9660dd!!! ! ! 4@@! P! ! ! !x @@!p skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd! !@!! !@! !@!!!x!h !@!X !@!P !@!H!@!8!0!(unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination%s%s: illegal numeric value%s: %s%s: short input record    [.<(+!&]$*);^-/|,%_>?`:#@'="abcdefghijklmnopqr~stuvwxyz{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@O{[lP}M]\Nk`Kaz^L~no|JZ_myjС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwx    .<(+|&!$*);~-/,%_>?`:#@'="abcdefghijklmnopqr^stuvwxyz[]{ABCDEFGHI}JKLMNOPQR\STUVWXYZ01234567897-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|ཚmyO_ !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxjJ7-./% <=2&?'@Z{[lP}M]\Nk`Kaz^L~no|_myOС !"#$()*+, 01345689:;>ABCDEFGHIQRSTUVWXYbcdefghipqrstuvwxstdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer%s: end of device%s: short write on character device%s: short write on tape device%u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) summaryA.%sskip reached end of input!!!!!!!!!!!! !updateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rrealpath %scd9660%s: Filesystem not supported by kernel%s on %smainusage: mount_cd9660 [-egjR] [-o options] special node ,-o %s: option not supportedhiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file systemempty type list %lld %6s%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s A@Y Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s @Y df: %qd: %s usage: %s [-hiklnP] [-t type] [file | file_system ...] ffsext2fsunionsoftdepsyncsynchronousroot file systemroread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasyncasynchronousffsAadfo:rwt:uvforceonly one -t option may be specified.updaterwrqnoautogetmntinforealpath %sunknown special file or file system %s.root_devicecan't find fstab entry for %s.malloc%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountdmain,/usr/sbin/sbin/statfs %s%s on %s type %.*s: %s already mountedexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %smountfs%s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemdirexeccd9660norripgensextattprocfsversion %dlinux) prmountempty type list%s,%s-ousage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-Aadfruvw] [-t ffs | external_type][-dfruvw] special | nodeufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s,-o %s: option not supported!! !!!!!!!!! !! !!x !p !h!`werasetimesuspstopstatusstartreprintquitminlnextkillintreraseeol2eoleofdsuspdiscard!0!(! rprntflushbrkoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sillegal gfmt1 option -- %sillegal gfmt1 optiongfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d :%lxcflagiflagispeed%ldlflagoflagospeedttyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakallillegal option -- -%soption requires an argument -- %s%d %d %d TIOCSETDTIOCSTARTTIOCSTOP!@!8!0!(! !!!!!! ! !#!3!#!3!2!3!3!#!@!@!@!@!!x!p!`!X!P-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5!!!!!!!!!!! ! !@!@!!!!x!p!h!`!X!P!H!@!8!0!(! !!!! ! -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrk!h!`!X!P!@!0!(! !!!!!!!!!!ø!ð!è!à@!Ð@!È@!x@!p !` !P !@ !8!0!(! !!!@!@!!! ! !C$!C!C$!C!°! !!€!x!p-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho!!!!!!! ! !!!Ÿ!Ű!Ũ@!Š@!Ř!Ő!ň!ŀ!x!p-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostoposttablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s print%s: %s %s %s%d-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZmainusage: %s [-a|-e|-g] [-f file] [operands] @(#) Copyright (c) 1987, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ln.c,v 1.10 2003/06/02 23:32:08 millert Exp $Ffhns.%s%s: is a directory%s/%slinkitusage: %s [-fhns] file1 file2 ln [-fs] file ... directory @(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: disklabel.c,v 1.85 2003/07/29 18:38:35 deraadt Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenp:rs:tvwbckmg%srioctl DIOCWLABELunknown disk type: %sDANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO%s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of diskreading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFOBootstrap doesn't leave room for disk label\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u: %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uA# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffsetw # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: editsh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sgetasciilabelsector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %dcmplabel usage: disklabel [-nv] [-r|-cd] [-p unit] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)usageRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) editorNo space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. editor_addpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and sizepartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffsetpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk %s: [%s] %s: [%u] Rounding to nearest cylinder: %u getuintAA? Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] has_overlapChanging device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.edit_parmsfailed to sort partition tablesdrzwdfdFLOPPYxdxyhdCCDVNDsvnd!!x!!x!!X!!!!ߐ!!ߐ!!`!@!!8!!!0123456789Possible values are:"IDE", Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, CCD, ST506, or floppy.Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).The 'p' command prints the current disk label. By default, it prints the size and offset in sectors (a sector is usually 512 bytes). The 'p' command takes an optional units argument. Possible values are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, and 'g' for gigabytes. The 'M' command pipes the entire OpenBSD manual page for disk label through the pager specified by the PAGER environment variable or 'less' if PAGER is not set. It is especially useful during install when the normal system manual is not available. The 'e' command is used to edit the disk drive parameters. These include the number of sectors/track, tracks/cylinder, sectors/cylinder, number of cylinders on the disk , total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. You should not change these unless you know what you are doing The 'a' command adds new partitions to the disk. It takes as an optional argument the partition letter to add. If you do not specify a partition letter, you will be prompted for it; the next available letter will be the default answer The 'b' command is used to change the boundaries of the OpenBSD portion of the disk. This is only useful on disks with an fdisk partition. By default, on a disk with an fdisk partition, the boundaries are set to be the first and last sectors of the OpenBSD fdisk partition. You should only change these if your fdisk partition table is incorrect or you have a disk larger than 8gig, since 8gig is the maximum size an fdisk partition can be. You may enter '*' at the 'Size' prompt to indicate the entire size of the disk (minus the starting sector). Use this option with care; if you extend the boundaries such that they overlap with another operating system you will corrupt the other operating system's data. The 'c' command is used to change the size of an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may add a '+' or '-' prefix to the new size to increase or decrease the existing value instead of entering an absolute value. You may also use a suffix to indicate the units the values is in terms of. Possible suffixes are 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). You may also enter '*' to change the size to be the total number of free sectors remaining. The 'D' command will set the disk label to the default values as reported by the disk itself. This similates the case where there is no disk label. The 'd' command is used to delete an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. You may not delete the ``c'' partition as 'c' must always exist and by default is marked as 'unused' (so it does not take up any space). The 'g' command is used select which disk geometry to use, the disk, BIOS, or user geometry. It takes as an optional argument ``d'', ``b'', or ``u''. If you do not specify the type as an argument, you will be prompted for it. The 'm' command is used to modify an existing partition. It takes as an optional argument the partition letter to change. If you do not specify a partition letter, you will be prompted for one. This option allows the user to change the filesystem type, starting offset, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all parameters are configurable for non-BSD partitions). The 'n' command is used to set the mount point for a partition (ie: name it). It takes as an optional argument the partition letter to name. If you do not specify a partition letter, you will be prompted for one. This option is only valid if disklabel was invoked with the -F flag. The 'r' command is used to recalculate the free space available. This option should really not be necessary under normal circumstances but can be useful if disklabel gets confused. The 'u' command will undo (or redo) the last change. Entering 'u' once will undo your last change. Entering it again will restore the change. The 's' command is used to save a copy of the label to a file in ascii format (suitable for loading via disklabel's [-R] option). It takes as an optional argument the filename to save the label to. If you do not specify a filename, you will be prompted for one. The 'w' command will write the current label to disk. This option will commit any changes to the on-disk label. The 'q' command quits the label editor. If any changes have been made you will be asked whether or not to save the changes to the on-disk label. The 'X' command toggles disklabel in to/out of 'expert mode'. By default, some settings are reserved for experts only (such as the block and fragment size on ffs partitions). The 'x' command exits the label editor without saving any changes to the on-disk label. The 'z' command zeroes out the existing partition table, leaving only the 'c' partition. The drive parameters are not changed. Available commands: p [unit] - print label. M - show entire OpenBSD man page for disklabel. e - edit drive parameters. a [part] - add new partition. b - set OpenBSD disk boundaries. c [part] - change partition size. d [part] - delete partition. D - set label to default. g [d|b] - Use [d]isk or [b]ios geometry. m [part] - modify existing partition. n [part] - set the mount point for a partition. r - recalculate free space. u - undo last change. s [path] - save label to file. w - write label to disk. q - quit and save changes. x - exit without saving changes. X - toggle expert mode. z - zero out partition table. ? [cmnd] - this message or command specific help.Numeric parameters may use suffixes to indicate units: 'b' for bytes, 'c' for cylinders, 'k' for kilobytes, 'm' for megabytes, 'g' for gigabytes or no suffix for sectors (usually 512 bytes). Non-sector units will be rounded to the nearest cylinder. Entering '?' at most prompts will give you (simple) context sensitive help./dev/%s%s%s%c %s %s rw 1 %d mpsaveStarting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors fragment sizeSize of fs block fragments. Usually 2048 or 512.Zero fragment size implies zero block sizeblock sizeSize of filesystem blocks. Usually 16384 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. cpgNumber of filesystem cylinders per group. Usually 16 or 8.FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' Can't stat deviceioctl DIOCGDINFO[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. $OpenBSD: ar_io.c,v 1.34 2003/09/08 20:19:51 tedu Exp $Failed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. ar_drainUnable to truncate archive fileCannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specFailed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Forward positioning operation on archive failedReverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocksget_physUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again ar_nextcould not pipecould not fork-c-dccould not exec$OpenBSD: ar_subs.c,v 1.25 2003/06/26 00:10:17 deraadt Exp $listCannot chdir to %sCan't fchdir to starting directoryextractUnable to open %s to readCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. appendarchivedirectory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %scopyPremature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot identify format. Searching...Sorry, unable to determine archive format.$OpenBSD: buf_subs.c,v 1.17 2003/06/02 23:32:08 millert Exp $Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableWrite block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Unable to append when there are archive read errors.Archive read error limit (%d) reachedRead fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archiveUnable to obtain block size for file %sActual crc does not match expected crc %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sUser specified archive volume byte limit reached.$OpenBSD: cache.c,v 1.15 2003/08/08 01:39:52 millert Exp $Unable to allocate memory for user id cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group name cache table%lu$OpenBSD: cpio.c,v 1.16 2003/06/26 00:10:17 deraadt Exp $TRAILER!!!cpio_endwrCpio file name length %d is out of rangeCpio file name in header is corruptedCpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt070707File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %scpio_wr070701070702File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %svcpio_wrFile is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sbcpio_wr$OpenBSD: file_subs.c,v 1.24 2003/08/06 21:08:05 millert Exp $Unable to create %sUnable to close file descriptor on %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to copy %s, file would overwrite itselfUnable to link file %s to itselfUnable to remove %sCould not link to %s from %starcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)node_creatUnable to remove directory %sCould not unlink %sUnable to obtain file stats %sAccess/modification time set failed on: %spaxUnable to set file uid/gid of %sCould not set permissions on %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryFailed write to file %sFailed seek on file %sFile changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %sset_crc$OpenBSD: ftree.c,v 1.23 2003/06/13 17:51:14 millert Exp $Unable to allocate memory for file name bufferInvalid file name argumentUnable to allocate memory for filenameWARNING! These file names were not selected:%s Can't fchdir to starting directoryCan't chdir to %sFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %s$OpenBSD: gen_subs.c,v 1.17 2003/06/13 17:51:14 millert Exp $%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => ls_list%s%s %s ls_tty$OpenBSD: getoldopt.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $%s: unknown option %c %s: %c argument missing $OpenBSD: options.c,v 1.59 2003/06/26 00:10:17 deraadt Exp $ustartarsv4crcsv4cpiocpiobcpiopaxab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZ0Invalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedb:cef:hmopqruts:vwxzBC:HI:LOPXZ014578write_opt=nodirUnable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-I-rUnable to open file '%s' for readProblem with file '%s'-CTAPE/%sabcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdin%s: Invalid combination of options: -%cThese format options are not supported %s = %s Invalid option nameInvalid options formatusage: pax [-cdnvzO] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDOYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLOPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLOPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list $OpenBSD: pat_rep.c,v 1.25 2003/06/02 23:32:08 millert Exp $Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %srep_addEmpty pattern stringUnable to allocate memory for pattern stringWARNING! These patterns were not matched:%s Pattern select out of memoryPattern list inconsistentRemoving leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s tty_renameFile name %s/%s, too longReplacement name error %sReplacement name too long %s >> %s%s >> %s >> %s rep_name@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: pax.c,v 1.24 2003/06/13 17:51:14 millert Exp $.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appendingCpu time limit reached, cleaning up.Signal caught, cleaning up.LC_TIMEUnable to set up signal maskUnable to set up signal handler$OpenBSD: sel_subs.c,v 1.16 2003/06/02 23:32:09 millert Exp $Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryUnable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]$OpenBSD: tables.c,v 1.21 2003/08/16 17:31:55 deraadt Exp $Cannot allocate memory for hard link tableHard link table out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memorychk_ftimeCannot allocate memory for interactive rename tableNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryCannot allocate memory for device mapping tableDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedCannot allocate space for directory access time tableDirectory access time reset table ran out of memoryUnable to create temporary file for directory times: %sUnable to store mode and times for directory: %sUnable to store mode and times for created directory: %sUnable to set mode and times for created directoriesproc_dir$OpenBSD: tar.c,v 1.31 2003/06/26 00:10:18 deraadt Exp $ustarwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %star_wrUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %sustar_wr$OpenBSD: tty_subs.c,v 1.12 2003/06/02 23:32:09 millert Exp $/dev/ttywrFatal error, cannot open %s%s: : %ssocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommainA??zG{A.ping: sendtoping: wrote %s %d chars, ret=%d pingerpacket too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %x --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1lf%% packet loss round-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms summary@YEcho Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x%s (%s)TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0xusage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-T tos] [-t ttl] [-w maxwait] host benstuvusage: %s [-benstuv] [-] [file ...] stdoutstdin-r%s%6d buffer@(#) Copyright (c) 1983, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ifconfig.c,v 1.78 2003/07/30 01:42:47 pvalchev Exp $"^P5"^H5"^85L"^(5L"^ 5"^5"^5"^5"^4"]4"]4"]4H"]9"]9"]>"]>"]>"]A"]A"]A"]4l"]x4"]hW"]`6"]P6"]@6"]06"](6"] 6"]7"]p"]q0"\s"\t"\b"\b"\b"\b"\7b"\u"\vt"\w`"\2P"\2P"\x4 "\p5"\h5"\` 5"\X5"\P@5"\H5"\@HT"\0H"\ I4"\I"\I15dinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0deletetunneltunnelgiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangeeui64vltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownup"_xTixj< i@ix x P"_p]m4n< ixix (xl"_h^ o i@ix x "_``rL i@ix x "_Xclr i@ix x "_Pfs0itixx Pisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRmainsocketSIOCGIFFLAGSSIOCGIFMETRICgetifaddrs%s: no such interface error in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRsettunnelSIOCDIFPHYADDRNote: trailers are no longer sent, but always received SIOCSIFFLAGSsetifflagsinvalid %s%s not allowed for the AFinterface index is already filledcould not determine link local address%s: invalid metricSIOCSIFMETRIC%s: invalid mtuSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too long"%.*s"%.*s0x%02xSIOCS80211NWIDsetifnwidpersistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYsetifnwkeySIOCG80211POWERSIOCS80211POWERsetifpowersavesetifpowersavesleep nwid nwkey %d: powersave on (%dms sleep) offieee80211_statusSGIOCGIFMEDIA%s: no link type?init_current_mediaSIOCSIFMEDIAonly one `media' command may be issuedmay not issue `media' after `mediaopt' commandsonly one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'only one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s "fh "f`@"fP@"fH`"f@"f0IEEE802.11FDDItokenTokenRingetherEthernet"k "k"k"k#"k#"j#"j#"j$"j$"j$"j$"j%"j%"j%"j%"j&"j&"jx'"jh'"j`("jP("jH)"j8)"j0*"j *"j+"j+"j,"i,"i,"i-"i-"i-"i."i."i/"i/"i0"i0"ix0"ih0"i`1"iP1"iHC"i8C"i0D"i D"iE"iE"iF"hF"hc"hc"hd"hd"he"je"h"h"h"h"h"h"hDS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000T1000baseT1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect"l"l "l "l"l"l"l"l"l"l@"lp@"lh@"lX@"lP@"l@@"l8`"l(`"l "l"l"l"k"kmonitoribss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexunknown %s media subtype: %sstrdupunknown %s media option: %s%s %s%smedia %smediaopt instance %d6 physical address inet%s %s --> %s phys_status "n"n`"nx"nh@"nx"nh"nX"nno networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %lu mtu %lu address: %s %s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: status inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %sin_status inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime in6_aliasSIOCGIFADDR AppleTalk %d.%d range %d-%d phase %d--> %d.%d broadcast %d.%dat_status ns %s ipx %s SNAPframe %s SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOiso_status%s: bad value%s=%o%s=%x%s: %sAppleTalk does not use netmasks%u.%u%s: illegal address%hu-%hu%s: illegal net range: %u-%u12%s: illegal phase atalk %d.%d range %d-%d phase %d AppleTalk address is not in rangeAttempt to set XNS netmask will be ineffectual Attempt to set IPX netmask will be ineffectual negative NSEL length is absurdsetting NSEL length valid only for isousage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [ media media_type ] [ mediaopt media_option ] [ metric n ] [ mtu n ] [ nwid network_id ] [ nwkey network_key | -nwkey ] [ powersave | -powersave ] [ powersavesleep duration ] [ [af] tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ anycast | -anycast ] [ deprecated | -deprecated ] [ tentative | -tentative ] [ pltime n ] [ vltime n ] [ eui64 ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] vlan: %d parent interface: %s vlan_statusSIOCGETVLANSIOCSETVLANsetvlantagmust specify both vlan tag and devicesetvlandevunsetvlandev%dd%dh%dm%ds%luCOLUMNS1ACFLRSTWacdfghiklmnopqrstux %s: %s: %s: directory causes a cycle%s: %sfts_read%u-%lu%qudisplaytotal %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd printlongtotal %llu %s%s/%s ls: %s: %s -> printlink%*s usage: %s [-1ACFLRSTWacdfhiklmnopqrstux] [file ...] sumo:12illegal argument to -o option%sstdincksumusage: cksum [-o 1 | 2] [file ...] usage: %s [file ...]  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@crc%lu %lu %s csum1csum2LESSSECUREmore-E-G-L-mMORELESS--WARNING: terminal is not fully functionalCannot allocate memoryraw_modeLESS_TERMCAP_ltget_envLINESliCOLUMNScokrklkukdkPkNkh@7kDTERMunknownhcamxndadbutsgpcksketitececdcl cmsoseusuemdmembvbbsbcho|^ll alsrget_termNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek errorread error%sch_ungetchar overrunseek error to 0%cESC^%c*s<%X>Non-match First-file EOF-ignore Keep-pos Regex-off /?_-(P)+! [Press space to continue, 'q' to quit.]less %sungetcc overflowPattern not found:%s helpCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some commands disabledWarning: some edit commands disabledWarning: environment variables from lesskey file unavailableeditchar-%s"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPE\LESSMETACHARS; *? '"()<>|&^`#\%c%s%c%s%s%s/HOMEbin_fileSHELLr%s %s %s%s LESSOPEN-LESSCLOSE-c...skipping... Cannot find help fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nDetermining length of fileDon't know length of fileCannot seek to that file positionLESSANSIENDCHARSm%*s plinenum~ Calculating line numbers! /dev/ttySHELL%s %s %ssh (press RETURN)Invalid mark letterCannot seek to end of fileMark not setMark not in current filelLine number is required after -l/%sless Copyright (C) 2002 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less Tab stops ,%d and then every %d spacesopt_x-" must be followed by 1 or 2 charsquotes %sUse "h" for help%s is an ambiguous abbreviation ("less --help" for help)There is no %s option ("less --help" for help)There is no %s optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sValue is required after %sNumber is required after %sfakeDon't use keypad modeUse keypad modeHorizontal shift %d positionsHorizontal shift: Show tildes after end of fileDon't show tildes after end of filequotes: Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminal0123456789,Tab stops: Highlight first unread line after any forward movementHighlight first unread line after forward-screenDon't highlight first unread linePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modeChop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters directly, processing ANSI sequencesDisplay control characters directlyDisplay control characters as ^XNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptUse the LESSOPEN filterDon't use the LESSOPEN filterDisplay a status columnDon't display a status columnPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesQuit if end-of-file on first screenDon't quit if end-of-file on first screenOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileAssume dumb terminalAssume intelligent terminalRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffersMax buffer space per file: %dKMax buffer space per file (K): Search skips displayed screenSearch includes displayed screenBe less helpful in promptsBe helpful in prompts%s: %spostoalinenumtoainttoaiprint_intiprint_linenum?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%t?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for dataap_posap_linenumap_int?-fileNo previous regular expressionInvalid patternPlease re-enter search patternNothing to searchLine numbers turned off/dev/tty"P"@"8"0"(" """" """"""" "@""""" "x@"pacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %srealpath %snfs%s: Filesystem not supported by kernel%smainhostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %susage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node,-o %s: option not supportedbin_file(standard input)(fd %d)%sinvalid file typeusage: %s [-[AB] num] [-CEFGHILPRSUVabchilnoqsvwx] [-e pattern] [-f file] [file ...] 0123456789A:B:CEFGHILPSRUVabce:f:hilnoqrsuvwxyunix-byte-offsetsline-regexpword-regexprevert-matchno-messagesrecursivesilentquietline-numberfiles-with-matchesfiles-without-matchignore-caseno-filenamefileregexpcountbyte-offsettextversionbinarybasic-regexpfixed-stringsextended-regexpdevicescontextbefore-contextafter-contextmmaphelpbinary-filesr%scontext out of rangegrep version %u.%u without-matchUnknown binary-files option%s: %s(standard input)r%s%s:%u %s Binary file %s matches -- mallocreallocstrdup%d%luaFfh:t:vonly one -t option may be specified.nfs/%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCumountfsgetmntinfoempty type listusage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]mkfifom:invalid file mode.node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%susage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p _block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrapnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x %s: devread: lseek%s: devread: readstatfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block@(#) Copyright (c) 1983, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: route.c,v 1.60 2003/08/26 08:33:12 itojun Exp $route: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. route: %s: %s nqdtv/dev/nullsocketmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done defaultinvalidiso %s(%d) %sroutenameaf %d: %snetname0%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 64128inet6_makenetandmaskInternal Error%s: bad value %s: resolved to multiple values route: %s: bad value prefixlen is not supported with af %d *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sns_print*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sactual retrieval of interface tablegot message of size %d on %smonitoruwriting to routing socketroute: read from routing socket: %s RTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %ld, seq %d, errno %d, flags: route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: locks: inits: sockaddrs: %s%s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; sodump$OpenBSD: show.c,v 1.26 2003/08/26 08:33:12 itojun Exp $UGHRBD M@dmCXLS1@2 3croute-sysctl-estimateout of space sysctl of routing tableRouting tables %-*.*s %-*.*s %-6.6s DestinationGatewayFlags%-6.6s InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s p_sockaddrp_flagsxresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %sinternal error: unknown type %d.typeWe only support %s mode, sorry. We only support %s format, sorry. We only support %s structure, sorry. local-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPElocal-filesusage: %s local-files Continue withmput%s: not foundmputr+wwusage: %s remote-file [ local-file ] local: %sRETRgetitremote-filesusage: %s remote-files mgetmgetonoffConnected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s usage: %s [ on | off ] %s %s. Bell modeEPSV/EPRT on IPv4Packet tracingusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). Verbose modeUse of PORT/LPRT cmdsProgress barInteractive modeusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. GlobbingPreserve modification timesusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). remote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %susage: %s local-directory Local directory now %s getcwd: %slcdusage: %s remote-file DELE %smdeletefrom-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s-usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:usage: %s remote-files local-file SHELL/bin/shsh-c%sTry again latershellusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. userPWDPWD command not recognized, trying XPWD. XPWDLocal directory %s getcwdlpwddirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %sRMD %sRMD command not recognized, trying XRMD. XRMD %scommand line to sendusage: %s line-to-send arguments to SITE commandSITEquote1modefile-nameusage: %s mode file-name SITE CHMOD %s %sSITE UMASKSITE UMASK %sSITE IDLESITE IDLE %sHELPHELP %sQUITusage: %s [password] Account:commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. Case mappingCarriage Return strippingNtrans off. Nmap off. mapoutusage: %s [mapin mapout] nmap: unbalanced brackets. Passive modeStore uniqueReceive uniqueCDUPCDUP command not recognized, trying XCUP. XCUPrestart: offset not specified. restart: invalid offset. Restarting at %lld. Execute get, put or append to initiate transfer SYSTLimit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. filenameusage: %s filename %s %lld %s %sSTAT %sSTATLocal file "%s" is newer than remote file "%s". PAGERmore|%sCan't allocate memory for $PAGER?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. domacroExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sCan't allocate memory for transfer bufferWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %s(unknown)Trying %s... socketconnect%sr+Requesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Writing HTTP requestReceiving HTTP replyreceived '%s' 301302200Error retrieving file: %sContent-Length: Location: Redirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %surl_get http fetch aborted. file fetch aborted. ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetauto_fetchCan't allocate memory for URL decoding:/unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socket(unknown)connect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopthookup---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT%c%c%c421 Service not available, remote server has closed connection. %s:getreply send aborted waiting for remote to finish abort. sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetoutsendrequest receive aborted waiting for remote to finish abort. receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %suse of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)bindlistenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dinitconnacceptdataconnSTOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s abortresetrunique: can't find unique file name. Lost control connection for abort.%cABOR abort_remoteftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssu46Aadegimno:pP:r:tvV--r requires numeric argumentRetrying... mainftp> sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. !$%sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s usage: %s [-AVadegimnptv46] [-o output] [-P port] [-r ] [host [port]] %s host:[/path/]file[/] %s ftp://[user:password@]host[:port]/file[/] %s http://host[:port]/file macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %sruserpassstringlistAlready connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. anonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$initftp_loginsorry, arguments too long. (%s) TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.remglob%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! confirm%s: not foundSIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. KMGTP %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAprogressmeterA.%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d ptransferA.>?P/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pid-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITalias_%sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]ARPCHECKcheck_DHCPACK from %spacket_to_lease failed.REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.BOOTREPLY from %s rejected.DHCPOFFERDHCPNACKDHCPACK%s from %s rejected.BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSENDdhcpoffer: no memory to record lease.dhcpoffer: no memory for option %dInvalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.DHCPNAK from %sDHCPNAK with no active lease. No valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %dNo DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAILEXPIREDHCPREQUEST on %s to %s port %dsend_requestDHCPDECLINE on %s to %s port %dDHCPRELEASE on %s to %s port %dwcan't create %s: %mlease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_init:n no memory for environment initializationinterfacemediumreasonip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiryscript_write_paramsREASON=NBIfork: %mwait: %mexecve (%s, ...): %mscript_goscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%sCan't fork daemon: %mCan't create %s: %mCan't fdopen %s: %m%ld Invalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%xoption_as_string: bad code %d \%03odhcp option too largerno memory for client state.no memory for client config.Corrupt lease file - possible data loss!hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal dataexpected option name.%s: unexpected option name.%s: too many options.expecting semicolon.expecting interface name (in quotes).expecting left brace.unterminated interface declaration.Insufficient memory to record interface %sno memory for state on %s no memory for config for %s no memory for lease. unterminated lease declaration.expecting lease declaration.expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.parse_option_declExpecting media options.parse tmpno memory for string list entry.expecting IP address.no memory for reject list!parse_reject_statementNo memory for %s.dfree %s: free on null pointer.unable to allocate tree cache for %s.Can't create addrlist socketgetifaddrs faileddiscover_interfacesInsufficient memory to %s %srecord interfaceno space to remember ifp.Multiple %s %s: %s %sinterfaces match thesame subnetInterface %s matches %smultiple shared networkssame shared network%s: not foundNo subnet declaration for %s (%s).Please write a subnet declaration in your %sdhcpd.conf file for thenetwork segment to which interface %s %sis attached.discover_interfacesInsufficient memory to record fallback interface.fallbackparse_statementNo memory for shared subnetfallback-netCan't allocate poll structures.No live interfaces to poll on - exiting.poll: %mreceive_packet failed on %s: %sInterface %s no longer appears valid.got_oneioctl(SIOCGIFFLAGS) on %s: %mioctl(SIOCGIFMEDIA) on %s: %minterface_statuslocate_networkCan't allocate timeout structure!can't allocate protocol struct for %snew_hashadd_hashCan't add %s to hash table.delete_hash_entryfind_host_for_networkNo shared network for network %s (%s)Address range %s to %s, netmask %s spans %s!multiple subnetsAddress range %s to %s not on net %s/%s!new_address_rangeNo memory for address range %s-%s.No hostname for %sno memory for hostname %s.new_address_range%ssubnet %s/%d conflicts with subnet %s/%dWarning: subnet_inner_thanenter_leaseNo memory for lease %s Lease conflict at %scorrupt lease uid.Released lease for IP address %srelease_leaseAbandoning IP address %s for %d seconds: %sabandon_leaseadd_class%s: can't allocate new groupCan't rewrite lease databaseCan't commit leases to new database: %mSubnets: Subnet %s netmask %sShared networks: %s Last Lease:%02x Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s print_leasepacket length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02x:%02x:%02x:%02x:%02x:%02xfilename = %sserver_name = %s %s = %s%s%03x: %02xdump_rawhash bucket %d:/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %mif_register_bpfSending on BPF/%s/%s%s%s/Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%sfallbacksend_packet: %msend_packetattempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %mattempt to use ICMP protocol before initialization.icmp_echorequest %s: %micmp_echorequesticmp_echoreply: %micmp_echoreplycScoption %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.cons_optionspretty_print_option: bad code %d %s: Excess information in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array\%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largepretty_print_optionDiscarding packet with invalid hlen.do_packetdo_packetconsno memory for cons.tree_cachetree_host_lookupNo memory for host lookup tree node.enter_dns_hostCan't allocate space for new host.tree_constNo memory for constant data tree node.tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.tree_limittree_evaluateBad node id in tree: %d.%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookupeof in string constantstring constant larger than internal buffernumeric token larger than internal buffertoken larger than internal bufferlways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class%s exiting.exiting. %s line %d: %s%s^^ subnet_numberip_addrbroadcast_addrhost_addr%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packetsCan't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %mif_register_socketSending on Socket/%s%s%s/send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.fallback_discard: %mfallback_discardeoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.semicolon expected.filename must be a stringno memory for string %s.expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.expecting a network hardware typehardware address too longexpecting semicolon.Expecting numeric lease timecan't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.Bogus number: %s.Bogus number: %s: digit %d not in base %dvalue %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %dnumeric day of week expected.numeric year expected.expected slash seperating year from month.numeric month expected.expected slash seperating month from day.numeric day of month expected.numeric hour expected.expected colon seperating hour from minute.numeric minute expected.#6#6#6#6#6#6#6#6#6#6#6#6 #6x@#6p#6h#6`#6X#6Psoftdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:realpath %sffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernelfilesystem must be mounted read-only; you may need to run fsck%s on %s: %smainusage: mount_ffs [-o options] special node ,-o %s: option not supportedhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainusage: %s [-dlnpq] cannot seek temp fileout of memorycannot read temp fileline too longcannot write temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp filecannot close temp fileEnter key: get_keywordbad hex digit in keybad binary digit in keydes_setkeydes_cipherdecryption failed (block corrupted)decryption failed (incomplete block)cannot read filecbc_decodeinvalid pattern delimiter p unexpected end-of-file& no previous commandout of memoryrcannot open input filecannot close input file%lu newline inserted newline appended out of memorycannot read input filewcannot open output filecannot close output filecannot write fileunexpected end-of-filestdincannot read stdin%d \  \abfnrtv\@(#) Copyright (c) 1993 Andrew Moore, Talke Studio. All rights reserved. *usage: %s [-] [-sx] [-p string] [name] HOMEp:sx ? interrupt? invalid filename%s warning: file modifiedscript, line %d: %s unexpected end-of-filenumber out of rangeinvalid addressinvalid command suffixunexpected addressunexpected command suffixno current filenameinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioninvalid pattern delimiteraw%d ! unknown commandno matchfilename too longout of memoryshell access restrictedno previous command invalid mark charactered.hup/ed.huphandle_hup..invalid pattern delimiterno previous patternout of memoryunbalanced brackets ([])trailing backslash (\)number out of rangeno previous substitutionout of memoryno matchinfinite substitution loop out of memorynothing to undoHLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too long%s%s: %s%s: directory causes a cycle..%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).fts_read%soverwrite %s? readlink: %sunlink: %ssymlink: %scopy_linkmkfifo: %smknod: %sutimes: %schown: %schflags: %slchown: %susage: %s [-R [-H | -L | -P]] [-fip] src target %s [-R [-H | -L | -P]] [-fip] src1 ... srcN directory @(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1997-2002 Michael Shalayeff $OpenBSD: main.c,v 1.47 2003/09/05 21:03:36 henning Exp $#EP#EH#E@ڄ d.gzdeflatezcatzipcompressunknown program nameGZIP GZIP is too long123456789ab:cdfghlLnNOo:qrS:tvVoption -a is ignored on this systemillegal bit count -- %s-o argument is too long%s %s %s /dev/stdin-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored%s%s%s: %s%s not a regular file%s: unchanged%s already has %s suffix -- unchanged/dev/stdout%s: unknown suffix: ignored%s%s: name too long%s: input: %soutput: %smain%s%s: won't write compressed data to terminalwfile would grow; left unmodified compress%s: won't read compressed data from terminal%s: unrecognized file formatrcrc errordecompressutimes: %schown: %schflags: %soverwrite %s? .-_taztgzzgzZmethod crc date time compressed uncompr. ratio uncompressed_name%.5s %08x %s %9lld %9lld %4.1f%% %s %9lld %9lld %4.1f%% (totals) @YOK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out @Yusage: %s [-cdfghOqrtvV] [-b bits] [-S suffix] [-[1-9]] [file ...] $OpenBSD: gzopen.c,v 1.14 2003/07/17 20:17:02 mickey Exp $1.1.4put_headerHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %sinvalid file mode: %s%s: %s%sfts_read%s: invalid user name%s: invalid group nameusage: %s [-R [-H | -L | -P]] %s file ... modeflagsusage: %s [-R [-H | -L | -P]] [-f] [-h] %s file ... [owner][:group]group$OpenBSD: dir.c,v 1.16 2003/08/25 23:28:15 tedu Exp $lost+foundwrong type to dirscan %d dirscanDIRECTORY CORRUPTED%s NAME=%s %s=%s DIRFILEfileerrorUNREFLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED) ADJUSTmkentryUNREF %s (RECONNECTED) RECONNECTNO lost+found DIRECTORYCREATE (CREATED) SORRY. CANNOT CREATE lost+found DIRECTORY lost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORY..DIR I=%u CONNECTED. PARENT WAS I=%u linkupmakeentryNO SPACE LEFT IN %s (EXPANDED) EXPANDexpanddir$OpenBSD: inode.c,v 1.24 2003/08/25 23:28:15 tedu Exp $DIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDS ckinodePARTIALLY TRUNCATED INODE I=%uiblockblk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > sblock.fs_fpg %d bad inode number %d to ginode bad inode number %d to nextinode Cannot allocate space for inode buffer cannot allocate memory for inode cachecannot increase directory listcannot find inode %d %s %sDIRFILECLEAR (CLEARED) I=%u OWNER=%s %u MODE=%o %s: SIZE=%llu MTIME=%12.12s %4.4s %d %s I=%u BAD STATE %d TO BLKERRCG %d: BAD MAGIC NUMBER @(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.25 2003/06/02 20:06:15 millert Exp $dfpnNyYb:c:l:m:numberAlternate super block location: %d conversion levelmodebad mode to -m: %o ** lost+found creation mode %o usage: %s -p [-f] [-m mode] %s [-f] [-b block#] [-c level] [-y] [-n] [-m mode] [filesystem] ... -%c flag requires a %s ufsffsrwrostarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system ** Phase 1 - Check Blocks and Sizes INTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS ** Phase 2 - Check Pathnames ** Phase 3 - Check Connectivity ** Phase 4 - Check Reference Counts ** Phase 5 - Check Cyl groups %d files, %d used, %d free (%d frags, %d blocks, %d.%d%% fragmentation) %d files missing %d blocks missing The following duplicate blocks remain: %d, The following zero link count inodes remain: %u, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** / ***** REBOOT NOW ***** checkfilesys$OpenBSD: pass1.c,v 1.14 2003/08/25 23:28:15 tedu Exp $phase 1, inode %d/%dPARTIALLY ALLOCATED INODE I=%uCLEARbad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:cannot read symlinkconvert symlink %d(%s) of size %llu bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWCONTINUE%sINCORRECT BLOCK COUNT I=%u (%d should be %d) (CORRECTED) CORRECTUNKNOWN FILE TYPE I=%ucheckinodeBADEXCESSIVE BAD BLKS I=%u (SKIPPING) DUPEXCESSIVE DUP BLKS I=%uDUP TABLE OVERFLOW.$OpenBSD: pass1b.c,v 1.9 2003/08/25 23:28:15 tedu Exp $phase 1b, inode %d/%dDUP$OpenBSD: pass2.c,v 1.18 2003/08/25 23:28:15 tedu Exp $phase 2, directory %d/%dphase 2, parent directory %d/%dROOT INODE UNALLOCATEDALLOCATE%sCANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEREALLOCATECONTINUEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODEDIRECTORY TOO SHORT%s %s: LENGTH %ld NOT MULTIPLE of %dDIRECTORY%s %s: LENGTH %ld NOT MULTIPLE OF %d (ADJUSTED) ADJUSTMISSING '..'..BAD INODE NUMBER FOR '..'pass2.BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEBAD WHITEOUT ENTRYUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (REMOVED) BAD TYPE VALUEBAD STATE %d FOR INODE I=%dpass2check$OpenBSD: pass3.c,v 1.8 2003/06/02 20:06:15 millert Exp $phase 3, directory %d/%ld$OpenBSD: pass4.c,v 1.9 2003/08/25 23:28:15 tedu Exp $phase 4, inode %d/%dUNREFZERO LENGTHBAD/DUPBAD STATE %d FOR INODE I=%d$OpenBSD: pass5.c,v 1.16 2003/06/02 20:06:15 millert Exp $phase 5, cg %d/%dDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATEXPANDCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d CG %d: BAD MAGIC NUMBER BAD STATE %d FOR INODE I=%ldFREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSpass5$OpenBSD: fsutil.c,v 1.12 2003/07/29 18:38:35 deraadt Exp $%s: %s: UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. %s (%s)/r/Can't stat root Can't stat %s %s is not a character device malloc failedrealloc failedstrdup failed$OpenBSD: setup.c,v 1.20 2003/06/26 08:01:54 tedu Exp $RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsCan't stat %s: %s %s is not a character deviceCONTINUECan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE) cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ffs(8).USING ALTERNATE SUPERBLOCK AT %d clean = %d %sile system is clean; not checking f** F** File system is already clean UNDEFINED OPTIMIZATION IN SUPERBLOCKSET TO DEFAULTIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE INTERLEAVE=%d IN SUPERBLOCK (FIXED) IMPOSSIBLE NPSECT=%d IN SUPERBLOCKINCORRECT BMASK=%x IN SUPERBLOCKFIXINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKCONVERTING TO NEW INODE FORMAT CONVERT TO NEW INODE FORMATCONVERTING TO NEW CYLINDER GROUP FORMAT CONVERT TO NEW CYLINDER GROUP FORMATcannot alloc %u bytes for cylinder group summary area BAD SUMMARY INFORMATION%scannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %lu bytes for lncntp cannot alloc %lu bytes for inphead setupMAGIC NUMBER WRONGNCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSIZE PREPOSTEROUSLY LARGEsuperblock mismatches offset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATE%s: BAD SUPER BLOCK: %s %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A BSD FILE SYSTEM (%s) ioctl (GCINFO): %s %s: can't read disk label $OpenBSD: utilities.c,v 1.20 2003/08/25 23:28:15 tedu Exp $bad file type 0%o INTERNAL ERROR: GOT TO reply()CONTINUE %s? no %s? yes %s? [yn] cannot allocate buffer pool deadlocked buffer pool WRITING %sZERO'ED BLOCK %d TO DISK PARTIALLY CANNOT %s: BLK %dProgram terminated UPDATE STANDARD SUPERBLOCKPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) SEEKREADTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld), %ld,WRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN:CG %d: BAD MAGIC NUMBER /?..returning to single-user after filesystem check catchquit%s (SALVAGED) SALVAGEUNKNOWN INODESC FIX MODE %d /dev/tty: catchinfoffs_isblockffs_clrblockffs_setblockffs_isfreeblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@init: %s init: already running initinitial setsid() failed: %mrootsetlogin() failed: %msfunrecognized flag '-%c'ignoring excess argumentsfatal signal: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %scan't open %s: %mcan't get %s for controlling terminal: %m/bin/sh-sh/dev/consolePATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartingsingle_usersh/etc/rcautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode~rebootsession database close: %ssession database open: %sinsert %d: %sdelete %d: %s %s%s/dev/%s %scan't parse getty for port %scan't parse window for port %scan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %m01getty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %mport %s changed utmp index from %d to %d shutdowncan't exec %s for %s %s: %msome processes would not die; ps axl advised ,-o %s: option not supportedupdateasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotamfsinsane maxpartitions value %dT:a:b:c:d:e:f:i:m:o:s:NOS:T:a:b:c:d:e:f:g:h:i:k:l:m:n:o:p:qr:s:t:u:x:z:%s: bad sector size%s: bad maximum contiguous blocks %s: bad block size%s: bad cylinders/group%s: bad rotational delay %s: bad blocks per file in a cylinder group %s: bad fragment size%s: bad average file size%s: bad average files per dir%s: bad bytes per inode %s: bad track skew%s: bad interleave%s: bad free space %% %s: bad rotational layout count spacetime%s: unknown optimization preference: use `space' or `time'.%s: bad spare sectors per track%s: bad revolutions/minute %s: bad file system size%s: bad total tracksffs%s: bad sectors/track%s: bad spare sectors per cylindernewfs_%s%s/newfs_%s/sbin/usr/sbin%s not foundswap%sr%s/dev/%s%s%s: %s%s: getmntinfo: %s%s is mounted on %s%s: unknown disk type%s: %s: not a character-special device %s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s: maximum file system size on the `%c' partition is %d%s: no default #tracks%s: no default #sectors/track%s: no default sector sizeWarning: changing optimization to space because minfree is less than %d%% %s (%d) %s (%lu) Warning: calculated sectors per cylinderdisagrees with disk labelNumber of cylinders restricts cylinders per group to %d. mfs:%dstatfs %swaitpid%s: mount: %sabnormal termination/mainioctl (GDINFO)ioctl (WDINFO)%s: can't rewrite disk label-z tracks/cylinder-x spare sectors per cylinder-u sectors/track-t file system type-s file system size (sectors)-r revolutions/minute-p spare sectors per track-o optimization preference (`space' or `time')-n number of distinguished rotational positions-m minimum free space %%-l hardware sector interleave-k sector 0 skew, per track-i number of bytes per inode-h average files per directory-g average file size-f frag size-e maximum blocks per file in a cylinder group-d rotational delay between contiguous blocks-c cylinders/group-b block size-a maximum contiguous blocks-T disktype-S sector size-O create a 4.3BSD format filesystem-N do not create file system, just print out parametersusage: %s [ -fsoptions ] special-device mount-point usage: %s [ -fsoptions ] special-device where fsoptions are: %s buffer malloc failed preposterous size %d preposterous ntrak %d preposterous nsect %d illegal expected average file size %d illegal expected number of files per directory %d block size must be a power of 2, not %d fragment size must be a power of 2, not %d fragment size %d is too small, minimum is %d block size %d is too small, minimum is %d block size (%d) cannot be smaller than fragment size (%d) fragment size %d is too small, minimum with block size %d is %d There is no block size that can support this disk With a block size of %d %s %ld minimum bytes per inode isMinimum bytes per inode is %ld With %d bytes per inode, minimum cylinders per group is %ld With %d sectors per cylinder, %s to be changed from %d to %d This requires the block size %s to be changed from %d to %d and the fragment size%s groups must have a multiple of %ld cylinders CylinderWarning: cylinderpanic (fs_cpg * fs_spc) %% NSPF != 0cylinder groups must have at least %ld cylinders Block size and bytes per inode restrictBlock size restrictsBytes per inode restrict cylinders per group to %d. file systems must have at least one cylinder %s %s %d %s %d.%sWarning: insufficient space in super block for rotational layout tables with nsectand ntrak File system performance may be impaired. inode blocks/cyl group (%ld) >= data blocks (%d) number of cylinders per cylinder group (%d) %s. must be increasedFilesystem must have at least %d sectors Warning: inode blocks/cyl group (%ld) >= data blocks (%ld) in last cylinder group. This implies %ld sector(s) cannot be allocated. Warning: %d sector(s) in last cylinder unallocated cg summary malloc failed %s: %d sectors in %d %s of %d tracks, %d sectors cylinders %.1fMB in %d cyl groups (%d c/g, %.2fMB/g, %d i/g) super-block backups (for fsck -b #) at: %ld, %smkfs>Panic: cylinder group too big cg 0: bad magic number first cylinder group ran out of space internal error: can't find block in cyl 0 fsinit: inode value out of range (%d). read error: %d rdfswrite error: %d wtfsisblock bad fs_frag %d clrblock bad fs_frag %d setblock bad fs_frag %d COLUMNSdfiPRrW%s: %s%sfts_read%s: is a directory%s (inode %u): not overwritten due to multiple linksmallocrm_overwriteremove %s? override %s%s%s/%s for %s? check"." and ".." may not be removedusage: %s [-dfiPRrW] file ... weofretensionstatusrewofflrewindofflinefsrfsferaseeomeofdensitybsrbsfblocksizeejectTAPE/dev/rst0f:%s: unknown command%s%s: illegal count%s: %sioctl MTIOCGET76543210WriteProtectMountedSCSI%d: unknown tape drive type %s tape drive, residual=%d ds erblocksize: %d (%d, %d, %d, %d) density: %d (%d, %d, %d, %d) %s=%o%s=%xusage: %s [-f] device usage: %s [-f device] command [ count ] Lost connection to remote host.shelltcpshell/tcp: unknown servicewho are you?/etc/rmtinvalid user name: %sO%s %d rmtopencloseC statusS I%d %d ioctlrmtioctl%s: %sProtocol to remote tape server botched (code "%s").rmtreplyProtocol to remote tape server botched.(rmtgets got "%s").m:pinvalid file mode: %s%s/%s: %susage: %s [-p] [-m mode] dirname ... $OpenBSD: compile.c,v 1.15 2003/06/10 22:20:50 deraadt Exp $unexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw command%s: %sread commandbranchlabelempty labelsubstitute pattern can not be delimited by newline or backslashunterminated substitute patternextra text at the end of a transform command\ can not be used as a string delimiternewline can not be used as a string delimiterunbalanced brackets ([])RE error: %scompile_re123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsno wfile specifiedbad flag in substitute command: '%c'compile_flagstransform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthcompile_trcompile_textunterminated regular expressionexpected context addresswhitespace after %sundefined label '%s'duplicate label '%s'unused label '%s'$OpenBSD: main.c,v 1.9 2003/06/10 22:20:50 deraadt Exp $ae:f:nusage: sed script [-an] [file ...] sed [-an] [-e script] ... [-f script_file] ... [file ...] stdout: %sr%s: %s"%s" ..."stdin$OpenBSD: misc.c,v 1.5 2003/06/03 02:56:16 millert Exp $%ssed: %lu: %s: $OpenBSD: process.c,v 1.11 2003/06/10 22:20:51 deraadt Exp $%s %s: %s%lu \%d not defined in the RErstdout: %sflush_appendsCOLUMNS\ \ \abfnrtv%03ofirst RE may not be emptyRE error: %sunable to allocate memoryLPrestricted shell - can't cdPWDOLDPWDHOMEno home directory (HOME not set)-no OLDPWDdon't know current directorybad substitutiontoo many argumentsCDPATH%s: bad directory%s - %s%s can't get current directory - %sRnprsu,ne-p: %s-u: %s: %spvpvV%s is a reserved word is an %salias for exported alias %s= is an exported traced undefined (autoload from %s) function is a%s shell builtin special is a tracked %salias for not found%s is *GOK*L#R#UZ#fi#lprtuxponly -t, -u and -x options may be used with -ffunction %s %T %s() %T %s: not identifiertypeset -i -x -r -t -L%d -R%d -Z -l -u -U %s exportreadonly%s[%d]=dprtUx##-taunaliasalias: -r flag can only be used with -t and without arguments alias %s alias not found adtno argumentslpnzbgjob control not enabled%%%*d %*s %s%*d %*d %sbad signal `%s'--ls:Usage: kill [ -s signame | -signum | -signame ] {pid|job}... kill -l [exit_status] %d %s%s%s: arguments must be jobs or process ids%s: %smissing options argumentmissing name argument%s: is not an identifierc_getopts: no argvarguments changed since last callOPTARGlm# z# c#x r<#p h\#` rP#X f#H #@ #8 #0 $#( h\# g# rP# rP# # m# # # bind+fg+bgwhence+unalias=typeset*=readonlypwdprintlet+kill+jobs+getopts+fc*=exportecho+command+cd+alias%s: bad numbernothing to shiftSugorwx%s %#3.3o bad numberaugo=+-rwxugoXsbad maskc_umask%s: %snot foundprsu,-p: %s-u: %s: %sREPLY%s%s is read onlytrap -- %s bad signal %s%s: bad value%s: cannot %s%s: can only %s %d level(s)##-setfvShell: %8ss user %8ss system Kids: %8ss user real %8s %8ss real user %8s %8ss user sys %8s :ptime: -%s unknown optiontime: -%s requires an argument#` |#X \#P #H #8 8#( # # # # \# # # t# # # # # # \# # L# *=unset+umaskulimit+truetest+read+=wait*=trap=times*=shift*=set*=return+false*=exit*=exec*=eval*=continue=builtin*=break[*=:*=.-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$[]missing ]-tinternal error: unknown opunexpected operator/operandmissing closing parenmissing argumentexpression expectedmissing second argumentmissing expression operator#####)(!-a-o1%s: %s%s#ht#Xf#@c#0d# s#l#m#n#pprocessesnofiles(descriptors)memory(kbytes)lockedmem(kbytes)stack(kbytes)data(kbytes)coredump(blocks)file(blocks)time(cpu-seconds)ulimit: %ctoo many argumentsunlimitedinvalid limit: %s%-20s unlimited %ld exceeds allowable limitbad limit: %sCOLUMNSLINESx_modefileglob: substitute errorFPATH;|&()`*+?@!IFS\$(){}*&;#|<>"'`\ @# # @# # p# ל# #h #P 0#8 #( |# # # # # # 8# # |# # # X# #x #p #` #P H#@ X#0 `# # D# ߰# # l# # T# 8# # # #` #@ #0 # # # # t# 0# # # # h# T# @#x #p P#hcommentset-argupcase-worddowncase-wordcapitalize-wordexpand-filecomplete-listyankexchange-point-and-markversiontranspose-charsstuff-resetstuffset-mark-commandsearch-historysearch-character-backwardsearch-character-forwardprev-hist-wordup-historyno-opnewline-and-nextdown-historynewlineforward-wordforward-charend-of-linebackward-wordbeginning-of-linebackward-charyank-popprefix-2prefix-1quotelist-filelist-commandkill-regionkill-to-eolauto-insertmacro-stringgoto-historyerroreot-or-deletelisteotend-of-historyredrawkill-linedelete-word-forwarddelete-char-forwarddelete-word-backwarddelete-char-backwardcompletecomplete-filecomplete-commandbeginning-of-historyaborthb fd'(! ! %"#)< >g  0y7#-1 1= ?2*?* /.&.&_606162636465666768695U5u4L4l3C3c[O%A"BCD I-search: x_search_hist nothing to yank yank something first%s%s = %s '%s' cannot bind, not a tty%s: no such functionCPOSIXsubstituteexpand(NULL)%S%s: bad substitution%s: %sparameter null or not set%s: parameter not setfunny $() command: %s%R%s: cannot open $() input.*+?@! HOMEPWDOLDPWD%sPS4%s%scoprocess already exists%s: %s_builtin: %s: not a builtin:pcommand -p: restricted%s: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s%s: not foundEXECSHELL/bin/sh%s: %s: %sshcomexec: %sFPATH%s%s %Rcannot %s %s: %sopencreatedupcould not finish (dup) redirection %s: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %s###REPLY-rreadPS3%*d) %sdbteste_isadbteste_error: %s (offset %d)++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():end of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variable%s: %smissing )zero divisormissing :missing ]e:glnrs0,1,2,3,4,5,6,7,8,9,- $_-%c%stoo many argumentscan't use -e, -l, -n, -r with -s (-e -)can't use -l, -n with -e-16 %d %.*s %s cannot create temp file %s - %serror writing temporary file - %s_${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %ssubstitution failed%s: not in history%s: invalid rangeno history (yet)HISTFILE%s.%dhist_shrink%s: internal error: %s[%d]: shl_stdout not validtoo many files open in shellcan't create pipe - try againbad file descriptorfd not open for readingfd not open for writingillegal file descriptor nameno coprocess/tmp%s/shXXXXXXXX5G##x#Pargument must be %job or process idambiguousno such jobj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlexchild: XPIPEI and no last_job - pid %d%Tfork failedcannot fork - try again/dev/nullchildexchild: execute() returned[%d] %djw:last procwaitlast: no last jobwaitlast: not startedjw:waitlast%s: %sjw:waitforjob not job-controlled[%d] %s%s| 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumeYou have %s%s%s jobs stopped and runningjobsnotifyasyncj_async: job not startedj_async: bad nzombie (%d)zombiej_waitj: tcsetpgrp(%d, %d) failed: %scheck_job: job started (flags 0x%x)checkjob%d RunningDoneDone (%d)[%d] %c %s%5d %s%s (core dumped)%-20s %s%s%s|%s%5d %-20s %s%s %s%sj_printremove_job: job not found (%s)no closing quote here document `%s' unclosed PS1%dPS2missing ] MAIL_%s you have mail in $_IFS= ${PS2=> } ${PS3=#? } ${PS4=+ }KSH_VERSION#ø#ð#è#à#Ø#ø#Ð##ø#È#À#ø#È#p#h######¸# #ˆ#x#`#P#@#0#####################whovishsedrmprmvmakemaillsgrepemacseddatecpchmodcccat-tUlogin=exec loginr=fc -e -local=typesetnohup=nohup integer=typeset -ihistory=fc -lfunctions=typeset -fautoload=typeset -fususpend=kill -STOP $$stop=kill -STOPtype=whence -vhash=alias -taliastypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"evalOPTIND=1PPID-i-rHOMEPATHSHELL-xtypesetpdksh/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin/sh-shPWD.RANDOM$ # PS1-c requires an argument%s: %sCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENV#ø#Ð#à##èinclude: %dshell: %dUse `exit' to leave ksh alloc: %s0123456789 |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF#Ha#8#0c#(##e###i#k#l#X#m#ǰC#Ǩn#Ǡf#ǘ#ǐ#Ljb#ǀu#p#h#Xp#Hr#@#8s#(h# v######xxtracevi-esccompletevi-tabcompletevi-show8virawviverbosetrackallstdinshrestrictedprivilegedposixphysicalnounsetnotifynolognohupnoglobnoexecnoclobbermonitormarkdirsloginkeywordinteractiveignoreeofgmacserrexitemacs-usemetaemacsbgnicebraceexpandallexport%-*s %sonoffCurrent option settings set -o %sgetoptionso:A:o;s%s: bad optionparse_args: `%c'%s: is not an identifier%s: bad numbergmatch*+?@! %s%s-%c: unknown option: %s%s-`%c' requires argument%s'\''%-*s%*sdo_phys_pathshf_fdopen: missing read/writeshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_sopen: flags 0x%xshf_flush: no fdshf_emptybuf: no fdshf_fillbuf: no fdshf_read: flags %xshf_read: bsize %dshf_getse: flags %xshf_getchar: flags %xshf_ungetc: flags %xshf_putchar: flags %xshf_putchar: no fdshf_write: flags %xshf_write: nbytes %dshf_snprintf: buf %lx, bsize %d0123456789ABCDEF0123456789abcdef(null %s)shf_vfprintftoo many <<'s too many redirections let%s: bad identifier forselect%s: invalid function name ##͸#Ͱ#ͨ#͠#͘ #͐ # # #͈ #̀#x#p#h#X#P#H{#@}#8#0#(# #### newline|&((;;||&&[[!}{timefunctionindonedountilwhileesaccasefielifelsethenifunexpectedunmatchedsyntax error: unexpected EOF %S%R?%dsyntax error: `%s' %s aliasexportreadonlytypeset||&&!()#`#h#p#x#΀]]<>Error handlerERRUser defined signal 2USR2User defined signal 1USR1Information requestINFOWindow size changeWINCHProfiling timer expiredPROFVirtual timer expiredVTALRMFile size limit exceededXFSZCPU time limit exceededXCPUI/O possibleIOStopped (tty output)TTOUStopped (tty input)TTINChild exitedCHLDContinuedCONTStoppedTSTPStopped (signal)STOPUrgent I/O conditionURGTerminatedTERMAlarm clockALRMBroken pipePIPEBad system callSYSMemory faultSEGVBus errorBUSKilledKILLFloating point exceptionFPEEMT trapEMTAbortABRTTrace trapTRAPIllegal instructionILLQuitQUITInterruptINTHangupHUPSignal 0EXITSIGtimed out waiting for inputsetexecsig: unset signal %d(%s)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T||&&! [[ %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %Twhileuntil%;do%;%T{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T%s< <<- << >> >| > <> <&>&%s wdscan: unknown char 0x%x (carrying on)/dev/ttyNo controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s5G#h #`#X#P#@#8#( # # # #######LINENOTMOUTSECONDSRANDOMMAILPATHMAILCHECKMAILVISUALEDITORHISTSIZEHISTFILETMPDIRPOSIXLY_CORRECTPATHOPTINDIFSCOLUMNS%s: subscript out of rangebad substitution0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz%s: bad number%s: is read onlysetstr: %s=%s: assigning to self%0*s%.*s%*s%.*s%-*.*sENVSHELL%s: restricted @(#)PD KSH v5.2.14 99/07/13.2 AAA  Q AA A QB/?^y$%s %d%sfc -e ${VISUAL:-${EDITOR:-vi}} --grabhist: bad history arrayM-usage: %s seconds if%s: destination pathname too longmain%soverwrite %s? override %s%s%s/%s for %s? rename %s to %scannot resolve %s: %scannot rename a mount pointcan't remove %sdo_move%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set times/bin/cpmv-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rfusage: %s [-fi] source target %s [-fi] source ... directory %d|&=<>+-*/%:()syntax error%seval5non-numeric argumentdivision by zero%d %s _msgbufpM:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUF%susage: dmesg [-M core] [-N system] ssethostnamegethostname%s mainusage: %s [-s] [name-of-host] $Id: logout.c,v 1.6 2003/06/02 20:18:42 millert Exp $/var/run/utmplogoutRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs%s%sr%s/dev/%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labelreadlabelfs$Id: login_tty.c,v 1.5 2003/06/02 20:18:42 millert Exp $r%s%s%s%c/dev/%s%s%s$NetBSD: getrawpartition.c,v 1.1 1996/05/16 07:03:33 thorpej Exp $/etc/fbtabr /dev/%o%s: bad entry: %s(null):%s: %s: %m/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m...login_protect$OpenBSD: fmt_scaled.c,v 1.1 2003/05/15 01:26:26 ian Exp $0B%lld%c%lld.%1lld%c$Id: logwtmp.c,v 1.6 2003/06/02 20:18:42 millert Exp $/var/log/wtmplogwtmp$NetBSD: getmaxpartitions.c,v 1.1 1996/05/16 07:03:31 thorpej Exp $$OpenBSD: fparseln.c,v 1.4 2002/06/09 22:18:43 fgsch Exp $\\#TERMCAP/usr/share/misc/termcapTERMPATHHOME%s/%s.termcap /usr/share/misc/termcaptgetentOOPSw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-unknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengths deflate 1.1.4 Copyright 1995-2002 Jean-loup Gailly fH h, h, h, l l l  l  l  l1.1.4       L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}   S S  3 3  s s    K K  + +  k k     [ [  ; ;  { {     G G  ' '  g g     W W  7 7  w w     O O  / /  o o     _ _  ? ?     @ `P0pH(hX8xD$dT4tC#c         (08@P`p  0@`  0@`incompatible versionbuffer errorinsufficient memorydata errorstream errorfile errorstream endneed dictionary1.1.4=A@A : xxswufsswap ,rwrqrofstabscan/etc/fstabrfstab: : $OpenBSD: strtok.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: rand.c,v 1.7 2003/06/02 20:18:38 millert Exp $$OpenBSD: auth_unix.c,v 1.15 2002/01/02 23:00:10 deraadt Exp $authunix_create: out of memory authunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problem$OpenBSD: nice.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: strncat.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $%s: $OpenBSD: bsearch.c,v 1.4 2003/06/02 20:18:37 millert Exp $:2*" <4,$ >6.&@80( 91)! ;3+# =5-% ?7/'91)! :2*" ;3+# <4,$?7/'>6.&=5-%      )4%/7(3-!0,1'8"5.*2$                                                                                                                                  @ @ @ @ @ ./ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz01234567896789:;<=>?  !"#$%&'()*+,-./012345%2.2u$bcrypt_gensaltOrpheanBeholderScryDoubtbcrypt1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy$1$%s%.*s$md5crypt$OpenBSD: readpassphrase.c,v 1.16 2003/06/17 21:56:23 millert Exp $/dev/tty readpassphrasetcsetattr./%02x:%02x:%02x:%02x:%02x:%02x%x:%x:%x:%x:%x:%x/etc/ethersr+ ethers.byaddrether_ntohostethers.bynameether_hostton longjmp botch. IN-ADDR.ARPAgetnetanswerbf0.0.0.%u.in-addr.arpa0.0.%u.%u.in-addr.arpa0.%u.%u.%u.in-addr.arpa%u.%u.%u.%u.in-addr.arpagetnetbyaddrgetnetbyname/etc/networksr $OpenBSD: strtofflags.c,v 1.3 2003/06/25 21:15:40 deraadt Exp $$$$$p$h$X$H$8$($ $$$$noopaquenodumpnouimmutablenouchangenouchgnouappendnouappndnosimmutablenoschangenoschgnoarchivednoarchnosappendnosappnd ,$OpenBSD: swab.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: authunix_prot.c,v 1.4 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: xdr_array.c,v 1.6 2002/08/01 01:05:24 deraadt Exp $xdr_array: out of memory $OpenBSD: rpc_commondata.c,v 1.3 1996/08/19 08:31:47 tholo Exp $$OpenBSD: strmode.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: heapsort.c,v 1.6 2003/09/08 16:24:05 deraadt Exp $$OpenBSD: rcmd.c,v 1.47 2003/07/11 22:39:21 deraadt Exp $RSHshelltcp%urcmd: socket: All ports in use rcmd: socket: %s (invalid)connect to address %s: Trying %s... %s: %s %drcmd: write (setting up stderr): %s rcmd: select (setting up stderr): %s select: protocol failure in circuit setup rcmd: accept: %s socket: protocol failure in circuit setup. rcmd: %s: %s rcmd_af0iruserok/etc/hosts.equivr%s/.rhosts.rhosts lstat failed.rhosts not regular file.rhosts fstat failedbad .rhosts owner.rhosts writable by other than owneriruserok_sa__ivaliduser__ivaliduser_sa__icheckhostrcmd: address %s not listed for host %s__gethostloop$OpenBSD: rcmdsh.c,v 1.8 2003/05/05 22:13:03 millert Exp $/usr/bin/rshrcmdsh: unknown user: %s localhostrcmdsh: socketpairrcmdsh: fork failedrcmdsh: dup2 failedrcmdsh: fork to lose parent failedrcmdsh: setuid(%u): %s /bin/sh-c-lrcmdsh rcmdsh: execvp %s failed: %s No address associated with nameUnknown server errorHost name lookup failureUnknown hostResolver Error 0 (no error): Resolver internal errorUnknown resolver error$OpenBSD: rresvport.c,v 1.6 2003/06/03 02:11:35 deraadt Exp $rresvport_af$OpenBSD: setenv.c,v 1.6 2003/06/02 20:18:38 millert Exp $ *** unknown regexp error code ***invalid argument to regex routineREG_INVARG"can't happen" -- you found a bugREG_ASSERTempty (sub)expressionREG_EMPTYrepetition-operator operand invalidREG_BADRPTout of memoryREG_ESPACEinvalid character rangeREG_ERANGEinvalid repetition count(s)REG_BADBRbraces not balancedREG_EBRACEparentheses not balancedREG_EPARENbrackets ([ ]) not balancedREG_EBRACKinvalid backreference numberREG_ESUBREGtrailing backslash (\)REG_EESCAPEinvalid character classREG_ECTYPEinvalid collating elementREG_ECOLLATEinvalid regular expressionREG_BADPATregexec() failed to matchREG_NOMATCHREG_0x%xregerror0%d$OpenBSD: system.c,v 1.6 2003/06/02 20:18:38 millert Exp $sh-c/bin/shno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failuresystem errorinvalid value for hintsresolved protocol is unknownunknown/invalid error...$OpenBSD: realpath.c,v 1.10 2003/08/01 21:04:59 millert Exp $./realpath/$OpenBSD: strtoll.c,v 1.2 2003/06/02 20:18:38 millert Exp $MD5Final$OpenBSD: strspn.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $0123456789ABCDEFabcdefxdigitABCDEFGHIJKLMNOPQRSTUVWXYZupper space!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~punctABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ printabcdefghijklmnopqrstuvwxyzlowerABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~graph0123456789digit cntrl blankABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzalphaABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789alnumDELtilderight-curly-bracketright-bracevertical-lineleft-curly-bracketleft-bracegrave-accentlow-lineunderscorecircumflex-accentcircumflexright-square-bracketreverse-solidusbackslashleft-square-bracketcommercial-atquestion-markgreater-than-signequals-signless-than-signsemicoloncolonnineeightsevensixfivefourthreetwoonezerosolidusslashfull-stopperiodhyphen-minushyphencommaplus-signasteriskright-parenthesisleft-parenthesisapostropheampersandpercent-signdollar-signnumber-signquotation-markexclamation-markUSIS1RSIS2GSIS3FSIS4ESCSUBEMCANETBSYNNAKDC4DC3DC2DC1DLESISOcarriage-returnCRform-feedFFvertical-tabVTnewlineLFtabHTbackspaceBSalertBELACKENQEOTETXSTXSOHNUL[:<:]][:>:]]%x.0.%x%02x%8xH.%02x:%02x:%02x:%02x:%02x:%02x.%uHOMEglob3.g_opendirg_lstatg_statns_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3dipx_addr%d-%d-%d-%d-%d%x.%x.%x.%x.%x.%x%x:%x:%x:%x:%x:%x%x,%x,%x%3x%3o%3d__svfscanfRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffs/etc/disktabb0b1tyremovablesimulatedsfsentnsncdtscsurmilskcshstsbssbpxbxfxoxtxdx$OpenBSD: getcap.c,v 1.21 2003/06/02 20:18:34 millert Exp $%s.dbtcgetentr|:cgetnext$OpenBSD: strcspn.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: random.c,v 1.12 2003/06/02 20:18:38 millert Exp $/dev/arandom$OpenBSD: div.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: strsignal.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: __strsignal.c,v 1.8 2003/06/02 20:18:38 millert Exp $libcUnknown signal: $20$2($2$2$1$1$1$1$1$1$1$1x$1h$1X$1H$18$1 $1$0$0$0$0$0$0$0$0h$0P$08$0 $0$/$/User defined signal 2User defined signal 1Information requestWindow size changesProfiling timer expiredVirtual timer expiredFilesize limit exceededCputime limit exceededI/O possibleStopped (tty output)Stopped (tty input)Child exitedContinuedSuspendedSuspended (signal)Urgent I/O conditionTerminatedAlarm clockBroken pipeBad system callSegmentation faultBus errorKilledFloating point exceptionEMT trapAbort trapTrace/BPT trapIllegal instructionQuitInterruptHangupSignal 0LC_MESSAGESLC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLPATH_LOCALE/usr/share/locale%s/%s/%s/%s/%s/%sCPOSIX%s/%s/%sloadlocaleLANG$OpenBSD: strcoll.c,v 1.4 2003/06/11 21:08:29 deraadt Exp $$OpenBSD: strncpy.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $offonsecurelocalrtsctssoftcarmdmbufwindow/etc/ttysr$OpenBSD: rindex.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $/usr/src/lib/libc/gen/closedir.cunion__opendir2$OpenBSD: qsort.c,v 1.8 2003/06/02 20:18:38 millert Exp $/usr/src/lib/libc/gen/readdir.cBLOCKSIZEGKM%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocks__elf_fdnlist%u/etc/grouprgroup.byname%ugroup.bygid: grscan: master.passwd.bynamepasswd.byname__YP!+__has_yppwgetpwnam%umaster.passwd.byuidpasswd.byuidgetpwuid/etc/spwd.db/etc/pwd.db%s: %m$OpenBSD: getnetgrent.c,v 1.13 2002/07/06 03:07:41 deraadt Exp $*netgroup: %mnetgroup: db getnetgroupnetgroup.byusernetgroup.byhostnetgroup: Syntax error `%s'netgroup: Cycle in group `%s'%s.%s(%s,%s,%s) ,/etc/netgroup.db+%s: : %s %s: : %s %s: $OpenBSD: yp_first.c,v 1.7 2003/06/02 03:48:42 deraadt Exp $yp_first: clnt_call$OpenBSD: xdr_ypreq_nokey.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: getopt_long.c,v 1.14 2003/06/17 21:56:24 millert Exp $option requires an argument -- %coption requires an argument -- %sambiguous option -- %.*soption doesn't take an argument -- %.*sunknown option -- %cunknown option -- %sPOSIXLY_CORRECT/etc/protocolsr $OpenBSD: killpg.c,v 1.5 2003/06/02 20:18:33 millert Exp $/bin/shsh-cexeclexecleexeclpPATH/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin:.execvp: : path too long sh/bin/shexecvp$OpenBSD: strsep.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: creat.c,v 1.5 2003/06/02 20:18:33 millert Exp $$>X$>P$>@$>8$> $>$>$=$=$=$=$=$=$=$=p$=`$=H$=0$= $=$=$<$<$<$<$<$X$>P$>@$>8$> $>$>$=$=$=$=$=$=$=$=p$=`$=H$=0$= $=$=$<$<$<$<$<$%h %e %T %s[%ld]Error %d /dev/console vsyslog_r/dev/logconnectlog_r$OpenBSD: strftime.c,v 1.13 2003/06/04 21:47:58 deraadt Exp $$D$Dx$Dp$Dh$D`$DX$DP$DH$D@$D8$D0$D($D $D$D$D$D`$C$C$C$C$C$C$C$C$C$C$C$C$C$Cx$Cp$Ch$C`$CP$C@$C8$C($C$C$B$B$B$B%a %b %e %H:%M:%S %Z %YPMAM%a %b %e %T %Y%m/%d/%y%H:%M:%SSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJan%c?%02d%2d%Y-%m-%d%03d %H:%M%I:%M:%S %p%ld%lu %d%04d%e-%b-%Y-+_fmt_conv$OpenBSD: clnt_udp.c,v 1.19 2002/09/06 18:35:12 deraadt Exp $clntudp_create: out of memory clntudp_call$E$E$E$E$G$F$G$F$G$Ftcpudpfbfexplore_numericgethostby*.getanswer: asked for "%s", got "%s"gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswer/etc/hostsr# _gethtenthosts.bynameipnodes.byname%s.%sres_querydomainNudptcp%ugetnameinfoip6_parsenumericgethostby*.getanswer: asked for "%s", got "%s"-_/gethostby*.getanswer: asked for "%s %s %s", got type "%s"getanswerbf%u.%u.%u.%u.in-addr.arpa%x.%x.ip6.arpaip6.intgethostbyaddr/etc/hostsr %u.%u.%u.%uhosts.byaddr_yp_gethtbyaddrhosts.bynameres_query%.*s.%.*sres_querydomainHOSTALIASESr__hostalias __res_nameinquery__res_queriesmatch__res_sendrjeechodiscardsystatdaytimenetstatqotdchargenftp-dataftptelnetsmtptimerlpnamewhoisdomainaptsapfsbootpsbootpctftpfingerlinksupdupnewaccthostnamesiso-tsapx400x400-sndcsnet-nspop-2sunrpcauthsftpuucp-pathnntperpcntpstatsrvprofileNeWSsnmpsnmp-trapprint-srv%dicmpigmpggpsttcpuclegpigpnvp-IIpupchaosudp%s;; res options: %s;; ->>HEADER<<- opcode: %s, status: %s, id: %u; flags: qr aa tc rd ra UNUSED-BIT-ON ad cd; Ques: %u, Ans: %u, Auth: %u, Addit: %u;; QUESTIONS: ;; , type = %s, class = %s ;; ANSWERS: ;; AUTHORITY RECORDS: ;; ADDITIONAL RECORDS: ;; ...truncated ;; ...malformed __fp_nquery__p_cdnname.__p_fqname %lu %s %s ; proto %u, port %u " "\"?" ;; *** Warning *** OS-type missing ( %lu ; serial %lu ; refresh (%s) %lu ; retry (%s) %lu ; expire (%s) %lu ) ; minimum (%s) %u %u %u "%.*s" %u %u %u %u %s %s ( 0x%04x %u %u ( ) ; BAD BASE64 ; LABELS WRONG (%d should be %d) ( %s %u ?%d?;; packet size error (found %ld, dlen was %d) __p_rr$P$P$P$P$PxANYHESIODHSCHAOSIN$W$W$W$Wx$Wp$WP$WH$W($W $W$W$V$V$V$V$V $V$V $V$V $V$Vp $Vh$VP $VH$V0$V($V$V$U$U$U$U$U$U$U$U$U$U$Ux$Up$Uh$U`$UP$U@$VP$U8$U($U $U$U$T$T$T$T$T$T$T$T$Tp$Th$T@ $T8$T!$T$S"$S$S$S$S$S$S$S$S`$SX$S@d$S8$Se$S$Rf$R$R#$R$R$Px$R"any"URN Naming AuthorityNAPTRgroup ID (nonstandard)GIDuser ID (nonstandard)UIDuser information (nonstandard)UINFOmail agent (deprecated)MAILAmailbox-related data (deprecated)MAILBzone transferAXFRincremental zone transferIXFRATM address (unimplemented)ATMAserver selectionSRVNIMROD locator (unimplemented)NIMLOCendpoint identifier (unimplemented)EIDnext valid name (unimplemented)NXTlocationLOCIPv6 addressAAAAgeographical position (withdrawn)GPOSmapping informationPXkeyKEYsignatureSIGNSAP_PTRnsap addressNSAProuterRTISDN addressISDNX25 addressX25DCE or AFS serverAFSDBresponsible personRPtextTXTmail exchangerMXmailbox informationMINFOhost informationHINFOdomain name pointerPTRwell-known service (deprecated)WKSnullNULLmail renameMRmail group memberMGmailboxMBstart of authoritySOAcanonical nameCNAMEmail forwarder (deprecated)MFmail destination (deprecated)MDname serverNSaddressAinitdebugaaonly(unimpl)usevcprimry(unimpl)igntcrecursdefnamstyopndnsrchinsecure1insecure2inet6edns0?0x%lx?0 secs%d day%ss%d hour%s%d min%s%d sec%s%ld.%.2ld?; error: unknown LOC RR version%d %.2d %.2d.%.3d %c %d %.2d %.2d.%.3d %c %d.%.2dm %sm %sm %sm%04d%02d%02d%02d%02d%02dABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~/&fLOCALDOMAIN/etc/resolv.confrbf;#domain lookupsearchnameserver%usortlistoptionsconfRES_OPTIONSenvres_initndots:debuginet6insecure1insecure2edns0$OpenBSD: atoi.c,v 1.3 2003/06/02 20:18:37 millert Exp $01234567890123456789abcdef0123456789ABCDEFinet_pton6ZONEREFZONEINITUPDATEMAUPDATEMUPDATEDAUPDATEDUPDATEA8765NOTIFYCQUERYUCQUERYMIQUERYQUERYNOCHANGE14131211109REFUSEDNOTIMPNXDOMAINSERVFAILFORMERRNOERRORGMT../etc/localtime/usr/share/zoneinfo/tzloadmnposixrules,M4.1.0,M10.5.0TZSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec???%.3s %.3s%3d %02d:%02d:%02d %d $OpenBSD: strstr.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strncmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~%u.%u.%u.%u%u.%u.%u.%uinet_ntop4%xinet_ntop6$OpenBSD: strcasecmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~$OpenBSD: _yp_check.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: yp_get_default_domain.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: bcmp.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: ypmatch_cache.c,v 1.11 2003/06/25 21:51:56 marc Exp $yp_match: clnt_callyp_next: clnt_call$OpenBSD: yp_bind.c,v 1.14 2003/06/02 03:48:42 deraadt Exp $/var/run/ypbind.lock%s/%s.%d/var/yp/bindingclnttcp_createYP server for domain %s not responding, still trying clntudp_createfcntl: F_SETFD_yp_dobind$OpenBSD: clnt_perror.c,v 1.15 2002/09/10 05:39:07 deraadt Exp $%s: %s; errno = %s ; low version = %u, high version = %u ; why = %s (unknown authentication error - %d) ; s1 = %u, s2 = %u ... %s$h$h$h$h$h$hp$hH$h($h$g$g$g$g$gh$gH$g($g$fRPC: Unknown protocolRPC: Failed (unspecified error)RPC: Program not registeredRPC: Port mapper failureRPC: Unknown hostRPC: Remote system errorRPC: Server can't decode argumentsRPC: Procedure unavailableRPC: Program/version mismatchRPC: Program unavailableRPC: Authentication errorRPC: Incompatible versions of RPCRPC: Timed outRPC: Unable to receiveRPC: Unable to sendRPC: Can't decode resultRPC: Can't encode argumentsRPC: SuccessRPC: (unknown error code)%s: %s - %s %s: %s $j($j$i$i$i$i$ix$iXFailed (unspecified error)Invalid server verifierClient credential too weakServer rejected verifierInvalid client verifierServer rejected credentialInvalid client credentialAuthentication OK$OpenBSD: strerror.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: clnt_tcp.c,v 1.18 2001/09/15 13:51:00 deraadt Exp $clnttcp_create: out of memory $OpenBSD: auth_none.c,v 1.7 2001/09/15 13:51:00 deraadt Exp $$OpenBSD: rpc_prot.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: xdr_mem.c,v 1.9 2002/12/11 22:55:39 millert Exp $bindresvport_sa$OpenBSD: pmap_getport.c,v 1.7 2001/09/15 13:51:01 deraadt Exp $$OpenBSD: pmap_prot.c,v 1.4 2002/02/13 22:36:52 deraadt Exp $$OpenBSD: xdr_rec.c,v 1.9 2002/02/16 21:27:24 millert Exp $xdrrec_create: out of memory : perror$OpenBSD: __strerror.c,v 1.10 2003/06/02 20:18:38 millert Exp $libcUnknown error: NLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%N/%LLANGC_catopen$OpenBSD: errlist.c,v 1.7 2003/06/02 20:18:34 millert Exp $$w$wx$wX$wH$w0$w$w$v$v$v$v$v$vh$vP$v@$v($v$v$u$u$u$u$u$up$uX$u8$u($u$u$t$t$t$t$t$tx$tP$t0$t$s$s$s$s$s$sh$sH$s0$s$r$r$r$r$r$rX$r0$r$q$q$q$q$qh$qP$q8$q$p$p$p$p$p$p$px$p`$p8$p $p$o$o$o$o$o$oX$o@$o($o$nAttribute not foundIPsec processing failureNeed authenticatorAuthentication errorInappropriate file type or formatFunction not implementedNo locks availableBad procedure for programProgram version wrongRPC prog. not availRPC version wrongRPC struct is badToo many levels of remote in pathStale NFS file handleDisk quota exceededToo many usersToo many processesDirectory not emptyNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedOperation timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0$OpenBSD: strlcat.c,v 1.11 2003/06/17 21:56:24 millert Exp $$OpenBSD: xdr_ypbind_resp.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_binding.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypbind_resptype.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strdup.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: xdr_ypreq_key.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_domainname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_mapname.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_key_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_keydat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypresp_val.c,v 1.5 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_valdat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr_ypstat.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: xdr.c,v 1.6 2001/09/15 13:51:01 deraadt Exp $xdr_bytes: out of memory xdr_string: out of memory $OpenBSD: ypprot_err.c,v 1.6 2003/06/02 03:48:42 deraadt Exp $$OpenBSD: strlcpy.c,v 1.8 2003/06/17 21:56:24 millert Exp $/etc/servicesr ,/$OpenBSD: fgetln.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: index.c,v 1.4 2003/06/02 20:18:38 millert Exp $$OpenBSD: strpbrk.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtol.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: strcmp.c,v 1.5 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtoul.c,v 1.5 2003/06/02 20:18:38 millert Exp $$OpenBSD: db.c,v 1.8 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: rec_open.c,v 1.9 2003/06/02 20:18:34 millert Exp $r$OpenBSD: bt_open.c,v 1.11 2003/06/02 20:18:33 millert Exp $TMPDIR%s/bt.XXXXXX/tmptmp$OpenBSD: bt_get.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_conv.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_put.c,v 1.9 2003/06/02 20:18:33 millert Exp $__bt_put$OpenBSD: bt_delete.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_seq.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_search.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_utils.c,v 1.6 2003/06/02 20:18:33 millert Exp $$OpenBSD: rec_close.c,v 1.9 2003/06/02 20:18:34 millert Exp $$OpenBSD: bt_close.c,v 1.7 2003/06/02 20:18:33 millert Exp $/usr/src/lib/libc/sys/ftruncate.c$OpenBSD: rec_get.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_put.c,v 1.7 2003/06/02 20:18:34 millert Exp $__rec_iput$OpenBSD: rec_delete.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_seq.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: rec_utils.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: bt_overflow.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: bt_page.c,v 1.7 2003/06/02 20:18:33 millert Exp $$OpenBSD: rec_search.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: mpool.c,v 1.12 2003/06/02 20:18:34 millert Exp $mpool_new: page allocation overflow. $OpenBSD: getenv.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfprintf.c,v 1.20 2003/06/02 20:18:37 millert Exp $__sbprintfInfNaN0123456789abcdef(null)0123456789ABCDEFbug in vfprintf: bad base0.vfprintf__find_argumentsexponent$OpenBSD: strtod.c,v 1.16 2002/12/02 15:38:54 millert Exp $?@$@Y@@@È@jA.AcAׄAeB_ B7HvBmB0@BּC k&4CAy7Cv4WؠCmgNCX`=Dx@DKPDMՒCAy7FnM8O?ZwH02uOs<<Ҳ؉9I#ը32D=%[ό (doCA@???5?55?5InfInfinityNaN0A??҇coCa?Ɗ(`ȳ?DPy?@$@@? ((((( AAAAAABBBBBB ((((( $OpenBSD: localeconv.c,v 1.3 1997/07/23 21:14:40 kstailey Exp $$x$x$x$x$x$x$x$$$./usr/src/lib/libc/sys/lseek.c$OpenBSD: getdtablesize.c,v 1.3 2003/06/11 21:03:10 deraadt Exp $/usr/src/lib/libc/gen/isatty.cisattystack overflow in function %s__stack_smash_handler$OpenBSD: bcopy.c,v 1.3 2003/06/02 20:18:38 millert Exp $$OpenBSD: memchr.c,v 1.6 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: bcopy.c,v 1.3 2003/06/02 20:18:38 millert Exp $$OpenBSD: multibyte.c,v 1.4 2003/06/02 20:18:38 millert Exp $$OpenBSD: hash.c,v 1.16 2003/06/02 20:18:33 millert Exp $%$sniglet^&$OpenBSD: hash_buf.c,v 1.12 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_func.c,v 1.8 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_log2.c,v 1.7 2003/06/25 21:15:05 deraadt Exp $$OpenBSD: abort.c,v 1.12 2003/06/02 20:18:37 millert Exp $$OpenBSD: exit.c,v 1.9 2003/06/02 20:18:37 millert Exp $$OpenBSD: atexit.c,v 1.7 2002/09/14 22:03:14 dhartmei Exp $/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bin$OpenBSD: bcopy.c,v 1.3 2003/06/02 20:18:38 millert Exp $$OpenBSD: calloc.c,v 1.8 2003/06/02 20:18:37 millert Exp $$OpenBSD: memset.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: memcmp.c,v 1.4 2003/06/11 21:08:16 deraadt Exp $$OpenBSD: strtoull.c,v 1.2 2003/06/02 20:18:38 millert Exp $$OpenBSD: bt_split.c,v 1.11 2003/06/02 20:18:33 millert Exp $$OpenBSD: hash_page.c,v 1.14 2003/06/02 20:18:34 millert Exp $HASH: Out of overflow pages. Increase page size TMPDIR%s/_hash.XXXXXX/tmpopen_temp$OpenBSD: hash_bigkey.c,v 1.13 2003/08/06 21:08:05 millert Exp $!0!(!%!)t!:!XD!Xt!v!p{@!h!`!X!P!H!8(!0xL!(! !\!\!!!!!0!!!!8D!*l! !!!@!x!p!h!`!X!P!H!@!0P!(P! L!,!,! t! ! ! ! ^! ^! ^! ! ! ! ! !PL$OpenBSD: args.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: conv_tab.c,v 1.4 2003/06/02 23:32:07 millert Exp $@(#) Copyright (c) 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: dd.c,v 1.14 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: misc.c,v 1.13 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: position.c,v 1.7 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_cd9660.c,v 1.16 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: df.c,v 1.37 2003/07/29 00:24:15 deraadt Exp $@(#) Copyright (c) 1980, 1990, 1993, 1994 The Regents of the University of California. All rights reserved. @(#) Copyright (c) 1980, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount.c,v 1.33 2003/08/05 20:48:59 tedu Exp $@!!!!!!!!!p!!X!!P!!H!H!8!!0!0!(!(! ! !!!!@!!!!!! !!!!!`!P$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1987, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: sync.c,v 1.5 2003/06/02 23:32:09 millert Exp $$OpenBSD: cchar.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: gfmt.c,v 1.6 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: key.c,v 1.12 2003/06/11 23:42:12 deraadt Exp $!P_!H_ !@_|!8_|!0a!(_! _!_!`!`p!`!b!a!b!aT!b!b!a!a!a!bD!bd!b$OpenBSD: modes.c,v 1.8 2003/07/02 21:19:33 deraadt Exp $$OpenBSD: print.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1991, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: stty.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $!!!!!!!!!!!˸!˰!˨!ˠ!˘!̨!̠!̐!̀!x!p!`!X!P!H!!@!8!0!(! !!!˰!˘!!!!!!!!!!!!!̸!!̰!!!!!/tmp/EdDk.aXXXXXXXXXXu$OpenBSD: dkcksum.c,v 1.6 2003/07/02 21:22:10 deraadt Exp $$OpenBSD: editor.c,v 1.90 2003/08/29 00:17:09 tedu Exp $!ߘ!ߐ!߈!߀!x!p!h!`!X!P!H!@!8!0!(!8!0! !!!!!!!!ߘ!!!!߸!߰!ߨ!ߠ!@!(!h!h!h!h!h!h!h!`!X!P!h!h!H!h!@!h!h!ߠ!h!hDISKLABEL(8) OpenBSD System Manager's Manual DISKLABEL(8) NNAAMMEE ddiisskkllaabbeell - read and write disk pack label SSYYNNOOPPSSIISS ddiisskkllaabbeell [--nn] [--ccdd | --rr] [--pp _u_n_i_t] [--tt] [--vv] _d_i_s_k ddiisskkllaabbeell --ww [--nn] [--ccdd | --rr] [--vv] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --ee [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --EE [--ff _t_e_m_p_f_i_l_e] [--nn] [--ccdd | --rr] [--vv] _d_i_s_k ddiisskkllaabbeell --RR [--rr] [--nn] [--vv] _d_i_s_k _p_r_o_t_o_f_i_l_e ddiisskkllaabbeell [--NNWW] [--nn] [--vv] _d_i_s_k ddiisskkllaabbeell --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k [_d_i_s_k_t_y_p_e] ddiisskkllaabbeell --ww --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _d_i_s_k_t_y_p_e [_p_a_c_k_i_d] ddiisskkllaabbeell --RR --BB [--nn] [--vv] [--bb _b_o_o_t_1 [--ss _b_o_o_t_2]] _d_i_s_k _p_r_o_t_o_f_i_l_e [_d_i_s_k_t_y_p_e] DDEESSCCRRIIPPTTIIOONN The ddiisskkllaabbeell utility can be used to install, examine, or modify the la- bel on a disk drive or pack. The disk label contains information about disk characteristics (size, type, etc.) and the partition layout, stored on the disk itself. It is used by the operating system to optimize disk I/O and locate the filesystems resident on the disk. The options are as follows: --nn Make no permanent changes to the disklabel (useful for debugging purposes). --vv Print additional information during operation (verbose mode). --rr Causes the label to be read from or written to the disk directly, rather than going through the system's in-core copy of the label. This option may allow a label to be installed on a disk without kernel support for a label, such as when labels are first in- stalled on a system. This flag does not work on a number of ar- chitectures, thus it is not considered the right way to put a new label on a disk. Its use is discouraged. --BB Install bootstrap code. The --rr flag is implied by --BB and never needs to be specified. --bb Specify the single level boot program, or the primary boot pro- gram, depending on the system boot architecture (single or two- level). --ss On machines with a two-level bootstrap (such as i386-based sys- tems), specify the secondary boot program. --dd Use the _d_e_f_a_u_l_t label. This ignores any existing OpenBSD parti- tions on the disk. Note that this option will only work for disks that are capable of reporting their geometry, such as SCSI, IDE, and ESDI. May not be used in conjunction with the --rr flag. --cc Clear the system's in-core copy of the label and update it based on the on-disk label. May not be used in conjunction with the --rr flag. --ff _t_e_m_p_f_i_l_e Write entries to _t_e_m_p_f_i_l_e in fstab(5) format for any partitions for which mount point information has been specified. The --ff flag is only valid when used in conjunction with the --EE flag. If _t_e_m_p_f_i_l_e already exists, it will be overwritten. --pp _u_n_i_t Print partition sizes and offsets in _u_n_i_t instead of sectors. Valid units are b(ytes), c(ylinders), k(ilobytes), m(egabytes) and g(igabytes). --tt Format the label as a disktab(5) entry. --ww Write a standard label on the designated drive. --ee Edit an existing disk label using the editor specified in the EDITOR environment variable, or vi(1) if none is specified. --EE Use a simple initial label editor, using the command-driven built-in editor described below. --RR Restore a disk label that was formatted in a prior operation and saved in an ASCII file. --NN Disallow writing of the pack label area on the selected disk. --WW Allow writing of the pack label area on the selected disk. The first form of the command (read) is used to examine the label on the named disk drive (e.g., sd0 or _/_d_e_v_/_r_s_d_0_c). It will display all of the parameters associated with the drive and its partition layout. Unless the --rr flag is given, the kernel's in-core copy of the label is dis- played; if the disk has no label, or the partition types on the disk are incorrect, the kernel may have constructed or modified the label. The second form of the command (write) is used to write a standard label on the designated drive. The drive parameters and partitions are taken from that file. If different disks of the same physical type are to have different partitions, it will be necessary to have separate disktab en- tries describing each, or to edit the label after installation as de- scribed below. The optional argument is a pack identification string, up to 16 characters long. The pack ID must be quoted if it contains blanks. If the --rr flag is given, the disk sectors containing the label and boot- strap will be written directly. A side-effect of this is that any exist- ing bootstrap code will be overwritten and the disk rendered unbootable. If --rr is not specified, the existing label will be updated via the in- core copy and any bootstrap code will be unaffected. If the disk does not already have a label, the --rr flag must be used. In either case, the kernel's in-core label is replaced. In the third form of the command (edit), the label is read from the in- core kernel copy, or directly from the disk if the --rr flag is also given. The label is formatted and then supplied to an editor for changes. If no editor is specified in an EDITOR environment variable, vi(1) is used. When the editor terminates, the formatted label is reread and used to rewrite the disk label. Existing bootstrap code is unchanged regardless of whether --rr was specified. The initial label editor mode is only intended for new disks as it will move partitions around as necessary to maintain a contiguous pool of free blocks. Some commands or prompts take an optional unit. Available units are `b' for bytes, `c' for cylinders, `k' for kilobytes, `m' for megabytes, and `g' for gigabytes. Quantities will be rounded to the nearest cylinder when units are specified for sizes (or offsets). Com- mands may be aborted by entering `^D' (Control-D). Entering `^D' at the main `>' prompt will exit the editor. At prompts that request a size, `*' may be entered to indicate the rest of the available space. The edi- tor commands are as follows: ? [command] Display help message with all available commands. You may specify a _c_o_m_m_a_n_d for which to get more detailed help. There is also (simple) context-sensitive help available at most prompts. M Display this manual page. u Undo (or redo) last change. Entering _u once will undo your last change. Entering it again will restore the change. p [unit] Print the current disk label. If a _u_n_i_t is given, the size and offsets are displayed in terms of the specified unit. e Edit drive parameters. This option is used to set the follow- ing parameters: sectors/track, tracks/cylinder, sectors/cylin- der, number of cylinders on the disk, total sectors on the disk, rpm, interleave, disk type, and a descriptive label string. b Set OpenBSD disk boundaries. This option tells ddiisskkllaabbeell which parts of the disk it is allowed to modify. This option is probably only useful for ports with fdisk partition tables where the ending sector in the MBR is incorrect. The user may enter `*' at the ``Size'' prompt to indicate the entire size of the disk (minus the starting sector). This is useful for disks larger than 8 gigabytes where the fdisk partition table is incapable of storing the real size. r Recalculate free space. This option should really not be nec- essary under normal circumstances. a [part] Add new partition. This option adds a new BSD partition. If no partition letter is specified (a-p), the user will be prompted for one. c [part] Change the size of an existing partition. If no partition is specified, the user will be prompted for one. The new size may be in terms of the aforementioned units and may also be prefixed with `+' or `-' to change the size by a relative amount. d [part] Delete an existing partition (or `*' to delete all parti- tions). If no partition is specified, the user will be prompted for one. You may not delete the `c' partition. g [d|b|u] Set disk geometry based on what the _d_i_s_k, _B_I_O_S, or _u_s_e_r thinks (the _u_s_e_r geometry is simply what the label said before ddiisskkllaabbeell made any changes). D Sets the disk label to the default values as reported by the kernel. This simulates the case where there is no disk label. m [part] Modify parameters for an existing partition. If no partition is specified, the user will be prompted for one. This option allows the user to change the filesystem type, starting off- set, partition size, block fragment size, block size, and cylinders per group for the specified partition (not all pa- rameters are configurable for non-BSD partitions). n [part] Name the mount point for an existing partition. If no parti- tion is specified, the user will be prompted for one. This option is only valid if ddiisskkllaabbeell was invoked with the --ff flag. s [path] Save the label to a file in ASCII format (suitable for loading via the --RR option). If no path is specified, the user will be prompted for one. w Write the label to disk. This option will commit any changes to the on-disk label. q Quit the editor. If any changes have been made, the user will be asked whether or not to save the changes to the on-disk la- bel. x Exit the editor without saving any changes to the label. X Toggle ``expert mode''. By default, some settings are re- served for experts only (such as the block and fragment size on ffs partitions). z Zeroes out the existing partition table, leaving only the ``c'' partition. The drive parameters are not changed. In the restore form of the command, the prototype file used to create the label should be in the same format as that produced when reading or edit- ing a label. Comments are delimited by _# and newline. As with --ww, any existing bootstrap code will be clobbered if --rr is specified and will be unaffected otherwise. The final three forms of ddiisskkllaabbeell are used to install bootstrap code on machines where the bootstrap is part of the label. The bootstrap code is comprised of one or two boot programs depending on the machine. When installing bootstrap code with the --BB flag, if the names are not ex- plicitly given, standard boot programs will be used. The boot programs are located in _/_u_s_r_/_m_d_e_c. The names of the programs are taken from the ``b0'' and ``b1'' parameters of the disktab(5) entry for the disk if _d_i_s_k_t_y_p_e was given and its disktab entry exists and includes those param- eters. Otherwise, boot program names are derived from the name of the disk. These names are of the form _b_a_s_e_n_a_m_eboot for the primary (or only) bootstrap, and boot_b_a_s_e_n_a_m_e for the secondary bootstrap; for example, _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d if the disk device is _s_d_0. The first of the three boot-installation forms is used to install boot- strap code without changing the existing label. It is essentially a read command with respect to the disk label itself and all options are related to the specification of the boot program as described previously. The final two forms are analogous to the basic write and restore versions ex- cept that they will install bootstrap code in addition to a new label. Note that when a disk has no real BSD disklabel the kernel creates a de- fault label so that the disk can be used. This default label will in- clude other partitions found on the disk if they are supported on your architecture. For example, on systems that support fdisk(8) partitions the default label will also include DOS and Linux partitions. However, these entries are not dynamic, they are fixed at the time ddiisskkllaabbeell is run. That means that subsequent changes that affect non-OpenBSD parti- tions will not be present in the default label, though you may update them by hand. To see the default label, run ddiisskkllaabbeell with the --dd flag. You can then run ddiisskkllaabbeell with the --ee flag and paste any entries you want from the default label into the real one. FFIILLEESS /etc/disktab /usr/mdec/_x_xboot /usr/mdec/boot_x_x EEXXAAMMPPLLEESS # disklabel sd0 Display the in-core label for sd0 as obtained via _/_d_e_v_/_r_s_d_0_c. # disklabel -w -r /dev/rsd0c sd2212 foo Create a label for sd0 based on information for ``sd2212'' found in _/_e_t_c_/_d_i_s_k_t_a_b. Any existing bootstrap code will be clobbered. (Normally you do not want to use the --rr flag though.) # disklabel -e -r sd0 Read the on-disk label for sd0, edit it and reinstall in-core as well as on-disk. (Normally you do not want to use the --rr flag though.) Existing bootstrap code is unaffected. # disklabel -R sd0 mylabel Restore the on-disk and in-core label for sd0 from information in _m_y_l_a_b_e_l. Existing bootstrap code is unaffected. # disklabel -B sd0 Install a new bootstrap on sd0. The boot code comes from _/_u_s_r_/_m_d_e_c_/_s_d_b_o_o_t and possibly _/_u_s_r_/_m_d_e_c_/_b_o_o_t_s_d. On-disk and in-core la- bels are unchanged, but on some systems other information may be de- stroyed. Use with care. # disklabel -w -B /dev/rsd0c -b newboot sd2212 Install a new label and bootstrap. The label is derived from disktab in- formation for ``sd2212'' and installed both in-core and on-disk. The bootstrap code comes from the file _/_u_s_r_/_m_d_e_c_/_n_e_w_b_o_o_t. DDIIAAGGNNOOSSTTIICCSS The kernel device drivers will not allow the size of a disk partition to be decreased or the offset of a partition to be changed while it is open. Some device drivers create a label containing only a single large parti- tion if a disk is unlabeled; thus, the label must be written to the `a' partition of the disk while it is open. This sometimes requires the de- sired label to be set in two steps, the first one creating at least one other partition, and the second setting the label on the new partition while shrinking the `a' partition. On some machines the bootstrap code may not fit entirely in the area al- located for it by some filesystems. As a result, it may not be possible to have filesystems on some partitions of a ``bootable'' disk. When in- stalling bootstrap code, ddiisskkllaabbeell checks for these cases. If the in- stalled boot code would overlap a partition of type FS_UNUSED it is marked as type FS_BOOT. The newfs(8) utility will disallow creation of filesystems on FS_BOOT partitions. Conversely, if a partition has a type other than FS_UNUSED or FS_BOOT, ddiisskkllaabbeell will not install bootstrap code that overlaps it. SSEEEE AALLSSOO disklabel(5), disktab(5), scan_ffs(8) NNOOTTEESS On i386 machines, installboot(8) is normally used to install boot code. The --BB option to ddiisskkllaabbeell can still be used to install old style boot code, but this usage is deprecated. On some machines, such as the sparc, partition tables may not exhibit the full functionality that is described above. CCAAVVEEAATTSS ddiisskkllaabbeell only supports up to a maximum of 15 partitions, `a' through `p', excluding `c'. The `c' partition is reserved for the entire physi- cal disk. By convention, the `a' partition of the boot disk is the root partition, and the `b' partition of the boot disk is the swap partition, but all other letters can be used in any order for any other partitions as desired. BBUUGGSS When a disk name is given without a full pathname, the constructed device name uses the `a' partition on the tahoe, the `c' partition on all oth- ers. In --EE mode, ddiisskkllaabbeell is far too quick to shuffle partitions around; it should keep a free block list and only move partitions around with the user's permission. Also, in --EE mode, partitions outside the OpenBSD portion of the disk should be changeable. OpenBSD 3.4 October 27, 1997 6  abcdfiklnoprstuvwxBDEGHLPTUXYZ0"/WHE`W[KD[GHEt54x"/LI@E`IxK8KDKXGHEt54x"/nNE`OXRLKDRtGHEt54x"/nOO<OXRLRXRtGHEt54x"/(Tpp,54"/($54x5@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: ping.c,v 1.63 2003/07/24 03:10:04 deraadt Exp $8w\.? ;@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cat.c,v 1.15 2003/06/02 23:32:06 millert Exp $7x x `x x px 8x|xxx x x x x x x x xx `x x $OpenBSD: cmp.c,v 1.5 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: ls.c,v 1.21 2003/08/06 19:09:09 tedu Exp $P.4@$OpenBSD: print.c,v 1.20 2003/08/06 19:09:09 tedu Exp $$OpenBSD: util.c,v 1.11 2003/08/06 19:09:09 tedu Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: cksum.c,v 1.11 2003/06/10 22:20:45 deraadt Exp $$OpenBSD: crc.c,v 1.4 2003/06/03 02:56:06 millert Exp $$OpenBSD: print.c,v 1.3 2003/06/03 02:56:06 millert Exp $$OpenBSD: sum1.c,v 1.4 2003/06/03 02:56:06 millert Exp $$OpenBSD: sum2.c,v 1.4 2003/06/03 02:56:06 millert Exp $"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789=:f/?/*?*n+n,N-N.m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is a directory is not a regular file (use -f to see it)44"a4x(""b4@x(hT<"h"HB4x(x" "c4x(p"""xd4Ax("X"@e4x(P" ""f4x(""F4x(X""Xg4x("8""h4x(T""HAx("p"Pi4x(LT|"0""j4x(D""J4!x(`""lHRL4x(|"`"Hm4x("8"("n4"x(l"""p4HRP4S,"q4x(H""`"Hr4"x(" ""s4!x(\""S4!x("p"`u4"x("0""V4Tw4"x("""`x4(U@"P"@X4Ax(""y4x(t""z4x("""4W"p~4!x(d"H"(?4X#4x("".4Ax(""x" (press RETURN)... (interrupt to abort)"@""381@(#) Copyright (c) 1992, 1993, 1994 The Regents of the University of California. All rights reserved. $NetBSD: mount_nfs.c,v 1.12.4.1 1996/05/25 22:48:05 fvdl Exp $ @(#)getmntopts.c 8.3 (Berkeley) 3/29/95""P"H"@"0A" B"C"D"E"F"G"U"V"a"b"c"e"f"h"i"hL"Pl"@n"8q"0q" r"s"v"w"x"u@(#) Copyright (c) 1980, 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: umount.c,v 1.16 2003/07/29 18:38:36 deraadt Exp $@(#) Copyright (c) 1989, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mknod.c,v 1.13 2003/06/02 20:06:15 millert Exp $" ""0123456789abcdef""""""x"H" """""h"8" pksentrttvarrttssthreshsendpiperecvpipeexpirehopcountmtuUPGATEWAYHOSTREJECTDYNAMICMODIFIEDDONEMASK_PRESENT CLONING XRESOLVE LLINFO STATICPROTO2PROTO1 CLONEDUPBROADCASTDEBUGLOOPBACKPTPNOTRAILERSRUNNINGNOARP PPROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTDSTGATEWAYNETMASKGENMASKIFPIFAAUTHORBRD""""""x"p"h"`"X "P "H "@ "0 "("""""""""""""""""" "p!"h""`#"P$"H%"@&"8'"0(" )"*"+","-"."/$OpenBSD: cmds.c,v 1.45 2003/06/03 02:56:08 millert Exp $"""""""""""x""$OpenBSD: cmdtab.c,v 1.16 2003/06/03 02:56:08 millert Exp $send account command to remote serverappend to a fileset ascii transfer typebeep when command completedset binary transfer typetoggle mget upper/lower case id mappingchange remote working directorychange remote working directory to parent directorychange file permissions of remote fileconnect to remote ftp servertoggle carriage return stripping on ascii getstoggle/set debugging modedelete remote filelist contents of remote directoryterminate ftp sessionexecute macrotoggle use of EPSV/EPRT on IPv4 ftpset file transfer formattoggle gate-ftp; specify host[:port] to change proxytoggle metacharacter expansion of local file namestoggle printing `#' marks; specify number to set sizeprint local help informationget (set) idle timer on remote sidechange local working directoryprint local working directorylist contents of remote directorydefine a macrodelete multiple fileslist contents of multiple remote directoriesget multiple filesmake directory on the remote machinelist contents of multiple remote directoriesset file transfer modeshow last modification time of remote filesend multiple filesget file if remote file is newer than local file nlist contents of remote directoryset templates for default file name mappingset translation table for default file name mappingview a remote file through your pagertoggle passive transfer modetoggle use of PORT/LPRT cmd for each data connectiontoggle preservation of modification time of retrieved filestoggle transfer progress metertoggle interactive prompting on multiple commandsissue command on alternate connectionprint working directory on remote machineterminate ftp session and exitsend arbitrary ftp commandreceive fileget file restarting at end of local fileget help from remote serverrename fileclear queued command repliesrestart file transfer at bytecountremove directory on the remote machineshow status of remote machinetoggle store unique for local filessend one fileescape to the shellsend site specific command to remote server Try "rhelp site" or "site help" for more informationshow size of remote fileshow current statusset file transfer structuretoggle store unique on remote machineshow remote system typeset tenex file transfer typetoggle packet tracingset file transfer typeget (set) umask on remote sidesend new user informationtoggle verbose mode"Ȱ5 `"Ȩ5x"Ƞ5pkh"Ș5<"Ȑ5;"Ȉ5Q4"Ȁ5:"x5 j"p5np"h50W|"`5Px "X5i,"P5`j"H5n"@5V("85 Y"058\" 5`j"5Qd"5 j"5;"5 "5 D"5T"5U"5@Q"5xX"5j("5:"5X"Ǹ5~h"ǰ5e"Ǩ5\"Ǡ5(yT"ǘ58Z`"ǐ5P^D"Lj5IX"ǀ5e"x5^D"p5;l"h5}$"`5~h"X58>"P58>"H5P~ "@5\"85p,"05n"(5 " 5~h"5@wd"5U"5S"5S"5 0l4"5 <"5 Xd"5 j"5 g<"5 D"Ƹ5 D"ư5 (["ƨ5 8"Ơ5 Xx"Ƙ5 jl"Ɛ5 f`"ƈ5 }"ƀ5 w"x5 <"h5`Sp"`5 g"X5 |X"P5 LX"H5 ;"@5 w"85 y<"05 ;D"(5 8Q" 5 P8`"5 hi"5 b"5 S@"5xXS$OpenBSD: domacro.c,v 1.9 2003/06/03 02:56:08 millert Exp $$OpenBSD: fetch.c,v 1.47 2003/08/15 23:13:06 deraadt Exp $"@$OpenBSD: ftp.c,v 1.54 2003/08/11 21:23:58 millert Exp $@(#) Copyright (c) 1985, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: main.c,v 1.54 2003/07/02 21:04:10 deraadt Exp $$OpenBSD: ruserpass.c,v 1.16 2003/06/03 02:56:08 millert Exp $"0"("""" "$OpenBSD: util.c,v 1.35 2003/06/03 02:56:08 millert Exp $Q"`"x"Copyright 1995, 1996, 1997, 1998, 1999 The Internet Software Consortium.All rights reserved.Internet Software Consortium DHCP ClientPlease contribute if you find this software useful.For info, please visit http://www.isc.org/dhcp-contrib.htmlPATH=/usr/bin:/usr/sbin:/bin:/sbin/sbin/dhclient-script( 0(EHC  # # y# # y# # y# # y# # y# h# y# P# y# @# y# 0# y# # y # # y ## y ##y ##y ##y##y## y#x#y#h#y#X#Py#0#Py# #y##y##y##y##y##y##Py#h# y#P#Py#@#Py#(#Py## y ##y!##Py"##y###Py$##y%##y&#p#Py'#`#y(#P# y)#@# y*# #y+## y,## y-##y.##y/## y0## y1## y2#x#y3#`#y4#H#y5#0# y6##y7##y8##y9##y:##y;##y<##y=#p#y>#`#y?#P#y@#@# yA#(#yB##yC## yD## yE## yF## yG## yH## yI## yJ## yK#`# yL#P#yM#@#yN#0#yO# #yP##yQ##yR##yS##yT## yU##yV##yW##yX##yY##yZ#p#y[#`#y\#P#y]#@#y^#0#y_# #y`##ya##yb##yc##yd##ye##yf##yg##yh##yi##yj#p#yk#`#yl#P#ym#@#yn#0#yo# #yp##yq##yr##ys##yt##yu##yv##yw##yx##yy##yz#p#y{#`#y|#P#y}#@#y~#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#y# #y##y##y##y##y##y##y##y##y##y##y#p#y#`#y#P#y#@#y#0#(y249:;<=   !"#$%&'()*+,-./017>?@ABCDEFGHIJKLNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~#0#0#0#0#0#0x#0h#0X#0P#0@#00#0 #0#0#/#/#/#/#/#/#/#/#/p#/`#/P#/@#/0#/ #/#/#.#.#.#.#.#.#.#.#.p#.`#.P#.@#.0#. #.#.#-#-#-#-#-#-#-#-#-p#-`#-P#-@#-0#- #-#-#,#,#,#,#,#,#,#,#,p#,`#,P#,@#,0#, #,#,#+#+#+#+#+#+#+#+#+p#+`#+P#+@#+0#+ #+#+#*#*#*#*#*#*#*#*#*p#*`#*P#*@#*0#* #*#*#)#)#)#)#)#)#)#)#)p#)`#)P#)@#)0#) #)#)#(#(#(#(#(#(#(#(#(p#(`#(P#(@#(0#( #(#(#'#'#'#'#'#'#'#'#'p#'`#'P#'@#'0#' #'#'#&#&#&#&#&#&#&#&#&p#&`#&P#&@#&0#& #&#&#%#%#%#%#%#%#%#%#%p#%`#%P#%@#%0#% #%#%#$#$#$#$#$#$#$#$#$p#$`#$P#$@#$0#$ #$#$##################p##`##P##@##0## #####"#"#"#"#"#"#"#"#"p#"`#"P#"@#"0#" #"#"#!#!#!#!#!#!#!#!#!p#!`#!P#!@#!0#! #!#!# # ;Zx0N@(#) Copyright (c) 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mount_ffs.c,v 1.17 2003/07/03 22:41:40 tedu Exp $$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1980, 1986, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: reboot.c,v 1.25 2003/06/02 20:06:16 millert Exp $$OpenBSD: buf.c,v 1.15 2003/08/07 22:13:43 millert Exp $y$OpenBSD: cbc.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $@ $OpenBSD: glbl.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: io.c,v 1.11 2003/06/11 23:42:12 deraadt Exp $#=$OpenBSD: main.c,v 1.28 2003/06/11 23:42:12 deraadt Exp $#=`#=hH$OpenBSD: re.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: sub.c,v 1.10 2003/06/11 23:42:12 deraadt Exp $$OpenBSD: undo.c,v 1.8 2003/06/11 23:42:12 deraadt Exp $@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: cp.c,v 1.27 2003/07/29 00:24:14 deraadt Exp $53#Ah$OpenBSD: utils.c,v 1.24 2003/08/06 21:08:05 millert Exp $#I#I#I#I#H@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: chmod.c,v 1.16 2003/06/02 23:32:06 millert Exp $#L ... ...#b#b#b#b#b#b#bx#bp#bh#b`#bX#bP#bH#b@#b8#cH#c@#c0#c #c#c#c#b#b#b#b#b#b#b#b#b#b#b#bP#b8#cx#cx#cx#cx#cx#cx#cx#cp#ch#c`#cx#cx#cX#cx#cP#cx#cx#b#cx#cx#m#o#o#o#p@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: init.c,v 1.33 2003/07/29 18:38:36 deraadt Exp $$OpenBSD: dkcksum.c,v 1.6 2003/07/02 21:22:10 deraadt Exp $$OpenBSD: getmntopts.c,v 1.5 2003/06/11 06:22:13 deraadt Exp $@(#) Copyright (c) 1983, 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: newfs.c,v 1.44 2003/07/16 18:02:36 tedu Exp $#xP#x@#x8#x0#x(#x#x#x#x#w#w#w #w@#w@@ @%s: can't read disk label; disk type must be specified#######p#@#######h#H######x#`#@#($OpenBSD: mkfs.c,v 1.33 2003/08/25 23:28:15 tedu Exp $......@(#) Copyright (c) 1990, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: rm.c,v 1.15 2003/06/02 23:32:09 millert Exp $@(#) Copyright (c) 1980, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mt.c,v 1.23 2003/06/02 23:32:08 millert Exp $###### # ###x#p#h#`#P#H#p#X#H@(#) Copyright (c) 1983, 1992, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: mkdir.c,v 1.16 2003/07/29 00:24:15 deraadt Exp $#0{}abcdDgGhHilnNpPqrs tw xy !:#=@(#) Copyright (c) 1992, 1993 The Regents of the University of California. All rights reserved. #{{## / P###########Ѱ#Ѩ#ј#ѐ#ш#р#p#h#H #@#8 #0# ## ## #####и#Ш#Р#Ј#Ѐ#h#`#X#P#@#8#(# #######ϰ#Ϩ#ψ#π#h#`#H#@#(# ##### ##ΰ{  _@(#) Copyright (c) 1988, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: sleep.c,v 1.16 2003/06/02 23:32:09 millert Exp $@(#) Copyright (c) 1989, 1993, 1994 The Regents of the University of California. All rights reserved. $OpenBSD: mv.c,v 1.29 2003/07/29 00:24:15 deraadt Exp $@(#) Copyright (c) 1991, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: dmesg.c,v 1.17 2003/06/02 20:06:14 millert Exp $#ۈ@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. $OpenBSD: hostname.c,v 1.7 2003/06/02 23:32:08 millert Exp $#@#8#0#(# ##############ݸ#ݰ#ݨ#ݘ#ݐ#݈#݀#@#x#p#h#`#X#P#H####################H##BKMGTPE@$OpenBSD: termcap.c,v 1.8 2003/06/02 20:18:42 millert Exp $$OpenBSD: tgoto.c,v 1.3 2003/06/02 20:18:42 millert Exp $$OpenBSD: tputs.c,v 1.3 2003/06/02 20:18:42 millert Exp $5MS7) ?? `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`#x###L##l#@#0#(#######($OpenBSD: confstr.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: cfsetispeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fscanf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: fstab.c,v 1.12 2003/06/02 20:18:34 millert Exp $# #`$OpenBSD: fwrite.c,v 1.3 2003/06/02 20:18:37 millert Exp $# $OpenBSD: cfgetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $#$OpenBSD: linkaddr.c,v 1.3 2003/06/02 20:18:35 millert Exp $0123456789abcdef$OpenBSD: getprotoname.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: vis.c,v 1.12 2003/06/02 20:18:35 millert Exp $$OpenBSD: errx.c,v 1.7 2003/06/02 20:18:34 millert Exp $$OpenBSD: verrx.c,v 1.6 2003/06/02 20:18:35 millert Exp $#$OpenBSD: sethostname.c,v 1.7 2003/07/15 17:32:41 deraadt Exp $$OpenBSD: crypt.c,v 1.18 2003/08/12 01:22:17 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz:$OpenBSD: md5crypt.c,v 1.13 2003/08/07 00:30:21 deraadt Exp $./0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz$$OpenBSD: tcsetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: fputc.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: errno.c,v 1.2 1996/08/19 08:22:34 tholo Exp $$OpenBSD: basename.c,v 1.11 2003/06/17 21:56:23 millert Exp $$OpenBSD: ethers.c,v 1.16 2003/06/17 21:56:24 millert Exp $xx:xx:xx:xx:xx:xx$OpenBSD: setjmperr.c,v 1.3 2003/06/02 20:18:34 millert Exp $$OpenBSD: getnetnamadr.c,v 1.23 2003/06/03 21:09:00 deraadt Exp $$OpenBSD: getnetbyaddr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetbyname.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getnetent.c,v 1.9 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_network.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: alarm.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: inet_makeaddr.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: getmntinfo.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: asprintf.c,v 1.10 2003/06/17 21:56:24 millert Exp $$$OpenBSD: iso_addr.c,v 1.3 2003/06/02 20:18:35 millert Exp $0123456789abcdef$$8$$OpenBSD: cfgetispeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$$ $OpenBSD: times.c,v 1.3 2003/06/02 20:18:35 millert Exp $$`$x$OpenBSD: herror.c,v 1.5 2003/06/02 20:18:35 millert Exp $$0$ $$$$OpenBSD: wait.c,v 1.3 2003/06/02 20:18:35 millert Exp $$$OpenBSD: sleep.c,v 1.9 2003/06/25 21:15:04 deraadt Exp $$$OpenBSD: getlogin.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: puts.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: regerror.c,v 1.10 2003/06/02 20:18:36 millert Exp $$($$$$$$$$p$X$H$($$$$ $$ $$p $`$H $8$( $$$$$$$$X$P$($h$OpenBSD: fts.c,v 1.34 2003/06/11 21:03:10 deraadt Exp $$!$OpenBSD: getcwd.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: regexec.c,v 1.8 2003/06/02 20:18:36 millert Exp $$OpenBSD: engine.c,v 1.7 2003/06/02 20:18:36 millert Exp $$OpenBSD: vprintf.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: raise.c,v 1.3 2003/06/02 20:18:34 millert Exp $$OpenBSD: md5c.c,v 1.15 2002/12/23 21:10:22 drahn Exp $$"$OpenBSD: tcsetpgrp.c,v 1.5 2003/06/02 20:18:40 millert Exp $$OpenBSD: setbuffer.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: regcomp.c,v 1.10 2003/06/02 20:18:36 millert Exp $$%H$%$%$$$$$%$$$$$%$$$$$%$$x$$h$%$$`$$$%$#$#$%$#$#p$%$#h$#@$%$#8$#0$%$#($#$%$#$"$%$%$)$)$)$)$)$)$)x$)p$)h$)`$)P$)H $)@ $)8 $)0 $)( $) $) $) $( $( $($($($($($($($($($($($($($(x$(p$(h$(`$(X$(P$(H$(@$(8$#8 $( !$("$(#$'$$'%$'&$''$'($')$'*$'p+$'h,$'`-$'P-$'H.$'8.$'0/$'(/$' 0$'1$'2$'3$'4$&5$&6$&7$&8$&9$&:$&;$&<$&=$&>$&x?$&h@$&P[$&@\$&0\$&]$&^$%^$%_$%_$%`$%{$%{$%|$%x}$%`}$%X~$%P$OpenBSD: regfree.c,v 1.4 2003/06/02 20:18:36 millert Exp $$OpenBSD: ns_ntoa.c,v 1.12 2003/06/02 20:18:35 millert Exp $$OpenBSD: ipx_ntoa.c,v 1.4 2003/06/02 20:18:35 millert Exp $xxxx.xx:xx:xx:xx:xx:xx.uuuuu$OpenBSD: glob.c,v 1.22 2003/06/25 21:16:47 deraadt Exp $$OpenBSD: tcgetpgrp.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: cfmakeraw.c,v 1.5 2003/06/11 21:03:09 deraadt Exp $$OpenBSD: ns_addr.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: ipx_addr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: sscanf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: vfscanf.c,v 1.9 2003/06/02 20:18:37 millert Exp $  $OpenBSD: fread.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: ungetc.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: disklabel.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$+$+$+$+$+$+$+x$+p$+h$+`$+X$+P$+H$+@$+8$,H$,@$,0$, $,$,$,$+$+$+$+$+$+$+$+$+$+$+$+P$+8$,x$,x$,x$,x$,x$,x$,x$,p$,h$,`$,x$,x$,X$,x$,P$,x$,x$+$,x$,x$-$.0?9gt>QNPaPkqj,jH6T7YqϑI 7RǤq)>Oq9NNL(Kɲ@KCS[kA5y<5y05y05y$.$OpenBSD: printf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: utime.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: ftell.c,v 1.4 2003/06/02 20:18:37 millert Exp $$.$.$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: setlocale.c,v 1.11 2003/06/02 20:18:35 millert Exp $$2$2$2x$2h$2X$2P$2@CCCCCCC$3$OpenBSD: inet_lnaof.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: setmode.c,v 1.12 2003/06/02 20:18:34 millert Exp $$3X$OpenBSD: getttyent.c,v 1.6 2003/06/02 20:18:34 millert Exp $$3$OpenBSD: closedir.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: seekdir.c,v 1.5 2003/06/02 20:18:34 millert Exp $$OpenBSD: opendir.c,v 1.9 2003/06/02 20:18:34 millert Exp $$4p$OpenBSD: telldir.c,v 1.4 2003/06/25 21:16:47 deraadt Exp $$OpenBSD: readdir.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: getbsize.c,v 1.9 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: nlist.c,v 1.46 2003/08/27 17:16:00 mickey Exp $qt{t$OpenBSD: fgetc.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: pwcache.c,v 1.6 2003/06/02 20:18:34 millert Exp $$OpenBSD: getgrent.c,v 1.19 2003/06/02 20:18:34 millert Exp $$OpenBSD: getpwent.c,v 1.31 2003/06/25 21:16:47 deraadt Exp $$6$OpenBSD: err.c,v 1.8 2003/06/02 20:18:34 millert Exp $$OpenBSD: verr.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: warn.c,v 1.7 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarn.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: warnx.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: vwarnx.c,v 1.6 2003/06/02 20:18:35 millert Exp $$8$8h$8?$8$OpenBSD: getproto.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: getprotoent.c,v 1.5 2003/06/02 20:18:35 millert Exp $$9$OpenBSD: popen.c,v 1.13 2003/06/02 20:18:34 millert Exp $$OpenBSD: exec.c,v 1.16 2003/06/11 21:03:10 deraadt Exp $$;$OpenBSD: waitpid.c,v 1.5 2003/06/02 20:18:35 millert Exp $$OpenBSD: cfsetospeed.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$;@$OpenBSD: _sys_siglist.c,v 1.2 1996/08/19 08:21:27 tholo Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: siglist.c,v 1.3 2003/06/02 20:18:35 millert Exp $$OpenBSD: malloc.c,v 1.59 2003/08/04 16:51:49 jfb Exp $|P|P$OpenBSD: syslog.c,v 1.25 2003/06/02 20:18:35 millert Exp $@(#)strftime.c 7.64$A$OpenBSD: usleep.c,v 1.8 2003/06/02 20:18:35 millert Exp $$OpenBSD: vsnprintf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$E8     $OpenBSD: gethostnamadr.c,v 1.57 2003/06/27 22:23:05 vincent Exp $$OpenBSD: res_query.c,v 1.21 2003/06/02 20:18:36 millert Exp $$OpenBSD: res_mkquery.c,v 1.14 2003/06/02 20:18:36 millert Exp $$OpenBSD: res_send.c,v 1.15 2003/06/02 20:18:36 millert Exp $$OpenBSD: send.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: setbuf.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: setvbuf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: res_debug.c,v 1.17 2003/06/02 20:18:36 millert Exp $ d'B@;$X$OpenBSD: res_comp.c,v 1.11 2003/06/02 20:18:36 millert Exp $$OpenBSD: tolower_.c,v 1.6 2002/12/13 23:16:38 millert Exp $$Yp$OpenBSD: wbuf.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: res_init.c,v 1.29 2003/06/02 20:18:36 millert Exp $$\$OpenBSD: gethostname.c,v 1.5 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: inet_addr.c,v 1.7 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_pton.c,v 1.4 2002/02/16 21:27:23 millert Exp $$OpenBSD: res_data.c,v 1.2 2003/06/02 20:18:36 millert Exp $$]$]$]$]$]$]$]x$]p$]h$]`$]X$]H$]@$]0$] $]$^($^ $^$^$]$]$]x$]p$]h$]$]$]$]$]$]$]$OpenBSD: fputs.c,v 1.4 2003/06/02 20:18:37 millert Exp $@(#)localtime.c 7.75$OpenBSD: localtime.c,v 1.22 2003/03/13 15:47:34 deraadt Exp $WILDABBR5 5 @(#)asctime.c 7.9$OpenBSD: asctime.c,v 1.7 2000/01/06 08:24:17 d Exp $$_p$_$OpenBSD: nsap_addr.c,v 1.4 1997/07/09 01:08:45 millert Exp $$OpenBSD: toupper_.c,v 1.6 2002/12/13 23:16:38 millert Exp $$_$OpenBSD: inet_ntoa.c,v 1.4 2003/06/02 20:18:35 millert Exp $$OpenBSD: inet_ntop.c,v 1.5 2002/08/23 16:27:31 itojun Exp $$b@$c$c$OpenBSD: getdomainname.c,v 1.6 2003/07/15 17:32:41 deraadt Exp $$d$dP$d $e$j@$jX$jX$k ,$k`##P$$%%,%h##$$$%%,%#$k<$k$l8*4*+ +,H,-x-$OpenBSD: perror.c,v 1.5 2003/06/02 20:18:37 millert Exp $$l$OpenBSD: catclose.c,v 1.4 1997/07/09 01:08:57 millert Exp $$OpenBSD: catgets.c,v 1.5 1996/09/15 09:31:22 tholo Exp $$OpenBSD: catopen.c,v 1.10 2002/02/16 21:27:23 millert Exp $$m`T$w$w$x0$xx$x$OpenBSD: time.c,v 1.4 2003/07/08 00:11:50 jfb Exp $$y$yH$y$y$z$zX$z$z${ ${$OpenBSD: getservbyport.c,v 1.4 2003/06/02 20:18:35 millert Exp $${$OpenBSD: fgets.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: getservbyname.c,v 1.6 2003/06/02 20:18:35 millert Exp $$OpenBSD: getservent.c,v 1.6 2003/06/02 20:18:35 millert Exp $$|@$OpenBSD: fopen.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: rewind.c,v 1.3 2003/06/02 20:18:37 millert Exp $$OpenBSD: fseek.c,v 1.5 2003/06/02 20:18:37 millert Exp $$|$|$}$}@$}$OpenBSD: fclose.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: ftruncate.c,v 1.11 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: rget.c,v 1.4 2003/06/02 20:18:37 millert Exp $$OpenBSD: refill.c,v 1.6 2003/06/02 20:18:37 millert Exp $$OpenBSD: fprintf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: fdopen.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: flags.c,v 1.4 2003/06/02 20:18:37 millert Exp $$$OpenBSD: mktemp.c,v 1.17 2003/06/02 20:18:37 millert Exp $$OpenBSD: pread.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: snprintf.c,v 1.8 2003/06/02 20:18:37 millert Exp $$ 0000000000000000$}$OpenBSD: flt_rounds.c,v 1.3 1997/08/01 21:36:33 deraadt Exp $$OpenBSD: infinity.c,v 1.2 1996/08/19 08:17:37 tholo Exp $$OpenBSD: ctype_.c,v 1.6 2003/06/02 20:18:34 millert Exp $$$$OpenBSD: _def_monetary.c,v 1.3 1997/07/23 21:14:38 kstailey Exp $$P$OpenBSD: _def_numeric.c,v 1.3 1997/07/23 21:14:39 kstailey Exp $$$OpenBSD: fvwrite.c,v 1.12 2003/06/02 20:18:37 millert Exp $$OpenBSD: wsetup.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: makebuf.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: findfp.c,v 1.4 2003/06/02 20:18:37 millert Exp $|50/|0/5H0/|0/ 50/|0/55$OpenBSD: stdio.c,v 1.5 2003/06/02 20:18:37 millert Exp $$OpenBSD: lseek.c,v 1.10 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: fflush.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: fwalk.c,v 1.4 2003/06/02 20:18:37 millert Exp $$$OpenBSD: sysconf.c,v 1.5 2003/06/02 20:18:35 millert Exp $$OpenBSD: isatty.c,v 1.5 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: stack_protector.c,v 1.5 2003/07/18 23:05:13 david Exp $$h$OpenBSD: tcgetattr.c,v 1.4 2003/06/11 21:03:09 deraadt Exp $$$OpenBSD: umoddi3.c,v 1.3 2003/06/02 20:18:36 millert Exp $$OpenBSD: qdivrem.c,v 1.4 2003/06/02 20:18:36 millert Exp $$$OpenBSD: isinf.c,v 1.5 2003/06/02 20:18:32 millert Exp $$OpenBSD: isnan.c,v 1.5 2003/06/02 20:18:32 millert Exp $$(Y$x$$$OpenBSD: getpagesize.c,v 1.4 2003/06/25 21:15:04 deraadt Exp $$OpenBSD: sysctl.c,v 1.5 2003/06/02 20:18:35 millert Exp $$x$OpenBSD: mmap.c,v 1.12 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: signal.c,v 1.5 2003/06/02 20:18:35 millert Exp $$$$8$OpenBSD: pwrite.c,v 1.6 2003/06/11 21:03:10 deraadt Exp $$OpenBSD: ashldi3.c,v 1.3 2003/06/02 20:18:36 millert Exp $5.symtab.strtab.shstrtab.init.text.fini.rodata.data.ctors.dtors.pltpad0.pltpad1.gotpad0.gotpad1.sbss.bss.note.openbsd.identLL8!'-!0054 ;5 B5IE RE [e de mu su  U0x44 a  En}of!KF _syslogd*IISyslog Daemon/var/empty/sbin/nologin2_kdc*;;Kerberos Server/var/empty/sbin/nologin2popa3d*POP3 server/var/empty/sbin/nologin2_identd*identd/var/empty/sbin/nologin3_rusersd* rpc.rusersd/var/empty/sbin/nologin1_rusersd_identd*identd/var/empty/sbin/nologin1_identdpopa3d*POP3 server/var/empty/sbin/nologin1popa3dLGhc ~ y .  .nobody*Unprivileged user/nonexistent/sbin/nologin2_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin2sshd*sshd privsep/var/empty/sbin/nologin2nobody*Unprivileged user/nonexistent/sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin3F_spamd*>>Spam daemon/var/empty/sbin/nologin3>_rstatd*rpc.rstatd/var/empty/sbin/nologin3_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin1_isakmpdsmmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin1smmspfa#GB _spamd*>>Spam daemon/var/empty/sbin/nologin2_portmap*portmap/var/empty/sbin/nologin2proxy*GGProxy Services/nonexistent/sbin/nologin3G_kdc*;;Kerberos Server/var/empty/sbin/nologin1_kdc_x11*##X server/var/empty/sbin/nologin1_x11_rstatd*rpc.rstatd/var/empty/sbin/nologin1_rstatdbin*Binaries Commands and Source,,,//sbin/nologin1binoi"ZU uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico2_identd*identd/var/empty/sbin/nologin2 rootdaemonCharlie &/root/bin/csh2_rusersd* rpc.rusersd/var/empty/sbin/nologin3 rootdaemonCharlie &/root/bin/csh3proxy*GGProxy Services/nonexistent/sbin/nologin1proxy_portmap*portmap/var/empty/sbin/nologin1_portmapsshd*sshd privsep/var/empty/sbin/nologin1sshdXS hc H  Hwww*CCHTTP server/var/www/sbin/nologin2_rstatd*rpc.rstatd/var/empty/sbin/nologin2 daemon*The devil himself/root/sbin/nologin2_syslogd*IISyslog Daemon/var/empty/sbin/nologin3I_fingerd*!!fingerd/var/empty/sbin/nologin3!smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin3daemon*The devil himself/root/sbin/nologin3nobody*Unprivileged user/nonexistent/sbin/nologin1nobody_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin1_kadminvm,%LG \ W  _isakmpd*DDisakmpd privsep/var/empty/sbin/nologin2_rusersd* rpc.rusersd/var/empty/sbin/nologin2 operator*System &/operator/sbin/nologin2uucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico3Bpopa3d*POP3 server/var/empty/sbin/nologin3operator*System &/operator/sbin/nologin3_syslogd*IISyslog Daemon/var/empty/sbin/nologin1_syslogd_spamd*>>Spam daemon/var/empty/sbin/nologin1_spamdoperator*System &/operator/sbin/nologin1operatordaemon*The devil himself/root/sbin/nologin1daemonrootdaemonCharlie &/root/bin/csh1root\Vpk-( P K  named*FFBIND Name Service Daemon/var/named/sbin/nologin2_fingerd*!!fingerd/var/empty/sbin/nologin2 bin*Binaries Commands and Source,,,//sbin/nologin2www*CCHTTP server/var/www/sbin/nologin3C_kdc*;;Kerberos Server/var/empty/sbin/nologin3;_x11*##X server/var/empty/sbin/nologin3#sshd*sshd privsep/var/empty/sbin/nologin3bin*Binaries Commands and Source,,,//sbin/nologin3named*FFBIND Name Service Daemon/var/named/sbin/nologin1namedwww*CCHTTP server/var/www/sbin/nologin1wwwuucp*BUNIX-to-UNIX Copy/var/spool/uucppublic/usr/libexec/uucp/uucico1uucppkni+& proxy*GGProxy Services/nonexistent/sbin/nologin2_x11*##X server/var/empty/sbin/nologin2 smmsp*Sendmail Message Submission Program/nonexistent/sbin/nologin2_isakmpd*DDisakmpd privsep/var/empty/sbin/nologin3D_kadmin*<<Kerberos Admin Server/var/empty/sbin/nologin3<_portmap*portmap/var/empty/sbin/nologin3_fingerd*!!fingerd/var/empty/sbin/nologin1_fingerd . install.md set_term() { [ "$TERM" ] && return ask "Terminal type?" ${MDTERM:-vt220} TERM=$resp export TERM md_set_term } welcome() { cat << __EOT Welcome to the $OBSD $MODE program. This program will help you $MODE OpenBSD in a simple and rational way. At any prompt except password prompts you can run a shell command by typing '!foo', or escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. At any time you can exit this program by pressing Control-C and then RETURN, but quitting during an $MODE can leave your system in an inconsistent state. __EOT set_term cat << __EOT IS YOUR DATA BACKED UP? As with anything that modifies disk contents, this program can cause SIGNIFICANT data loss. __EOT case $MODE in upgrade) cat << __EOT NOTE: once your system has been upgraded, you must manually merge any changes to files in the 'etc' set into the files already on your system. __EOT ask "Proceed with upgrade?" n ;; install) cat << __EOT It is often helpful to have the installation notes handy. For complex disk configurations, relevant disk hardware manuals and a calculator are useful. __EOT if [ -f /etc/fstab ]; then cat << __EOT You seem to be trying to restart an interrupted installation! You can skip the disk preparation steps and continue, or you can reboot and start over. __EOT ask "Skip disk initialization?" n else ask "Proceed with install?" n fi ;; esac case $resp in y*|Y*) echo "Cool! Let's get to it..." ;; *) cat << __EOT Enter 'halt' at the prompt to gracefully exit OpenBSD. You can then power cycle the machine and boot your original OS. __EOT exit ;; esac } get_dkdevs() { bsort `sed -ne "${MDDISKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_cddevs() { bsort `sed -ne "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}" /var/run/dmesg.boot` } get_ifdevs() { ifconfig -a \ | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun|vlan)[[:digit:]]+:' \ | sed -ne 's/^\(.*\):.*/\1/p' } askpass() { set -o noglob stty -echo read resp?"$1 " stty echo set +o noglob echo } ask() { local _question=$1 _default=$2 set -o noglob while : ; do echo -n "$_question " [[ -z $_default ]] || echo -n "[$_default] " read resp case $resp in !) echo "Type 'exit' to return to install." sh ;; !*) eval ${resp#?} ;; *) : ${resp:=$_default} break ;; esac done set +o noglob } ask_until () { resp= while [[ -z $resp ]] ; do ask "$1" "$2" done } ask_which () { local _name=$1 _query=$2 _devs=$3 _defdev=$4 _err=$5 set -- $_devs if [[ $# -lt 1 ]]; then echo "${_err:=No ${_name}s found}." resp=done return fi : ${_defdev:=$1} _devs="$*" while : ; do ask "Available ${_name}s are: ${_devs}.\nWhich one ${_query}? (or 'done')" "$_defdev" [[ $resp == done ]] && break if isin "$resp" $_devs; then makedev $resp && break else echo "'$resp' is not a valid choice." fi done } isin() { local _a=$1 _b shift for _b; do [ "$_a" = "$_b" ] && return 0 done return 1 } addel() { local _a=$1 _b _seen=false shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [ "$_a" != "$_b" ] && echo -n "$_b " done } bsort() { local _l _a=$1 _b [[ $# -gt 0 ]] || return shift for _b; do if [[ $_a != $_b ]] ; then if [[ $_a > $_b ]] ; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo "$_a " bsort $_l } save_comments () { local _file=$1 if [[ -f /mnt/etc/$_file ]]; then grep "^#" /mnt/etc/$_file > /tmp/$_file.new [[ -f /tmp/$_file ]] && cat /tmp/$_file >> /tmp/$_file.new mv /tmp/$_file.new /tmp/$_file fi } edit_tmp_file () { local _file=$1 ask "Edit $_file with ${EDITOR}?" n case $resp in y*|Y*) ${EDITOR} /tmp/$_file ;; esac } manual_net_cfg () { ask "Do you want to do any manual network configuration?" n case $resp in y*|Y*) echo "Type 'exit' to return to ${MODE}." sh ;; esac } ftp_list_files() { ftp ${_ftp_active} -V -n "$1" << __EOT user "$2" "$3" cd "$4" ls quit __EOT } makedev() { local _dev=$1 _node=/dev/r${1}c if isin $_dev $IFDEVS || [[ -c $_node ]] ; then return 0 fi if [[ ! -r /dev/MAKEDEV ]] ; then echo "No /dev/MAKEDEV. Can't create device nodes for ${_dev}." return 1 fi (cd /dev; sh MAKEDEV $_dev) [[ -c $_node ]] || return 1 DEVSMADE=`addel $_dev $DEVSMADE` } addhostent() { sed "/ $2\$/d" /tmp/hosts > /tmp/hosts.new mv /tmp/hosts.new /tmp/hosts echo "$1 $2" >> /tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _next _f _action while : ; do _action= cat << __EOT The following sets are available. Enter a filename, 'all' to select all the sets, or 'done'. You may de-select a set by prepending a '-' to its name. __EOT _next= for _f in $_avail; do if isin $_f $_selected; then echo " [X] $_f" else echo " [ ] $_f" : ${_next:=$_f} fi done : ${_next:=done} ask "\nFile name? (or 'done')" "$_next" case $resp in done) break ;; -*) _action=rmel ;; esac : ${_action:=addel} resp=${resp#+|-} case $resp in "") continue ;; all) resp=* ;; esac for _f in $_avail; do eval "case $_f in @($resp)) _selected=\`$_action $_f \$_selected\` ;; esac" done done resp=$_selected } configure_all_interfaces() { local _IFDEVS=$IFDEVS _ifs while : ; do _IFDEVS=`rmel "$_ifs" $_IFDEVS` ask_which "interface" "do you wish to initialize" "$_IFDEVS" "" \ "No more interfaces to initialize" [[ $resp == done ]] && break _ifs=$resp configure_ifs $_ifs || _ifs= done } inet_info () { ifconfig $1 inet | sed -n ' 1s/.**$/DOWN/p /media:/s/^.*$// /status:/s/^.*$// /inet/s/--> [0-9.][0-9.]*// /inet/s/netmask// /inet/s/broadcast// /inet/s/inet// p' } dhcp_request () { local _ifs=$1 _hostname=$2 echo "initial-interval 1;" > /etc/dhclient.conf if [[ -n $_hostname ]]; then echo "send host-name \"$_hostname\";" >> /etc/dhclient.conf echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >> /etc/dhclient.conf << __EOT request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT cat >> /etc/resolv.conf.tail << __EOT lookup file bind __EOT kill_dhclient dhclient -1 $_ifs set -- $(inet_info $_ifs) if [[ $1 == UP && $2 == "0.0.0.0" ]]; then ifconfig $_ifs delete down rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 fi mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 } configure_ifs() { local _ifs=$1 _addr _mask _name _prompt _media _config set -- $(inet_info $_ifs) [[ $1 == UP ]] && ifconfig $_ifs delete down [[ -n $2 && $2 != "0.0.0.0" ]] && { _addr=$2; _mask=$3; } ask "Symbolic (host) name for $_ifs?" "$(hostname -s)" _name=$resp _media=$(ifconfig -m $_ifs | grep "media ") if [[ -n $_media ]]; then cat << __EOT The default media for $_ifs is $(ifconfig -m $_ifs | sed -n '/supported/D;/media:/p') __EOT ask "Do you want to change the default media?" n case $resp in y*|Y*) cat << __EOT Supported media options for $_ifs are: $_media __EOT ask "Media options for $_ifs?" _media=$resp ifconfig $_ifs $_media down || return 1 ;; *) _media= ;; esac fi _prompt="IP address for ${_ifs}?" [[ -x /sbin/dhclient ]] && _prompt="$_prompt (or 'dhcp')" ask_until "$_prompt" "$_addr" case $resp in dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not supported - no /sbin/dhclient found." return 1 fi dhcp_request $_ifs "$_name" || dhcp_request $_ifs || return 1 _config="dhcp NONE NONE" _addr=127.0.0.1 ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" _mask=$resp ifconfig $_ifs inet $_addr netmask $_mask $_media up || return 1 _config="inet $_addr $_mask" ;; esac echo "$_config NONE $_media" > /tmp/hostname.$_ifs addhostent $_addr $_name return 0 } isalphanumeric() { local _n _n=$1 while [[ ${#_n} -ne 0 ]]; do case $_n in [A-Za-z0-9]*) ;; *) return 1;; esac _n=${_n#?} done return 0 } enable_network() { local _netfile for _netfile in hosts dhclient.conf resolv.conf resolv.conf.tail protocols services; do if [ -f /mnt/etc/${_netfile} ]; then cp /mnt/etc/${_netfile} /etc/${_netfile} fi done DIDNET=y ifconfig lo0 inet localhost route -n add -host `hostname` localhost > /dev/null route -n add -net 127 127.0.0.1 -reject > /dev/null for hn in /mnt/etc/hostname.*; do if=${hn#/mnt/etc/hostname.} if ! isalphanumeric "$if"; then continue fi ifconfig $if > /dev/null 2>&1 if [ $? -ne 0 ]; then continue fi while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1; while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case $af in "#"*|"!"*|"bridge"|""|"rtsol") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= ifconfig $if $name $mask $bcaddr $ext1 $ext2 down kill_dhclient cmd="dhclient $if" ;; "up") cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name " case $dt in dest) cmd="$cmd $dtaddr" ;; [a-z!]*) cmd2="$dt $dtaddr" ;; esac if [ ! -n "$name" ]; then echo "/mnt/etc/hostname.$if: invalid network configuration file" return fi case $af in inet) [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a "$bcaddr" != "NONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd="; route -n add -host $name 127.0.0.1" ;; inet6) continue ;; *) cmd="$cmd $mask $bcaddr" esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done < /mnt/etc/hostname.$if done if [ -f /mnt/etc/mygate ]; then route delete default > /dev/null 2>&1 route -n add -host default `cat /mnt/etc/mygate` fi echo "Network interface configuration:" ifconfig -am route -n show if [ -f /etc/resolv.conf ]; then echo "\nResolver enabled." else echo "\nResolver not enabled." fi } install_files () { local _src=$1 _files=$2 _f _sets _get_sets for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) isin $_f $DEFAULTSETS && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then cat << __EOT No $OBSD sets were found at $(echo $_src | sed -e 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/') Set names are: $THESETS __EOT return fi select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp ask "Ready to $MODE sets?" y case $resp in n*|N*) return ;; esac for _f in $THESETS ; do isin $_f $_get_sets || continue echo "Getting $_f ..." case $_f in *.tgz) ftp $_ftp_active -o - -V -m "$_src/$_f" | tar zxphf - -C /mnt ;; *) ftp $_ftp_active -o "/mnt/$_f" -V -m "$_src/$_f" ;; esac if [ $? -ne 0 ]; then echo "'$_f' did not install correctly." else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) fi done } encode_for_url() { echo "$1" | sed -e 's/:/%3a/g' -e 's/@/%40/g' -e 's/\//%2f/g' } ftp_error () { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } install_url() { local _url_type=$1 _file_list _url_base _oifs _prompt _home _passwd donetconfig ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp rm -f $SERVERLIST ask "Display the list of known $_url_type servers?" "${_get_server_list:-y}" case $resp in n*|N*) _get_server_list=n ;; *) _get_server_list=y echo -n "Getting the list from 129.128.5.191 (ftp.openbsd.org)..." ftp $_ftp_active -V -a -o - \ ftp://129.128.5.191/$FTPDIR/ftplist 2>/tmp/ftplisterr \ | sed -ne "/^${_url_type}:\/\//s///p" >$SERVERLIST if [[ -s $SERVERLIST ]]; then echo "done." _prompt="Server? (IP address, hostname, list#, 'done' or '?')" cat -n $SERVERLIST | less -XE else echo "FAILED." cat /tmp/ftplisterr fi ;; esac : ${_prompt:="Server? (IP address, hostname or 'done')"} while : ; do eval resp=\$_${_url_type}_server_ip ask_until "$_prompt" "$resp" case $resp in done) return ;; "?") [[ -s $SERVERLIST ]] || continue cat -n $SERVERLIST | less -XE ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -ne "${resp}p" $SERVERLIST) [[ $# -lt 1 ]] && { echo "There is no line $resp." ; continue ; } echo "Using $*" eval _${_url_type}_server_ip=${1%%/*} eval _${_url_type}_server_dir=${1#*/}/$SETDIR ;; *) eval _${_url_type}_server_ip=$resp break ;; esac done if [[ $_url_type == ftp && -z $ftp_proxy ]]; then case $_ftp_active in -A) resp=n ;; *) resp=y ;; esac ask "Does the server support passive mode ftp?" "$resp" case $resp in n*|N*) _ftp_active=-A ;; *) unset _ftp_active ;; esac fi eval resp=\$_${_url_type}_server_dir ask_until "Server directory?" "${resp:-pub/OpenBSD/$SETDIR}" eval _${_url_type}_server_dir=$resp if [[ $_url_type == ftp ]]; then _oifs=$IFS IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp _passwd=root@`hostname` if [[ $_ftp_server_login != anonymous ]]; then resp= while [[ -z $resp ]] ; do askpass "Password? (will not echo)" done _passwd=$resp fi IFS=$_oifs fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then [[ $_ftp_server_dir == /* || $_ftp_server_dir == ~* ]] || _home="~/" _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi eval _url_base=$_url_base\$_${_url_type}_server_ip/$_home\$_${_url_type}_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]] ; then _file_list=$(ftp_list_files "$_ftp_server_ip" "$_ftp_server_login" "$_passwd" "$_ftp_server_dir") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -o - -V "$_url_base/index.txt" | sed 's/ //') fi install_files "$_url_base" "$_file_list" } install_mounted_fs() { local _mp=$1 _dir=$2 while : ; do ask_until "Pathname to the sets? (or 'done')" "$_dir" case $resp in done) return ;; *) [[ -d $_mp/$resp ]] && { _dir=$_mp/$resp ; break ; } [[ -d /$resp ]] && { _dir=/$resp ; break ; } echo "The directory '$resp' does not exist." ;; esac done install_files "file://$_dir" "`ls -l $_dir`" } install_cdrom() { local _drive _part _fstype _directory _n ask_which "CD-ROM" "contains the ${MODE} media" "$CDDEVS" [[ $resp == done ]] && return _drive=$resp _n=0 until disklabel $_drive >/tmp/label.$_drive 2>&1; do if egrep -q '(Input/output error)|(sector size 0)' /tmp/label.$_drive; then _n=$(( $_n + 1 )) if [ _n -le 5 ]; then echo "I/O error accessing $_drive; retrying" sleep 10 else echo "Cannot access $_drive." return fi else break fi done echo if grep -q '^ *c: .*ISO9660' /tmp/label.$_drive; then _fstype=cd9660 _part=c else resp= while [ -z "$resp" ] ; do ask "CD-ROM partition to mount? (normally 'c')" c case $resp in [a-p]) _part=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT Two CD-ROM filesystem types are currently supported by this program: cd9660 ISO-9660 ffs Berkeley Fast Filesystem __EOT resp= while [ -z "$resp" ] ; do ask "Which filesystem type?" cd9660 case $resp in cd9660|ffs) _fstype=$resp ;; *) echo "Invalid response: '$resp'" resp= ;; esac done fi rm -f /tmp/label.$_drive if ! mount -t ${_fstype} -o ro /dev/${_drive}${_part} /mnt2 ; then echo "Cannot mount CD-ROM drive." return fi install_mounted_fs /mnt2 "$SETDIR" umount -f /mnt2 > /dev/null 2>&1 } mount_a_disk() { local _drive _def_partition _partition_range _partition local _fstype _fsopts ask_which "disk" "contains the ${MODE} sets" "$DKDEVS" [[ $resp == done ]] && return 1 _drive=$resp cat << __EOT The following partitions have been found on $_drive: __EOT disklabel $_drive 2>/dev/null | grep '^ .:' echo _likely_partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/swap/s/.*//' -e '/unused/s/.*//' \ -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _partition_range=`disklabel $_drive 2>/dev/null | \ sed -n -e '/^ .:/{s/^ \(.\).*/\1/;H;}' \ -e '${g;s/\n//g;s/^/[/;s/$/]/p;}'` _def_partition=`echo $_likely_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then _def_partition=`echo $_partition_range | \ sed -n 's/^\[\(.\).*\]/\1/p'` if [ -z "$_def_partition" ]; then echo "There are no usable partitions on that disk" return 1 fi fi resp= while [ -z "$resp" ]; do ask "Partition?" "$_def_partition" case $resp in $_partition_range) _partition=$resp ;; *) echo "Invalid response: $resp" resp= ;; esac done cat << __EOT The following filesystem types are supported: default (deduced from the disklabel) ffs $MDFSTYPE __EOT resp= while [ -z "$resp" ]; do ask "Which filesystem type?" default case $resp in default) ;; ffs) _fstype="-t ffs" _fsopts=async ;; $MDFSTYPE) _fstype="-t $resp" _fsopts=$MDFSOPTS ;; *) echo "Invalid response: $resp" resp= ;; esac done if ! mount $_fstype -o ro,$_fsopts /dev/${_drive}${_partition} /mnt2; then echo "Cannot mount disk." return 1 fi return 0 } install_disk() { if mount_a_disk; then install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 fi } install_nfs() { if [ ! -f /sbin/mount_nfs ]; then echo "/sbin/mount_nfs not found. Cannot mount NFS filesystems." return fi donetconfig ask_until "Server IP address or hostname?" "$_nfs_server_ip" _nfs_server_ip=$resp ask_until "Filesystem on server to mount?" "$_nfs_server_path" _nfs_server_path=$resp ask "Use TCP transport? (only works with capable NFS server)" n case $resp in y*|Y*) _nfs_tcp=-T ;; *) _nfs_tcp= ;; esac if ! mount_nfs $_nfs_tcp -o ro ${_nfs_server_ip}:${_nfs_server_path} /mnt2 ; then echo "Cannot mount NFS server." return fi install_mounted_fs /mnt2 umount -f /mnt2 > /dev/null 2>&1 } install_tape() { local _xcmd cat << __EOT The installation program needs to know which tape device to use. Make sure you use a "no rewind on close" device. __EOT ask_until "Name of tape device?" "${TAPE##*/}" TAPE=/dev/${resp##*/} if [ ! -c $TAPE ]; then echo "$TAPE does not exist or is not a character special file." return fi export TAPE echo -n "Rewinding ${TAPE} (mt rewind)..." if ! mt rewind ; then echo "FAILED." return fi echo "done." resp= while [ -z "$resp" ]; do ask "File number?" case $resp in [1-9]*) _nskip=$(( $resp - 1 )) ;; *) echo "Invalid file number ${resp}." resp= ;; esac done if [ $_nskip -ne 0 ]; then echo -n "Skipping to source file (mt fsf ${_nskip})..." if ! mt fsf $_nskip ; then echo "FAILED. Could not skip $_nskip files." return fi echo "done." fi cat << __EOT There are 2 different ways the file can be stored on tape: 1) an image of a gzipped tar file 2) a standard tar image __EOT resp= while [ -z "$resp" ]; do ask "Which way is it?" 1 case $resp in 1) _xcmd="tar zxvphf -" ;; 2) _xcmd="tar xvphf -" ;; *) echo "Invalid response: $resp." resp= ;; esac ( cd /mnt; dd if=$TAPE | $_xcmd ) done echo "Extraction complete." } set_timezone() { local _zoneroot=/mnt/usr/share/zoneinfo/ _zonepath [[ ! -d $_zoneroot ]] && return if [[ -L /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}} fi : ${TZ:=GMT} while : ; do _zonepath=$_zoneroot ask "What timezone are you in? ('?' for list)" "$TZ" if [[ $resp == ? ]]; then ls -F ${_zonepath} continue; fi _zonepath=${_zonepath}${resp} while [[ -d $_zonepath ]]; do ask "What sub-timezone of '${_zonepath#$_zoneroot}' are you in? ('?' for list)" if [[ $resp == ? ]]; then ls -F $_zonepath else _zonepath=$_zonepath/$resp fi done if [[ -f $_zonepath ]]; then TZ=${_zonepath#$_zoneroot} echo -n "Setting local timezone to '$TZ'..." ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime echo "done." return fi echo -n "'${_zonepath#$_zoneroot}'" echo " is not a valid timezone on this system." done } sane_install() { local _insane if [[ ! -s /mnt/bsd ]]; then _insane=y DEFAULTSETS=$(addel bsd $DEFAULTSETS) cat << __EOT *** /bsd is not present in the installed system, or is 0 bytes long. OpenBSD cannot boot without a valid kernel! 'bsd' must be (re)installed. __EOT fi if [[ ! -x /mnt/bin/cat || ! -x /mnt/dev/MAKEDEV ]]; then _insane=y DEFAULTSETS=$(addel base${VERSION}.tgz $DEFAULTSETS) cat << __EOT *** One or both of the executable files /bin/cat and /dev/MAKEDEV are not present in the installed system. This indicates that executable files OpenBSD requires are missing. 'base${VERSION}' must be (re)installed. __EOT fi if [[ ! -d /mnt/etc || ! -d /mnt/usr/share/zoneinfo || ! -d /mnt/dev ]]; then _insane=y DEFAULTSETS=$(addel etc${VERSION}.tgz $DEFAULTSETS) cat << __EOT *** One or more of the directories /etc, /usr/share/zoneinfo and /dev are not present in the installed system. This indicates that directories OpenBSD requires are missing. 'etc${VERSION}' must be (re)installed. __EOT fi [[ -n $_insane ]] && return 1 return 0 } install_sets() { cat << __EOT You will now specify the location and names of the ${MODE} sets you want to load. You will be able to repeat this step until all of your sets have been successfully loaded. If you are not sure what sets to ${MODE}, refer to the installation notes for details on the contents of each. __EOT while : ; do cat << __EOT Sets can be located on a (m)ounted filesystem; a (c)drom, (d)isk or (t)ape device; or a (f)tp, (n)fs or (h)ttp server. __EOT ask "Where are the ${MODE} sets? (or 'done')" case $resp in done) sane_install && return ;; c*|C*) install_cdrom ;; d*|D*) install_disk ;; f*|F*) install_url ftp ;; h*|H*) install_url http ;; m*|M*) install_mounted_fs /mnt ;; n*|N*) install_nfs ;; t*|T*) install_tape ;; *) ;; esac done } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == \#* || \ $_fstype == nfs || \ ! -f /sbin/mount_$_fstype || \ $_opt == *noauto* || \ $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed -e 's/softdep//') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed -e 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt done < /tmp/fstab > /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp if ! mount -v -t $_fstype $_async -o $_opt $_dev $_mp ; then cat << __EOT FATAL ERROR: Cannot mount filesystems. Double-check your configuration and restart the ${MODE}. __EOT exit fi done < /etc/fstab } kill_dhclient () { if [[ -f /var/run/dhclient.pid ]]; then kill -HUP $(sed -ne "1p" /var/run/dhclient.pid) > /dev/null 2>&1 rm -f /var/run/dhclient.pid fi } check_fs() { local _dev _mp _fstype _rest _fail echo "Checking non-root filesystems..." while read _dev _mp _fstype _rest; do [ "$_dev" != /dev/"$ROOTDEV" ] || continue [ -f "/sbin/fsck_$_fstype" ] || continue _rest=${_dev#/dev/} makedev ${_rest%[a-p]} || continue echo -n "fsck -p ${_dev}..." if ! fsck -fp ${_dev} > /dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done < /etc/fstab echo "...done." [ "$_fail" ] && exit } get_fqdn() { local _dn _dn=$(hostname) _dn=${_dn#$(hostname -s)} _dn=${_dn#.} echo "${_dn:=my.domain}" raid2arraid2araid2brraid2braid2crraid2craid2drraid2draid2e rraid2e!raid2f"rraid2f#raid2g$rraid2g%raid2h&rraid2h'raid2i(rraid2i)raid2j*rraid2j+raid2k,rraid2k-raid2l.rraid2l/raid2m0rraid2m1raid2n2rraid2n3raid2o4rraid2o5raid2p6rraid2p7raid3a8rraid3a9raid3b:rraid3b;raid3c<rraid3c=raid3d>rraid3d?raid3e@rraid3eAraid3fBrraid3fCraid3gDrraid3gEraid3hFrraid3hGraid3iHrraid3iIraid3jJrraid3jKraid3kLrraid3kMraid3lNrraid3lOraid3mPrraid3mQraid3nRrraid3nSraid3oTrraid3oUraid3pVrraid3pXkmemnYksymsnZdrumn[eeprom\openprom@]bpp0n^tun0n_tun1n`tun2natun3nbbpf0ncbpf1ndbpf2nebpf3nfbpf4ngbpf5nhbpf6nibpf7njbpf8nkbpf9nlxfs0nmwsmouse0@nwsmouse1@owsmouse2@pwsmouse3@qwskbd0rwskbd1swskbd2twskbd3uwsmouse pfvwskbdnwttyFcfgxttyF0nyttyF1nzttyF2n{ttyF3n|ttyF4n}ttyF5n~ttyF6ttyF7nttyF8nttyF9nttyFanttyFbnttyEcfgttyE0nttyE1nttyE2ttyE3nttyE4nttyE5nttyE6nttyE7nttyE8nttyE9nttyEanttyEbnttyDcfgttyD0nttyD1nttyD2nttyD3nttyD4nttyD5nttyD6nttyD7nttyD8nttyD9nttyDanttyDbnttyCcfgttyC0nttyC1nttyC2nttyC3nttyC4nttyC5nttyC6nttyC7nttyC8nttyC9nttyCanttyCbnconsoleklognttyp0nptyp0nttyp1nptyp1nttyp2nptyp2nttyp3nptyp3nttyp4nptyp4nttyp5nptyp5nttyp6nptyp6nttyp7nptyp7nttyp8nptyp8nttyp9nptyp9nttypanptypanttypbnptypbnttypcnptypcnttypdnptypdnttypenptypenttypfnptypfnttyq0nptyq0nttyq1nptyq1nttyq2nptyq2nttyq3nptyq3nttyq4nptyq4nttyq5nptyq5nttyq6nptyq6nttyq7nptyq7nttyq8nptyq8nttyq9nptyq9nttyqanptyqanttyqbnptyqbnttyqcnptyqcnttyqdnptyqdnttyqenptyqenttyqfnptyqfnttyr0nptyr0nttyr1nptyr1nttyr2nptyr2nttyr3nptyr3nttyr4nptyr4nttyr5nptyr5nttyr6nptyr6nttyr7nptyr7nttyr8nptyr8nttyr9nptyr9nttyranptyranttyrbnptyrbttyrcnptyrcnttyrdn ptyrdn ttyren ptyren ttyrfn ptyrfnsound0mixer0audio0 audioctl0@ ttynullnzeronstdinnstdoutstderrX ch0YcuaanZcuabn[cuacn\cuadn]ttyan^ttybn_ttycn`ttydna st0brst0ncnst0ndnrst0neest0nferst0ngenst0nhenrst0i st1jrst1nknst1nlnrst1nmest1nnerst1noenst1npenrst1qrandomrsrandomsurandomtprandomuarandomvsystrace@w scan0A\x scan1`y audio`z mixer`{ sound`| audioctlElite 9:\ :ty#winchester:ns#108:nt#27:nc#6087:\ :pc#17749692:oc#0: Seagate ST42100N - Wren 9:\ :ty#winchester:ns#96:nt#15:nc#2574:\ :pc#3706560:oc#0: Seagate ST42400N Elite 2:\ :ty#winchester:ns#84:nt#19:nc#2604:\ :pc#4155984:oc#0: Seagate Sabre-5 ST81236J:\ :ty#XD7053:ns#82:nt#15:nc#1633:\ :pa#99630:oa#0:ba#8192:\ :pb#261990:ob#99630:\ :pc#2008590:oc#0:\ :pd#548580:od#361620:\ :pe#1098390:oe#910200:\ :pf#361620:of#0:\ :pg#1646970:og#361620:\ :ph#1908960:oh#99630: SeagateST3283N:\ :ty#winchester:ns#57:nt#5:nc#1689: Sun1.0G:\ :ty#winchester:ns#80:nt#15:nc#1703: SyQuest SQ555:\ :ty#winchester:ns#34:nt#2:nc#1273:\ :pc#86564:oc#0: Toshiba MK 156F:\ :ty#winchester:ns#34:nt#10:nc#815: Vertex V185:\ :ty#ACB4000:ns#17:nt#7:nc#1163: MDTERM=sun MDDISKDEVS='/^sd[0-9] /s/ .*//p;/^x[dy][0-9] /s/ .*//p' ARCH=sparc md_set_term() { } md_installboot() { local _rawdev _prefix if [ -z "$1" ]; then echo No disk device specified, you must run installboot manually. return fi _rawdev=/dev/r${1}c if [ -e /mnt/usr/mdec/boot ]; then _prefix=/mnt/usr/mdec elif [ -e /usr/mdec/boot ]; then _prefix=/usr/mdec else echo No boot block prototypes found, you must run installboot manually. return fi echo Installing boot block... cp ${_prefix}/boot /mnt/boot sync; sync; sync installboot -v /mnt/boot ${_prefix}/bootxx ${_rawdev} } md_checkfordisklabel() { local rval disklabel $1 > /dev/null 2> /tmp/checkfordisklabel if grep "no disk label" /tmp/checkfordisklabel; then rval=1 elif grep "disk label corrupted" /tmp/checkfordisklabel; then rval=2 else rval=0 fi rm -f /tmp/checkfordisklabel return $rval } md_prep_disklabel() { local _disk=$1 md_checkfordisklabel $_disk case $? in 0) ;; 1) echo WARNING: Disk $_disk has no label. You will be creating a new one. echo ;; 2) echo WARNING: Label on disk $_disk is corrupted. You will be repairing. echo ;; esac disklabel -W ${_disk} disklabel -f /tmp/fstab.${_disk} -E ${_disk} } md_congrats() { }  L8`@#`5#" $@``T@3#5c@@"@H*/+/4"c  0  " /"  */" !`/" @㿐@l/!d*@#5 `*L@ 3**#3*15%5/*+4)4-*'45*7/94 ;5 L@qc@ $ c@Р"H@ M"H 2%c@@ LȀ 2@ڒ ܐ@@ː`#` b1   @'/? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?+@ 1?㿘 #@(1+@ 1㿘@! " ܒ㿘 @>㿘4 ` @e/ "`p5  L@   $ 㿘4` ? "`/@c`p㿐%/@*p?45!'@5+@C 0@ p 2'5+5a@9 Pp+15#/`h!@ 3a 25!ܐ@'+a@% p!ܒ'p@6a 5 5 L 2 4#P㿘4P` 254"P "`"`"`"` "`"`" @`  "`L? 5 L ?4P 㿘  ; < 㿘 / @@<   @1"&  ?  㿘/ `4@|4c  $  44 `"5" JJ`  -2*@5 @ (*`J@ @ *`  4`(4"#J  *@J` )*@c 5`" ``*J@ -& @54 *:  c` d a  J@ s  J@   $ #bD @ # J@  @㿘@ː / `  @W`x$` $`%44# `( $ 4c€  #̒`$` $`$@ +@  02@ǐ $`&` 2!44/`P @#} +@ 0#/` @/`4 @ / "`l /` t $$ 㿘#4c`   ``*  `c   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ 4# `( ( @0@ 㿘   2  @ $ ?4`$ *㿘4#` `0`4 㿘4#` `?`8 ? 㿘  ,`+@5 ?@ `?㿘 ,m`€s㿐4 ` #    #O!/ #?  `$ *`P `/`$*O O /O㿘㿐4# `      O ? X/O O /O㿐4#/  0T@㿘  㿘4#`t€㿘@/@@㿐4c    #X# p@X/ ` 4 8 8` 4   Ћ@+@ `` ::* * * * * *34c` `€ 0 + @@c|@㿘4#` !/`@+@NaP+@a` +' ah@ + @ap    ` N@J@2J`N` " 2 㿘4#` €+ 0!x@ 㿘!4 Xߖ ??"  X.㿘)4! ?N  @  4"##$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` +@!+  " * @7 $`0 "$`4 " @*$` @ 2!&  %! +@! 㿘#4a  @ 4 "$a & 4$a㿘/ *`@ /+!@v!\ //         +!@_` `/ @ / 8 <?*  ` آ&@  ` / `@㿘?(4,14\&# H L` T ` X P d l$ p  t @4 .@㿘5 `@V 4 4 5@ s`L+@" G +"8 @    @ 8?@?# @!a% ?@?# @!a ?@?# @! a  ?@?# @ +0 `+ @ @"@ @㿐`+@"`@?@ %?# @! `  a `  `  @[`@`쀢 +@?  ?# ! ? ?# !!+` !+@!+,@`@2,@`@d"h`@`Z+` "h@W@ ` "`,@?`` A+`,@`"p,``,``,``@?``@`@5+@ @  -+,@ ,` ,` ,`  ?`@m+@+"x@``? ? 5"` +"@@8& @" ` @  ! ??#2   @. :d뀤 '@`,    6`,`  ̘D  "`,= x*@`,*` 5`L@  +@"0'@ E   2 `, "`,`@"'@`, @ 2`,+@"? P# 2H  C+"+"+" @i    d d @ "@  @@ @X @ E   :    +"@ @?"   @@ "  @" `,   @` %   5 d"   "  45`L@  +@#0`0, * @Z@5`L@ r +@# 05`L!+ "5`L!+#P5`L!+#h@ ] @0k`0@ `7E    @ " `("L@ 5 1+ ? )+#@#H+" @    d   @ @` ?$ @ @E  `0Ѡ (5+@#5` 4 4&` &`6`*@N6`,@? 5"` +'@@}# 㿐` @0@6ฐ`@@༠@* @ @@x` * d, `0 200@"x @* @ @ ?  "? 6"?% 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@,`& 㿐   <P @ 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @#0$  " @N  d  *  0 @]$ $  $@&@&    b 8   @   " & 㿐`@Ր  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@ Ц @ &`@@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  'a L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@, W(  2LL@@ $H  E;@P%( 8@H"@ 0 K䰒 *@6`  d*  0` @'O / ' 'ݒ L@  @   0@ @@  Ё㿘 &     . @ "  @ 0  .  "  @ 0 @ @ ے а 㿐 @ є@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  pZ j5!1a"'А $  $ $ ''X@Ғ 2V?/a??"a4` $@!#`"#@ #\ @  !5+@=#;?#5 D`H@ D*`4`H' @2 `+@$#"?5'ܠ 5a"@~܀ ?5"5aP@t܀  ?5b@܀ ? ?  M5!Ԣ5a?@G 2B?@i@> 29?/a5?"a6 D"&#`a#@b#\ @   5 H"`L''@( ?@I ?#'@ ? ?㿘`&"@  &@ e 㿘 &   ? @&@ S.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( +#@ڔ     2` * @h *`  * +` **` +   h  (@ qg@ @@ o`-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ }&  㷐 R@ N`@4 @H``@C@2 *@ `  @ Y,  ( )􀢨$ 2@` ' 8'" w@ 9'@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0   㿘  ,  ". /.".+."&  "!"..^ 0Y W ?T 0Q @͠LK *L0E 0B 0pؒ  @ Ɛ@ \ 8 'p@ t    $ #`a#\b` @  ? 5 H "`L؀`5@ {  " L?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 @ Tt$`     h #`ab`$#\ @ ? 5 L x 0  &,& &&& D& &(&$@ "㺈 ` ($ a b????#\#`  @ ? 5 L `  dh@d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H5" L?@T@0 +#@ 5 H"`L?㿘@Ӑ /5 "`L!5"!6 &` 2?5`P"`P0 "!"0" ?㷈5 P P` ,@   N  m `/2N N /" N a  0 ] @/ x  <$N O  N  /  .ؔ A.0 0P" 2;P@ @  $+  (@*;@&O`/ P@ x@ x  @  x N  P&`  @ x@ x㿘  "& @ x&  㿘' #5!4%,@    ? `L2  "D @ 0  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  /0h( 4 2`:2` <"` @"`D :`0 㿐\@?<6   '?'?@?5H '?` '?`@"H"?'?Đ #`#` #`#`#\ #`c$ #@? 5` @``2,"@~ P5 H"`L?㿘!5$ L@H 5!H@ 2?`2 ?`,` $ L h@Z ??"@?25L5ȇ( 2  2 2 *?5!L #!L!L5("#!L" " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !5 L@c?,@  H$ L8G8G8H8H8G8G8H8G8H8H8H8H8H8H8H8H8H8H8H8H8H8G8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8G8H8H8H8H8H8H8H8H8G8H8H8H8H8G`8Gl8Gx8G8G8G㿘`X1!Г*` €1,0 1,- 1,* 1,' 1,$ 1,!!1,! 1,!81,!P1,!p1,!1,!1, !1, !14,!@ @!44쀢@**@"㿘#44!4"a$a ,P'P'T'X@J$!a!耢 *`2*& ,@"J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b,4 `4 #\"X .@W ,@"(? 52a a2  a @ 0/ ? @ /??"b0 $`㿘/ @m 5㿐@5!" L  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` /"0    5`'"'ܐ@ܖ@ܘ( @?,"H@<x@ް {ހ( (  u?@p?2n?<@ 2g? 2c?6``<`]@l 2Y? &U?``  2M?` &@  4 & ` 2>?` "6`` %,@Ґ"h0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   )5 <+,`% L(?@ @b@,`4 2  L   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘4" ,@  .  @e 0,@@ "@Z  0,@@w  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` c+` ??㿘b  @,   /a@%  "` ?` ?74/ :  0 *@ `  *@`*@`4*"" @ ` ?  2  㿘4b('H'L'P'T 'X @"b(@H,@ߐ">㿘,"㿘5# , @` @ , 㿘@@T㿘@| 㿘 < " ? 2  @15 D& L@V  $  L `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘/"8  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 8㿘@Y?.`,@ P4",. `"  P @Ԑ,Ȑ?@ 8 `@v &`D&@c&`@0 @ݐ`@ P@Ð?㿘 5 "`L?5#. @ 4. ", @ D@y@v P@㿘4",.  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @$ 45 L`$<" $& @$$$<S < D!5$ L@ $ L $<D$@ #$8 H@q" $H H ?$88 @$$  @V $H8 2  < 2  2L H@D" $H&㾘 5 5#- @4@9",-  `L @?2+$`)'$`" ` 5f c5b @F ` 42$`@   @ ?L @`D P @,Ȑ?@̖ 8$@$`D$`@0` 4@ 1@ /@ f )`' a !ڒ: @5  Zd 4 `0 Z"`L??/@@ ? * `:```? /bD "bD"    /@?"  @@ @   @ *0   @ *`(㿘5. # @  @  5 $"`L2  " @      @ $5" L`5 " L?㿘5. #@ @  5 "  5  Z :@B: Z"`L? ?   ` 㿐5# @  `  ` 5 D"`L$@$`$` 'X 85@`` / "`J /`)$@&$`  l@  4# € ` ` l `" ` @5" L$@?㿐5. # @@  5 ,"`L" @ * 2`      5 "`L B< ' 5 "`L&?8f$8f8g08g8g8g8g8g8g8g8f8g8g8gl8g8g8g8f8g8g8g8g8gȝ㿘'H'L'P'T'X"Ē@ H㿘"Ē@8N@`N@`%` N@`|`! *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈,"Ф@ @,@͐  ?L?㿘/"H` 4"<, bJ@ #"<酐 /"@ /"L@  'h@@B`@ `   ,$"ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hb44 j4 h"\$@#\ .J? hl'l,# ` `4` 4`  $4`㿘/l(㿐5-" L(2*?@ 2&?`(2"?`&2?`  @??/"/*@ L*`@ `  ??㿘@ /`(+`&'` # `t   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8{8|D8|8}8}h8}8~8~88~88\8848<㿘 ?`2"`0"`"`   "` @ 㿘 ? ` $ 2`0 " $@= $  (€ $ 㿘"M?N 12I?8 D?2 @? & "P& & ( $ 2 "p& $   (  )& "  `"   "`  ( ?"  `   "X *@o  "` ?㿘 㿘 "@?  "<? 7` ?? ` . ܓ*` € %  $ $  @  " `$  ",c0 2    ",cP " `  $ $    $`*   &@,ݒch`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" ",c $ " @Β?   " F"" s @] `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  ",c $  " " ??㿘    "$? ? @s 0  ? & 06 "* $@@  "@ 㿘 A?`2@0;  "@"` 20?  ,#  @`#@  ?( "$$$ "`˰ $$ "@?㿘 " ?   ?  @9㿘?c6  @`W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@ђ#͒#񀦠,`88X8888 8|8088ܝ㿘" <&? 8`$`(€  2 ( @ (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€h 0 4@`  "? ,"` + #ܓ*` €Ъ  *``` 4  `&  `-`0  `4 $@&إ4@@9耢 & & & @&``$  &`&@& 4?  &4-& &`4& & @&``$  &`&@& 4ڔ?  *```?#4* @- & &`& & @&``$  &`&@& 4?`&  m p ` & & @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & & @&``$  &`&@& 4Y 8Ȕ "@`%@% &     &  *`` `?, & 4   ! -& 8&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @, #  *```  *@ *`"  & 2  4    ,#* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @  /-"`` @, `a  *`@ ,   *`    $@ * "  & T4    @ `E  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@rؠ ?2& `$`(€ && & @&``$  &`&@& 4@䀢 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@  @/ 0 4@`  "? ,"   c&&& 4@1 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘S `( `$€ (`(`$€ $`(`$€㿘 (^ (@& 0& 4`?8888T8P888D88㿘 (    * * " " "㿘 0 4 @`  " ,"@` $#<*` €)` '& & @&``%@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@` /`  *   /b+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@-$@ &`& & @&``%  &`&@& 4?` /`b  *   /"+`  ` ` `$`$ $` $`$@4 ` /`Q  *   /b+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`-$@ &`& & @&``%  &`&@& 4O?` /`   *   /"+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@* 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ ""22 ` & 4@ 0 4 "@ , ,"  0 ( @ ""2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@㿘`(`$€㿘04@`  , /. ((```(@( @ @-А"` &@6 . &@`` 6@(``` (- @@"` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ / ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0ヤ ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#. @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@ '48- @ ` 0@ `.@(h&@&H`@*@0h'H '0?'p  '(+ '$@??Hh.(+`', M+`$  0% ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? ' .@+`0@?2[  H+ ` 2?㿀   ( ' #?#d#`#\#h    ??-# ' -@ 2 (-#0' ? ( $€㿀d !  ( `' R?-- !#\#`#d#h]! ?  ,??-#X-$ +-'#--\#`#d"#\#h>  ? 2 (??-# $ ?-#-#$ ? ( $€0 ( $€ //""/"@3"" . `Y G8. @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` . @0(`8>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.1.40123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %sunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-8% 8(8)8)8)8*D81|86h86878788p8>\8@8@8A8A8B88 88 888 88 (88H8@88808(8 8   8@` 0123456789abcdef/8׈?? `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`88888X8X88888)858(B8M8ѠV8xa88p8u8X8Ѥ888\8`8И8@8@8088x88(8\8v48! 8P,8@587B8K8_Q86]8ehd 8k 8s 88D88G4 88HX8D(8888T8Bp8H8p 8@88p 81|, 8L28a(98Q4?88D8{@L 8D[8dc84n8oxt8+~8@8b8 88`8 8|8788ox 88S88 8H88hx8l88"8R(1 868-pA8hI 8R 8b8hq8}88  8D88d8]@888ud8(888 8P84 8 88.08{ =8>\F8$T8 _8s8@|8A8 8Bx8X808Vp8O8e8N8X8H8$8V 8=8  8b 8h8n%84+8B48A8U88]8Zb 8i8s8|88l8+t88 8P8)8L 88U 8H8K8y8U\8r8d8/L)8<8H8V 8b8)k8`r8w8kD8% 8 08Q 8A 88L86h8 8o8VP88.8h 8 88r8v4" 8L/8x>8/P8 Y8n8y8 8 8H 88*p888(8S(8\8l8 8 x8e 838U88l= 8 B8)L8Z8`8Pp8u8h8*D88P8o\8YX8Tx8q 888yt8t88 ( 8y 8T 8Z0 ! 8 /8( = 8 B8@ K8D ]8`h bgcc2_compiled.open_countnetif_promfilestore.9bootstore.10prom0_fakesaveechopv_putcharsun4_idprom.65dtabstringbuf.75promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.88elf_execaout_execelf_seekputchardvma_allocprom0_iclose_remprom_ioctldomainnameloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seekinflate_fast.udivrootipsendethercd9660_readdirrpc_xidinflate_flushtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodefile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvinflate_blocks_freenfs_readnfs_writeprom0_strategy4 `@# ` "" $@` `T@  p b@"@H*/+  "b   0  "# "# * "#!` "#@㿐@#  a"a @ "  "8@c@  @   " @@㿐 c@T    "P@c# @ D ?#c' / - + ,`2 h@k㨒   # #@^㨒@a#@`b@S@?@2 @a aa @F`#@Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1? @"1?㿘 #@(1 @"1㿘@ʐ " ܒ㿘 @  㿘 #` @ "  `  "  ` ""J  *@J` )*@㿘@  #` @ "  `  €b  $€b 2$   " @ɐ"0   $  $`$` 㿘# b `   ``*  `b    '@`2`0`,6 * '@ 㿘  ?& `& $& (   €? " '@ 㿘 "   @@ 0(@  㿘  @ $ ? `$ *㿐 " /  0T@㿘  㿘 " `t€㿘) ! ?N  @  "!Т!$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ "+  " * @7 $`0 "$`4 " @$` @ 2!&  %!  @# 㿘# a  @ 4 "$a & 4$a㿘 #*`@   #0@ \   #         #H@y` ` #@  #8 <?*  ` آ&@  `  #`@㿘?( ,1 \&" H L` T ` X P d l$ p  t @  .@ dd ? * `:```?  `h "`h"     d?"  d㿘 a'H'L'P'T 'X "a@/H @#h㿘 #p4 (4 4444444444 444p4444 44444̝㿘 'H'L'P'T'X#`@ H㿘 #`@8N@`N@`%` N@`|`  *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈 #x@ @,@  ?L?㿘  l`  !  cJ@ #! @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" %s: can't open device%s: alloc failed%s: block table corrupt%s: read failure%s: short readdvma_mapindvma_mapoutpromprom0Can't open device `%s' Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d exit0123456789abcdef|/-\bootxx44,44444444   444p4p44444p4,4 D74@4K4Y4 Hd4q4\4`44`4l44444 4 l 4 4444444"4|*4048 4H4tT4a 4g4l4tr4z4 4 44 44,4 44l444 4D4@4444D4!48,48 4E4 M4 R4X4^4j4t4~ELF@4)S4 (  @@)R<-13P zHP tHP pHP lH_HyHP `HP THP ZHP THP PHP LHP HHP DHP @HP HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P HP ? HP @ |HP A xHP B tHP C pHP D lHP E hHP F dHP G `HP H \HP I XHP J THP K PHP L LHP M HHP N DHP O @HP P HP ?HP @|HP AxHP BtHP CpHP DlHP EhHP FdHP G`HP H\HP IXHP JTHP KPHP LLHP MHHP NDHP O@HP P ;8;;;;; ;(;0H )@`  > !  > ;8!7 > 0+0;"+,+0΁`#@ 0΁1 !>&;8>0)@09`")@)@0΁`# 0΁1"; >  9`9`9`9`9` 9`(9`09`86`@!`xH )@` !!! P -@ @ @"P/> P->  %)>  %"+/> -> +cP> B#`"##t@> U#x;x ;"`;" @륐@Ҋ@@2 @ 0P -@ @ @"P/> P->  %)>  %"+/> -> +cP> B#`"##t@;x҂@ ;Ԃ@`;"k  ւ@ ؂@ " +?P `* -` @Zt x ``-`؁ @N tx ρ )>!4@! P->  %)>  %"+/> -> +cP> B#`"##t@;x;;>!<!@ ;`#h#l;;;;@Pі``htx ;`#h#l;;;;@O``htxn )>)"@)>)# P -@ @ @"P/> P->  %)>  %"+/> -> +cP ;`@;h#t;x;;;;;`@M>;`htx( /> -> +cPۜP -@ @ @"P/> P->  %)>  %"+/> -> +cP ;`@;h#t;x;;;`;;@Q^;`htx၌ -?P -@-P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P;x> B#`"#@;,/,;@ ;`,)>  ;h %)> U" #pH  p@  "`@ x  +?P`-@-?P- %0P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P;x> B#`"#@;,/,;@ ;`,)>  ;h %)> U"#pH  p@  "`@  @@!`x' P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P> B#`"#?P * * ;`@;h09P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P> B#`"#?P * * ;`@҂@ Ԃ@;h ւ@ ؂@@4`h ?P `*  P -@ @ @"/> /> /> 6PP->  %)>  %"/> /> /> P> B#`"#?p " ?P "  ;`@;h@!g`h ?p " q @/>  @̀->  $)>  %-> +cP-> , ZP @ H ,@`#> c$` (08 @̀=)> #0+0;"+2+0 `# @ 05-" % >&u 8 >0-@0=`"-@-@0 `# @ 05-"Y  -> %- +cP ;`@;h #t;x;`;;;;@J;`htx -> & 0Ȧ! H,@` !`hpxX (08@HP @̀H,@`%>  $!> #`8 (0 @̀@ @̀  H ,@`#> c$` (08@̀䀕2??@ @̀='> 0/0?"/2/0 `# @ 05-"$>& 8>0-@0=`"-@-@0 `# @ 05-" ?  H,@`#> c $`!> #`8 (0@̀ -> ,  @uP-> "/> V4͐  ! H,@` !X (08@HP @̀>  `?* `"" * `@"> +  * `@&* *  ֊@* "``'1@'0@ )>+>%@#' $P(   c     c  mt@ >   >  @@   >  @@ #>%> \ `P@%  '`@`@ 7  '`@`@ 0, *H Ѐ(H+ `!Ђ* ր  Ԡ҂2`*`D4`@ D֠ 0 !Ђ* ҂2`*`D4`@ D>%c@> "# *> "#!`> "#ćH(  /  > ==> H > "#> d"<> \a@"@!> $ H``> "`  !>%#!>'"$ $ >&  2> " > " > "!> "!@>#"">#"">#"#D>#"#l>$""$>$""L>$"">$"">)"#x>)"#0>+"!\@ n@d#@+`;h;p;x;;;;;;;;;;;;;@L@P@ `hpx gP   d#@+`;h;p;x;;;;;;;;;;;;;@H@@ `hpx d P    "%> > > "  "> >@ >  #>&c# #>&c# J@*@ ` `*@ ?"@ 2"# @ `*@ @ `*@  "  ?J*@`8  ?"@ 2"> * >  >@ *>  >' @S" > " > "   > 4``6 > c >   !!`> 8 @>  `" > B#`"# > ֈ > > ! `2$j0>'@Ð!x>'@!>'@!switch rqswitch wchanswitch SRUN> > : H>  " (o! `j>  > :"X>*Ԓ"2J "2 J    "2 J  J " > ֚` +  @ #@"   *@ * lH1 > "! , `! "I"j > !$`"!$j ` *@  ( !> !` (08 2㿠@+8> c` Ъ@@>`€"Т@: H" H*/  h`> >(`" `2 `2`2" " ?" ?> >(`" `2*`22`2"" @>(`" Њ@" " @""@" "`""@ 6 :@ 6 `6:   6  J?*@``";" " J `*"J*@ `"" "R2@ `4"R2@ `"" ""@ `""@ `":@ `""@ `R2@J *`2J*@   6 " J"`*@`"(" " " J"`*@"" J"`*@"" "" R"` 2@"" R"`2@"" "`"@"" R"`2@2J?*> c>)h` #` 6 J *@`#`  `"<" " J *@`#`  "J *@"`" "R 2@`8"R 2@"`" " "@`" "@"`  :@ ` " "@` R 2@J *`#`  2J#`  *@#`  #`  H@ `*  @ : " : : : : : (: 0: 8: @: H: P: X: `: h: p: x 2@ *  @ 2* H@ `      ( 0 8 @ H P X ` h p x 0000H ?P *H ?P +*?p` "@?p`"@@* ?P` <@ "@$@% #@%"$@% #@%&؃%"@ւ"%ւ"&؃"@  >*Ԓ "2 J "2 J   "2 J  J  @ @: `  : `z Z@  r R@  /*# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@#  # # # # # # # # # # # # #@+ 3`@;  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@a> `L """"""""""""""""@2?# * 2  `Lc  @ `L> ? @ 3 >  c@  Њb@&""""  > 5`Ԕ@ @> ` ``44: " longjmp botch@" `&"`㿠>+@z"<6 0㿘``@`€Ð  ``€  `€ <`㿘``€  *`,`€ ``€  `€ >怎㿘 ͖  Ȗ Ö   ``€e ```€ ] ``€W @€` ```€ J ``€D    .@€` 2```€ 1 ``€+ 耤 ``€"   㿘M e  ` [ V  Q L ``€ x0llllHll( `!<!"# #D#t##$$0???0?<?889$909<9X9t??99999?;<=,=p==;?????????;;??????????????>,;;;;;>?????????;A<A<A<A<A<A,A,A<A<A<A,A,A,A,A,AA<A<A<A<A<A,A,A<A<A<A<A<A<A<A,K`ABPBxEEFFFFG GHGpGGGHH8H`HHHMMIlIIIIJ@JhJKxLPMMMMMMLLMPMx!=> `.!=B  !  €* 2 aS 2  ؐ`€ * 2 ` 2  ؐ`€ * 2  "   `@  7@& @2  6 6 6  @ &  ؐ`    /     6 6 6! 6!  6 6!6 6!  `@ ` : ` "> 0  >  @ >    >!! ؐ`   ؐ`!  ؐ`   ؐ`(  ؐ`  . ` ܒ <.   "> "a  d ܀ . >!0  > !8 >!@2>>!H!P  `v€a id+ &>@2"+ @>>$!`@>>$ !h @>>$!x @9Ŗ   >3  @9        av€a  ̀id+ '>@#+ @>>$!` @>>$!h  @>>$!x >3  @9t x  ؐ` ܟ€  `*`>,"  €>@9] >  (!>  (!>  <!>  < !>  <!>  <!. .   `v€! > @91 *@$  ` € * 2``2   > @9  $ <.  *@$ *`"   @ +.    >!>!`" @   `  Q d !   "  ؒ B    `  ; d !     ؒ @   ؐ`  ` ## d?<    >€b 0    `€  "  0 `€      ؐ`   ؐ`   % @ d ؐ`    5  `( `€ * 2 `  !  `€  * 2 `  ؒ @`€ * 2 ` @  .   0   /(    @  `@   `" @  /  # d? X> ؐ`€* 2   7@$[ J  @7/b <)!777777@$> 耢.7" @/"?#@! )!@"  >#`#\`@7 0 `$   "    /#( 3``$ &!d`$ 6!^6!`77`$ @#7  !`>"@7  77@#ܔ 耢@>Ŕ   &  * >& Ȑ@7q @ 77@# Ґ!    ` ` 477@#  7@# @ 2  ` ꀥ   %6 6 6 6 6 6 䀥  ># >#( > #\  #`#d@7( "D@  * *`     2 >82 @7  ؐ`€  >X@7  怢> 耢    x @6  7@#F 5>6 *` @62@$  @ >!=  .!=`       `  & 8@6 0& 㿘@%H     2 @%=  @ɐ0@㿀  ܀   2   2 @2     `. 27 ` 7 `  7 7  @"7ߐ 67@2` `72 7@" 耤ΐ 57@2`2` `@ 722   7@" 耢 3>@3`2 23`#\Ж   `@61  37 `7 7@"~ 耤 > ` @6 0 17`7 7@"i 耢@     2 @y  ? # S!z!x @7777777@"D ^ R!t6!D!v!7777777!z !x @77777@"$ > !t6!D!v!77777@" 耢,6!@!@6!B  J? 7耢 7 7 ?  7ꀤ @! @>0@5 !=  .!=㿀.`*  ܐ *  07.`  7 @!͔ @>P  71@5h ,*  2``d  2   `.`,  8@77ꀌ 77  2 * @7> 2 #\#`x @54@! ' 8@7777@!x 耢$*  72    977 7 7@!\ @2  , *  @2  !=2 != *  `@.!=!=!=  `@.!=0` 㾨'D > '|#'@'|D 0"2` ` @ `D  ` /  |?# @3DD@  * *`   ||@ 7@|@|!D22 `2?#| @3|1 * 2 '@ 1 >D' @4z$$1 | *`  1  >D'@4j  1 |`  1 `>D'@4[  1 | `) |D  ) 1  /2DD    1   @   D @ 0 @  1 @D  /D @ ` 1 @`  D D  1 DD  *  *`  '  8 77'77@ Z D  `/ ) Dؐ `  'D ؐ ` D  ؐ `!Dؐ` D  ?h }?p zpp/`'\t*`l'Lh2 7 'X'/`Xt\2'H'dHpt*L3 h'<'8l'T+8'$<*`3 2 'D p@ $ 3 '4    37`p7 ',  3'`7 7`p p7 7`  'P'@'0'( 1 g>) W8) G) ) ) /) ) ) ) ) ) ) lt#\4w) 7 ) o) ) D@3]' D> '@3Uh? *@1 D!av @ax>ataz1 (1 $ 1 & @1 2 D1 *1 01 ,1 .1 41 6D @36'|  @ ) )( (`2    0?# @2 *`@0D2    0?# @2 *`@0D2    0?# @2 *`@0D 2    0?# @2 *`@0   ) ) (  ((  0 * D 2    0?# @2 *`@0   ) ) ( ( * D`2    0 ?# @2 *`@0 D`2   " 0"?# @2 *`@0"D2   $ 0$?# @2 *`@0$D2   & ??# @2 *`@?#0&(  D 2   3 @2 *`@3 ?#0  D`2   3 @2 *`@3 D`2   8 08?# @2 *`@08 : ;) ;) :(: ;(;D2   < 0<?# @2 *`@0<D2   @ 0@?# @2 *`@0@ B C) C) B(B C(CD 2  " D D?# @2 *`@0D| ` 7 77  7D7777@P @;> D7!@!@7!B7!D!=  /!=!= `` /!=;> c >@ !㿈 ܒ c7! 7   7` 77@!7@ ?  " @@ *  `@.@ ܐ (? (㿈 ܐ d7.`# 7`7 777@ @`?@'Ӑ 㿈.` j7耦  7`7@є @5  3 /`*`-5*0  0    5`- @   -4`, @ @ -`,` @ 6@   @ > #`ܨ 'd'`;'h-B5>@΄'\\@d 2  @\@ d2`@ `\ @1 d \2 d@2   x@]'\x"@|'p\"'tА"@'p'tp*" * "@*`@ t*`@ *`" *  * : Dx+`+ " "@ * *`"" **  *|* **# #@ + +` @ #\>h'\8+ +`#`@0 \А"?@hb@@ b?'h ` `?` `` `H 0 '\\` e6` 2@ H /d * % `   ` `H 0 e6@ ?D 8`;ʀ@8`'\@#\`  `  `?` `` `H 0  '\\` @h` <hH /d * % `   `) `H 0 "h h#;ʀ('\he6@ ?D 'h;ʀ@h#'\@[h\@'hh͐d2   2? 7'\@E @\?d*`  /d 8 d *  @#@ ?"@d d ?# + #` 22`C`* *``  %        '\ ~ \` ~`'ld@ ? "@* *`  *`d "- ,`+`(  l5`   @ 5-  @-`6`. .- .`d/   (  ?`+`(  ,`5- @ 6`.  @-5`- .`-`    ?`d 03  @ " **  '`l/`d#d "@-_'\\@ ڐ\d ?#d@k ?d ""d?c !"``/ ]7'\7@? \ d> @.۔`d   #\d> c 2`  `#\@>*  @d#`  @.'\d@3 \ ` *`  d*  (#7+ d *` d*  (@``@2@d` @2@`d@2@@2 @  @2@$$ d@ '@d  'h'\@,ɔh\d `/`d'``?`` ?``2 "@" @@" @@ ?@ ?  ?  '@@`'@d  'h@,h > # >@d"x >,$* >">">">"> "> ">">">#㾰> 'D #''2     ?2`   2`  @D ?@ 0g` "@ 0(" ? ((!  ` @*<  '!D '@, @ `@  !   2     ! '| '||*, ' @* *` (`(@@ ?'"@*` *  *  *  : ?'t`v'  @r 'x @l ` 2`D' `ʔ  'l?h,`'\'T( -'d'<T'4?P ', ?`\?0<'L l?Xd?8'D'$- L  , @ ?h?H?(-`4 D 0 ?@0 h, L?`H, (2 T*`P$@?h+` 3 ? @-T5 `,@.`D @$@ *32?`.`` @h?`, @?h.`h 4L@?hD*``.`h-`?`@`   ?`@ $ `-   0@3 ?h5?`* *`   @2+ 2' @2# `2 d22` 2`2t`!2 >D'( @, @ /'`?`8`  q2`D' `ؔ $ q7  *`D7'7@7>`#*` ** * :  @,\D ?o!@ og`S?%* *  *  *  : ' ~) x5 R`~ o7  *`x7D'77@ /'`G?@` 2>,"D*` €+ &'>&@* +  + +    D'; @,  !  ) >'Dx@+ !'  ~`~2 ) D9'  > D@+ؒ  /'`  > D'@+ƒ * *`   >  02  !-,`+`(  5   6`.   @-5`-   .`-`    9 +`(  ,`5- @  6`. @-5`- .`-`      @#9   @" * *  *  *    !: 'D' @)'D'@@+4 > ?! 3 D' @+&  q7 *7D 7@q7 /'`5 | *  (@ q?  0(#!> # >@%#> 'D# '2        ~_ [ pe' ('@+ '@̖ * * `( '  D'' 7 ?`2   *`` @ 'D?`2   ``@  ?`'D'  2    ?2   @ 'u`>D@*y ? +`(,`  5-   6`.   @-5`-   .`-`    ?`+`(  ,`5-  6`. @  -5`- .`-`    ?` 02  @' * *`  '`/` 8' ' (!)  **@ *` `(*"`( *  * ) *  ( " ( ' /''8+  * @`@   @' 8*` *  ` +` *  @x!  t )  ,#\>#`,x'D@)  (*` * *@ *` *"`, * * )+  *  (+ `" ( * *  * ( ` ?  :"(, *  ;>+  *  @2    2 D c'@)S* * ( ?"( ( % (  ۬  @t'6+  *  ,> )D'@)) t 8+ @ *`     @ 8@ @`@@2`@2 '>D'H@) M'0*` * * )+  *+`@  * :+`* * @ *` 0 ;+`+  * (  * ( ? "(+`*` * , +` +   *# , (D`"(' @'  '*  (@ "ؒ"@*` *  *  *   @ 2```@ < 'D @&@W `@   0&'> # >@Ħ#X㿀> #'@Ŕ @ ";  2`  2@ p""@@28?``>,"l*` €>#h>#p>#>#> #> #>@" >@(2 ?@2`  ?2`   ?c >@I > # '@` p$ @Ѱ  ( p#@ @ 'd@'`d "0@@ `!q#4 @ !c 2`4 4 4 4 4 4 $ ` 2  @  @@?# @2 *`@3 2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2    3 ?# @2 *`@3  2  "  ?# ? ** @2@ 2@ #  2  "  ?# ?*  *@2@ 2@ #  n7Ȓ ! 7ʐ @@7 Ȑ'd'`777d  `@2`   p" @@2   հ? @ `((@  @ +` +` +` +` +` +` +` 2    *`?# @2 *`@*`2`@3` 2  "  ?# @2 *`@* 2  3` `+` `'+`  '+`  +`  +  -  2` `  @"` `   ` `" >>'d`0 `@&#\d V@`?`?''x''p'|'lp 'd@M'`<*l*  ''l |*` x* @ @ '@5 d  `7@ ` !7@ !`a 2`7' 7777`@ 2  ' ? @ 2 *`@3 2    3 ?c @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2  "  ?c ? **` 2 2 #  2  "  ?# ? **` 2 2 #  7ʐ n 7Ȓ`@  @ 7`'d'`777d  `@2`   p" @@2    @ !!/@ /` /` /` /` /` /` 2  /` ?# @ 2 *`@ *`2`@ 2  7`   ?c @ 2 *`@* 2  7` `'t/`  t/` /` /` +  `  @ >` >`'d#\'``{8` `+``(`,`` ` `5-   6`.   @-5`-   .``-`    ? 'd@'` 7d @ ` 7  @ !!2  7 7 7 7 7 `  `2 ' @ , 3 2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ? @ 2 *`@3  2    3 ?c @ 2 *`@3  2  "  ?# ? **` 2 2 #  2  "  ?c ? **` 2 2 #  7ʐ n 7Ȓ`@  @ 7`'d'`777d  `@2`  j p"g @@2   a @ !!/@ /` /` /` /` /` /` 2  /` ?# @ 2 *`@ *`2`@ 2  7`   ?c @ 2 *`@* 2  7`  t/` /` /` /` +@    `  @>` `>'d#\'``@@# d@2   E`[?` `+``(`,`` ` `5-    6`.  @  -5`- .`-``    ?l @ ( 7'p'd'`@! `dl `$p 2 @>'dH@#B d@ 0$ @> # >@` h@>  ܠ#'@ <  7@  a4 @ "!2 4 4 4 4 4 ` !4   ` 2 4 4  @  ?# @2 *`@?#0    2   2 @2 *`@2? 2    ??# @2 *`@?#0    2  2 @ 2 *`@2? n  77 @@7 777@  @>x@"  >@ϐ 8> c   *'& & ,` `2   a=2   >@"   `  ,4 2   >  @"m m  ``m `2   `   } T& , N2`  }I 2`    & ,2 / e- h   o"2`  2 h2`  2 h2`  2`   -  2  h /(`2 h-*  (  2 2 >@" @ & , e a= "`@Ɛ`ؠ `€4a@a@4?aB4?*al  4? @  77> a=  `       @?# a=2  : ݐ@ @   -`,4 , ,`2  " ,,  , ,  ,  ,  ,  , `2  " ?  **` 2 2 $ `2   , , ,  , `2   4 @2 *`@4 `2   4 @2 *`@4 `2  4  @2 *`@4 `2  4  @2 *`@4   $   * ? # '? ?   `2  "@ @ *  *@ 2 @ 2 @ `2   @@ *  *@ 2 @ 2 @#$?ؚ``ؐ`` 4aB a=*@2   a=* *`  `,a= `4a@a@6aB6*al  6 @  77>`@@ @ , `   ,   ,, ` "    2  J`   d`ܔ̑-*  h"    4   d, ` "`    4  `  4 ,   @#* `4   4` aJ   ah "   *@`22ah ?*"@0`쀢" 4aJ >P$`ؐ`@`g" `.`쀢@*ah* &"@8@ .  & , f& , >J@h $  2   #` @@ #\`ؐ`` g4aBa> 4a># >@3!㿈 >,"* €>@ ?  7耊`7 `7 7    7 7 != 2* != *  `@.!=@  @2ΰ?>Ȗ@ ư ?# :..`@  777@  @2?> @!= *2!= *  `@.!=      !h*@ * +  2 >@s {?  2 ` `7  `.`7777.`  7.* @ 777; @ R  L D > 8 "3?3/ "*?&   b7 @ h@?   ' @ R  ?p> #'  . Z?.!!=`B 2.>!!< !L2@    <  `€4  `!^ " @  # & @z != .!= .>@2@   2`@ # . 2` @@2" !=2   2 !=2   $.`>25 p@  ؐ! €!* 2    `@ ؐ`  ^#  / `€!!D* 2`  7>!D@W  !D7   02/   8+ ؠ  ؐ`€! ت`€!* 2 -`2 @ #$ ؀@  `@>@" #`€!-`2@ 6!F2H ؀ 2E   /( t d ؐ`€! ت` ` €-`2@'   / `€  ش`€ .!.``B >!,`>#\23  @Λ4  6!F `@ ؐ`  !H #4  6!H ?# *  !p  ?2` 7` ` ``" 2   @.`.`.` ..`.`.`. 2  "` `? *` * 2 2  2  &`` @2 *`@ 2  6` ` @2 *`@ 2  6 ` ` @2 *`@ 2  6 `` @2 *`@ 2  6`` @2 *`@ 2  6`` @2 *`@ 2  6 ``?  **` 2 2 &   *   * .X 2   p@/q`/p`/s` /r@/p`/q`/r`/sr  *r  ?2  ct`* @2 *`@3@ r rt*2@r  rt, @ @7r, r!: *6!:А@ߖ " !Fǐ2   @.`.`.` ..`.`.`. 2  "` `? *` * 2 2  2  &`` @2 *`@ 2  6` ` @2 *`@ 2  6 ` ` @2 *`@ 2  6 `` @2 *`@ 2  6`` @2 *`@ 2  6`` @2 *`@ 2  6 ``?  **` 2 2 &   *   * 5>Ș#\@   %>#>`@  /'>%> `  X@ۖ  @2` h@ @/@ @  - >  @Ԑb ؀ >8@˒  >P@Ò  >`@  >x@    2@o @> @) ؀  (!h *  ?`"* @S @  >А@~   ؘ >@s  ؐ`!02 ` *2 @!h* "@  $`,` !=2` `$``!=*  .!= $`, "  "  6  @" ,`X>@`, 2  `X 2  $`,  >$`( " `X 2"`, 2 $`, `4 f "J>`   d ܔ̑* *  @ " ` != d  !=  .!=->@2 $`( , "$`($`( @> `X 2`$""`$`, 2 $`, `4   6 >`$ @ @"`$  (,`X $`,`, 2 `$>@@  $`,`$ $`(h@ `, 2`$ $`,`$ "     2 0`, 2 `X ( @" `X `6   W 0  . ?` ( 8 > 2 `$#\`( #` `X #d#h`,#l@O!> "-!>?6!>-" @ @@ -`2   `! ؐ`€ !86!@@&6!8 6!D6!H#, `!(B@*>!( , # >@5 㿀    2 '  ` €* 2 '.`4 > @@?ߐ#@`?>,"ē*` €!= 2*  != *  `@.!= @# @ @  @ ?>)>& ؐ`€ >@ 0v> @ 0o>8@ >=X>h>@   `€@h!>d0.`D>@@.`>@x   *# * "  1"А@d    " * # * ">@O   *@"  " * ">2@9 != 2* != *  `@.!='!#'!N '!'!'!'I > @0!0`B  >!0  `€ 2`  ܐ "  pa"!= .!=F @G  @2     쀢  !h*@ " " , &!h>H@Ԓ !=  ܔ.!= "  pa"1 !=  ܔ.!= "  p"  !=  ܔ.!= "  p" != `` .!= " @  ܐ pb" @Ք | @  ?  "@Ð!=   ܔ.!=  ?" ܐ @#>p@_ Y  `€梐.` miniroot:\ :ty=winchester:se#512:nt#2:rm#300:ns#64:nc#96:\ :ts=3500:\ :pa#12288:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#0:ob#0:\ :pc#12288:oc#0: rdroot:\ :ty=ramdisk:se#512:nt#2:rm#300:ns#4:nc#544:\ :pa#4352:oa#0:ta=4.2BSD:ba#8192:fa#1024:\ :pc#4352:oc#0: floppy|floppy3|3in|3.5in High Density Floppy:\ :dt=floppy:ty=floppy:se#512:nt#2:rm#300:ns#18:nc#80:\ :pa#2880:oa#0:ba#4096:fa#512:ta=4.2BSD:\ :pb#2880:ob#0:\ :pc#2880:oc#0: fakecdrom|Fake image for Bootable CDROM:\ :ty=winchester:se#512:nt#1:rm#350:ns#640:nc#2048:\ :pa#1310720:oa#0:ba#8192:fa#1024:ta=4.2BSD:\ :pb#1310720:ob#0:bb#8192:fb#1024:tb=4.2BSD:\ :pc#1310720:oc#0:bc#8192:fc#1024:tc=4.2BSD:\ :pd#1310720:od#0:bd#8192:fd#1024:td=4.2BSD: ASI-1.0GIBM:\ :ty#winchester:ns#80:nt#15:nc#1632: Arte DEC DSP3160S:\ :ty#winchester:ns#112:nt#16:nc#1744: CDC 9720-850:\ :ty#XD7053:ns#66:nt#15:nc#1358: CDC EMD 9720:\ :ty#XD7053:ns#48:nt#10:nc#1147: CDC EMD 9720-1230:\ :ty#XD7053:ns#82:nt#15:nc#1633: CDC IPI 9720:\ :ty#ISP-80:ns#82:nt#15:nc#1631:\ :pa#33210:oa#0:ba#8192:\ :pb#131610:ob#33210:\ :pc#2006130:oc#0:\ :pg#196800:og#164820:\ :ph#1644510:oh#361620: CDC IPI 9722:\ :ty#ISP-80:ns#156:nt#7:nc#1630:\ :pa#33852:oa#0:ba#8192:\ :pb#132132:ob#33852:\ :pc#1779960:oc#0:\ :pg#197652:og#165984:\ :ph#1416324:oh#363636: CDC Wren IV 94171-344:\ :ty#winchester:ns#46:nt#9:nc#1545: CONNER 30170E:\ :ty#winchester:ns#46:nt#8:nc#897:\ :pa#14720:oa#0:ba#8192:\ :pb#40480:ob#14720:\ :pc#330096:oc#0:\ :pg#274896:og#55200: CONNER 30200:\ :ty#winchester:ns#49:nt#4:nc#2121:\ :pc#415716:oc#0: CONNER CFP4207S 4.28GB:\ :ty#winchester:ns#125:nt#20:nc#3353:\ :pc#8382500:oc#0: CONNER CP3500-540MB-3.5:\ :ty#winchester:ns#50:nt#12:nc#1768:\ :pc#1060800:oc#0: CP3100:\ :ty#winchester:ns#49:nt#4:nc#1023:\ :pc#204864:oc#0: Conner CFP1060:\ :ty#winchester:ns#111:nt#8:nc#2329: Conner CP3540:\ :ty#winchester:ns#49:nt#12:nc#1805: DEC DSP3107L:\ :ty#winchester:ns#83:nt#8:nc#3147:\ :pc#2089608:oc#0: DEC DSP3210 2 GB:\ :ty#winchester:ns#86:nt#16:nc#3040:\ :pc#4183040:oc#0: DEC DSP5200:\ :ty#winchester:ns#71:nt#21:nc#2619:\ :pa#32802:oa#0:ba#8192:\ :pb#65604:ob#32802:\ :pc#3904929:oc#0:\ :pg#3806523:og#98406: DEC DSP5350:\ :ty#winchester:ns#91:nt#25:nc#3053: DEC_RZ26:\ :ty#winchester:ns#57:nt#14:nc#2568:\ :pa#66234:oa#0:ba#8192:\ :pb#132468:ob#66234:\ :pc#2049264:oc#0:\ :pg#1850562:og#198702: DEC_RZ28:\ :ty#winchester:ns#84:nt#16:nc#3043:\ :pa#64512:oa#0:ba#8192:\ :pb#196224:ob#64512:\ :pc#4089792:oc#0:\ :pg#3827712:og#260736: DEC_RZ58:\ :ty#winchester:ns#85:nt#15:nc#2112: DEC_RZ58_whole_disk:\ :\ :pc#2692800:oc#0: DEC_RZ74:\ :ty#winchester:ns#91:nt#25:nc#3053:\ :pa#65975:oa#0:ba#8192:\ :pb#193375:ob#65975:\ :pc#4192825:oc#0:\ :pg#3931200:og#259350:\ :ph#2752750:oh#4192825: Fujitsu M2243AS:\ :ty#ACB4000:ns#17:nt#11:nc#752: Fujitsu M2246E:\ :ty#winchester:ns#35:nt#6:nc#1196:\ :pa#16170:oa#0:ba#8192:\ :pb#28140:ob#16170:\ :pc#251160:oc#0:\ :pg#206850:og#44310: Fujitsu M2263SA:\ :ty#winchester:ns#53:nt#15:nc#1652: Fujitsu M2266SA 1.2GB:\ :ty#winchester:ns#85:nt#15:nc#1652: Fujitsu M2266SA 1GB:\ :ty#winchester:ns#85:nt#15:nc#1642: Fujitsu M2344K:\ :ty#XD7053:ns#64:nt#27:nc#622: Fujitsu M2511A:\ :ty#winchester:ns#25:nt#1:nc#9950: Fujitsu M2512A small:\ :ty#winchester:ns#25:nt#1:nc#9950:\ :pc#248750:oc#0: Fujitsu M2512A v2:\ :ty#winchester:ns#25:nt#1:nc#17840:\ :pc#446000:oc#0: Fujitsu M2622SA:\ :ty#winchester:ns#64:nt#7:nc#1429:\ :pc#640192:oc#0: Fujitsu M2624FA:\ :ty#winchester:ns#64:nt#11:nc#1440:\ :pa#22528:oa#0:ba#8192:\ :pb#67584:ob#22528:\ :pc#1013760:oc#0:\ :pg#450560:og#90112:\ :ph#473088:oh#540672: Fujitsu M2652SA:\ :ty#winchester:ns#88:nt#20:nc#1935: Fujitsu M2654SA:\ :ty#winchester:ns#88:nt#21:nc#2174: Fujitsu M2684S:\ :ty#SCSI:ns#74:nt#6:nc#2338: Fujitsu-M2284/M2322:\ :ty#XY450:ns#32:nt#10:nc#821: Fujitsu-M2312K:\ :ty#XY450:ns#32:nt#7:nc#587: Fujitsu-M2333:\ :ty#XD7053:ns#67:nt#10:nc#821: Fujitsu-M2351 Eagle:\ :ty#XD7053:ns#46:nt#20:nc#840: Fujitsu-M2361 Eagle:\ :ty#XD7053:ns#67:nt#20:nc#840: Fujitsu-M2372K:\ :ty#XD7053:ns#67:nt#27:nc#743: Fujitsu-M2382:\ :ty#XD7053:ns#81:nt#27:nc#743:\ :pa#80919:oa#0:ba#8192:\ :pb#129033:ob#80919:\ :pc#1624941:oc#0:\ :pd#470205:od#209952:\ :pe#944784:oe#680157:\ :pf#209952:of#0:\ :pg#1414989:og#209952:\ :ph#1544022:oh#80919: Fujitsu-M2624S-512:\ :ty#winchester:ns#64:nt#11:nc#1429: Fujitsu-M2651SA:\ :ty#winchester:ns#88:nt#16:nc#1934:\ :pc#2723072:oc#0: Fujitsu-M2694ESA:\ :ty#winchester:ns#77:nt#15:nc#1830: HP 97549T:\ :ty#winchester:ns#64:nt#16:nc#1909: HP 97556:\ :ty#winchester:ns#72:nt#11:nc#1668: HP 97558:\ :ty#winchester:ns#72:nt#15:nc#1933: HP 97560:\ :ty#winchester:ns#72:nt#19:nc#1933: HP C2247 1.05GB:\ :ty#winchester:ns#95:nt#13:nc#1661:\ :pc#2051335:oc#0:\ :pg#1640080:og#0:\ :ph#411255:oh#1640080: HP C3010 / Cranel 2.0GB Fast SCSI2 H10:\ :ty#winchester:ns#95:nt#19:nc#2165: HP97548SU 664MB:\ :ty#winchester:ns#56:nt#16:nc#1445:\ :pa#35840:oa#0:ba#8192:\ :pb#71680:ob#35840:\ :pc#1294720:oc#0:\ :pg#197120:og#215040:\ :ph#342720:oh#609280: Hewlett Packard C2490A:\ :ty#winchester:ns#107:nt#18:nc#2159: Hewlett Packard C3323A:\ :ty#winchester:ns#98:nt#7:nc#2995: Hewlett Packard C3725S:\ :ty#winchester:ns#140:nt#9:nc#3362:\ :pc#4236120:oc#0:\ :ph#4193280:oh#1260: Hitachi DK315C-10:\ :ty#winchester:ns#75:nt#11:nc#2467: Hitachi DK315C-11:\ :ty#winchester:ns#58:nt#15:nc#2478: Hitachi DK315C-14:\ :ty#winchester:ns#75:nt#15:nc#2462: Hitachi DK326C-10:\ :ty#winchester:ns#87:nt#7:nc#3200: Hitachi DK326C-6:\ :ty#winchester:ns#87:nt#4:nc#3200: Hitachi DK515C-78:\ :ty#winchester:ns#69:nt#14:nc#1354: Hitachi DK516C-16:\ :ty#winchester:ns#80:nt#15:nc#2170: Hitachi DK517C-37:\ :ty#winchester:ns#81:nt#21:nc#3297: Hitachi DK815-10:\ :ty#XD7053:ns#67:nt#15:nc#1735: IBM 0662-S12:\ :ty#winchester:ns#114:nt#6:nc#3002: IBM 0662S12:\ :ty#winchester:ns#108:nt#5:nc#3803: IBM 0663-E15:\ :ty#winchester:ns#37:nt#20:nc#3182: IBM 0663L12:\ :ty#winchester:ns#66:nt#15:nc#1979:\ :pc#1959210:oc#0: IBM 0664-M1H/N1H:\ :ty#winchester:ns#86:nt#16:nc#2856: IBM 0664CSH:\ :ty#winchester:ns#125:nt#30:nc#2787: IBM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM DFHSS1x:\ :ty#winchester:ns#125:nt#4:nc#4383: IBM DFHSS2x:\ :ty#winchester:ns#125:nt#8:nc#4388: IBM DFHSS4x:\ :ty#winchester:ns#125:nt#16:nc#4390: IBM DPES-31080:\ :ty#winchester:ns#108:nt#4:nc#4901:\ :pc#2117232:oc#0: IBM DSAS-3270:\ :ty#winchester:ns#108:nt#2:nc#2542: IBM DSAS-3360:\ :ty#winchester:ns#108:nt#2:nc#3297: IBM DSAS-3540:\ :ty#winchester:ns#108:nt#3:nc#3259: IBM DSAS-3720:\ :ty#winchester:ns#108:nt#4:nc#3292: IBM OEM 0664M1H:\ :ty#winchester:ns#94:nt#15:nc#2787: IBM OEM DFHSS2F:\ :ty#winchester:ns#135:nt#8:nc#4076:\ :pa#4100760:oa#0:ba#8192:\ :pb#301320:ob#4100760: MAXOPTIX (NON-ISO, 1024b) DATA:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 1024b) SYSTEM:\ :ty#winchester:ns#66:nt#1:nc#15104: MAXOPTIX (NON-ISO, 512b) DATA:\ :ty#winchester:ns#60:nt#1:nc#15081: MAXOPTIX (NON-ISO, 512b) SYSTEM:\ :ty#winchester:ns#60:nt#1:nc#15081: MICROP 4221-09MZ 10204:\ :ty#winchester:ns#139:nt#9:nc#3198:\ :pc#4000698:oc#0: MICROPOLIS 1991-27:\ :ty#winchester:ns#149:nt#27:nc#4400: MICROPOLIS 3243-19:\ :ty#winchester:ns#106:nt#19:nc#4139: MICROPOLIS 4110-09:\ :ty#winchester:ns#95:nt#9:nc#2283: Maxtor 7213SR NB:\ :ty#winchester:ns#65:nt#4:nc#1595:\ :pc#414700:oc#0:\ :pg#414700:og#0: Maxtor DXP3105S:\ :ty#winchester:ns#57:nt#14:nc#2568: Maxtor LXT-200S:\ :ty#winchester:ns#43:nt#7:nc#1117: Maxtor LXT-340SY:\ :ty#winchester:ns#70:nt#7:nc#1355: Maxtor LXT535ST:\ :ty#winchester:ns#61:nt#11:nc#1547:\ :pc#1038037:oc#0: Maxtor MXT1240S:\ :ty#winchester:ns#70:nt#15:nc#2306:\ :pc#2421300:oc#0:\ :pg#2421300:og#0: Maxtor P0-12S (1632):\ :ty#winchester:ns#90:nt#15:nc#1478:\ :pc#1995300:oc#0:\ :pg#1995300:og#0: Maxtor P0-12S (1795):\ :ty#winchester:ns#90:nt#15:nc#1510:\ :pc#2038500:oc#0:\ :pg#2038500:og#0: Maxtor P1-17S:\ :ty#winchester:ns#83:nt#19:nc#1816:\ :pa#78850:oa#0:ba#8192:\ :pb#78850:ob#78850:\ :pc#2863832:oc#0:\ :pd#78850:od#157700:\ :pg#2469582:og#236550:\ :ph#78850:oh#2706132: Maxtor P1-17S NB:\ :ty#winchester:ns#90:nt#19:nc#1711:\ :pc#2925810:oc#0:\ :pg#2925810:og#0: Maxtor XT-1050:\ :ty#ACB4000:ns#17:nt#5:nc#1020: Maxtor XT-3280S:\ :ty#winchester:ns#25:nt#15:nc#1222: Maxtor XT-4380S:\ :ty#winchester:ns#36:nt#15:nc#1202: Maxtor XT-8380S:\ :ty#winchester:ns#53:nt#8:nc#1626: Maxtor XT-8610E:\ :ty#winchester:ns#52:nt#12:nc#1626: Maxtor XT-8760E:\ :ty#winchester:ns#50:nt#15:nc#1616:\ :pa#97500:oa#0:ba#8192:\ :pb#63750:ob#658500:\ :pc#1212000:oc#0:\ :pd#280500:od#97500:\ :pe#280500:oe#378000:\ :pf#489750:of#722250:\ :pg#561000:og#97500:\ :ph#658500:oh#0: Maxtor XT-8760S:\ :ty#winchester:ns#54:nt#15:nc#1614: Micropolis 1304:\ :ty#ACB4000:ns#17:nt#6:nc#825: Micropolis 1325:\ :ty#ACB4000:ns#17:nt#8:nc#1022: Micropolis 1355:\ :ty#winchester:ns#34:nt#8:nc#1018: Micropolis 1528-15:\ :ty#winchester:ns#83:nt#15:nc#2102:\ :pa#32370:oa#0:ba#8192:\ :pb#64740:ob#32370:\ :pc#2616990:oc#0:\ :pg#2519880:og#97110: Micropolis 1548-15:\ :ty#winchester:ns#131:nt#15:nc#1701:\ :pa#33405:oa#0:ba#8192:\ :pb#66810:ob#33405:\ :pc#3342465:oc#0:\ :pg#3242250:og#100215: Micropolis 1558:\ :ty#winchester:ns#35:nt#15:nc#1218: Micropolis 1578-15:\ :ty#winchester:ns#35:nt#15:nc#1231:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#646275:oc#0:\ :pg#548625:og#97650: Micropolis 1588-15:\ :ty#winchester:ns#53:nt#15:nc#1637:\ :pa#32595:oa#0:ba#8192:\ :pb#65190:ob#32595:\ :pc#1301415:oc#0:\ :pg#1203630:og#97785: Micropolis 1598-15:\ :ty#winchester:ns#70:nt#15:nc#1931:\ :pa#32550:oa#0:ba#8192:\ :pb#65100:ob#32550:\ :pc#2027550:oc#0:\ :pg#1929900:og#97650: Micropolis 1624-7:\ :ty#winchester:ns#114:nt#7:nc#1647:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#1314306:oc#0:\ :pg#1216152:og#98154: Micropolis 1674-7:\ :ty#winchester:ns#35:nt#7:nc#1255:\ :pa#16415:oa#0:ba#8192:\ :pb#32830:ob#16415:\ :pc#307475:oc#0:\ :pg#258230:og#49245: Micropolis 1684-7:\ :ty#winchester:ns#53:nt#7:nc#1785:\ :pa#32648:oa#0:ba#8192:\ :pb#65296:ob#32648:\ :pc#662235:oc#0:\ :pg#564291:og#97944: Micropolis 1908-15:\ :ty#winchester:ns#95:nt#15:nc#1890:\ :pa#32775:oa#0:ba#8192:\ :pb#65550:ob#32775:\ :pc#2693250:oc#0:\ :pg#2594925:og#98325: Micropolis 1924-21:\ :ty#winchester:ns#94:nt#21:nc#2072:\ :pa#33558:oa#0:ba#8192:\ :pb#67116:ob#33558:\ :pc#4090128:oc#0:\ :pg#3989454:og#100674: Micropolis 1926-15:\ :ty#winchester:ns#101:nt#15:nc#2769:\ :pa#33330:oa#0:ba#8192:\ :pb#66660:ob#33330:\ :pc#4195035:oc#0:\ :pg#4095045:og#99990: Micropolis 1936-21:\ :ty#winchester:ns#101:nt#21:nc#2772:\ :pa#33936:oa#0:ba#8192:\ :pb#67872:ob#33936:\ :pc#5879412:oc#0:\ :pg#2846382:og#101808:\ :ph#2931222:oh#2948190: Micropolis 2105-8:\ :ty#winchester:ns#94:nt#8:nc#1448:\ :pa#32336:oa#0:ba#8192:\ :pb#64672:ob#32336:\ :pc#1088896:oc#0:\ :pg#991888:og#97008: Micropolis 2108-10:\ :ty#winchester:ns#94:nt#10:nc#1450:\ :pa#31960:oa#0:ba#8192:\ :pb#63920:ob#31960:\ :pc#1363000:oc#0:\ :pg#1267120:og#95880: Micropolis 2112-15:\ :ty#winchester:ns#94:nt#15:nc#1452:\ :pa#33840:oa#0:ba#8192:\ :pb#67680:ob#33840:\ :pc#2047320:oc#0:\ :pg#1945800:og#101520: Micropolis 2205-05:\ :ty#winchester:ns#109:nt#5:nc#2088:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#1137960:oc#0:\ :pg#1039860:og#98100: Micropolis 2210-09:\ :ty#winchester:ns#109:nt#9:nc#2099:\ :pa#33354:oa#0:ba#8192:\ :pb#66708:ob#33354:\ :pc#2059119:oc#0:\ :pg#1959057:og#100062: Micropolis 2217-15:\ :ty#winchester:ns#109:nt#15:nc#2105:\ :pa#32700:oa#0:ba#8192:\ :pb#65400:ob#32700:\ :pc#3441675:oc#0:\ :pg#3343575:og#98100: Micropolis 4110:\ :ty#winchester:ns#114:nt#9:nc#1998: Micropolis 4221:\ :ty#winchester:ns#109:nt#9:nc#4079:\ :pa#4001499:oa#0:ba#8192:\ :pc#4001499:oc#0: NEC D2363:\ :ty#XD7053:ns#67:nt#27:nc#964: NEC-D2352:\ :ty#XD7053:ns#57:nt#19:nc#758: Quantum ELS 127S:\ :ty#winchester:ns#54:nt#3:nc#1541: Quantum ELS 170S:\ :ty#winchester:ns#54:nt#4:nc#1542: Quantum ELS 85S:\ :ty#winchester:ns#54:nt#2:nc#1535: Quantum Empire 540S:\ :ty#winchester:ns#92:nt#8:nc#1431: Quantum Empire 1080S:\ :ty#winchester:ns#92:nt#16:nc#1431: Quantum Empire 2100S:\ :ty#winchester:ns#137:nt#12:nc#2497:\ :pc#4105068:oc#0: Quantum GoDrive 120S:\ :ty#winchester:ns#56:nt#4:nc#1067: Quantum GoDrive 160S:\ :ty#winchester:ns#58:nt#4:nc#1413: Quantum LPS 105S:\ :ty#winchester:ns#42:nt#4:nc#1221: Quantum LPS 120S:\ :ty#winchester:ns#60:nt#2:nc#1987: Quantum LPS 240S:\ :ty#winchester:ns#60:nt#4:nc#1995: Quantum LPS 270S:\ :ty#winchester:ns#76:nt#7:nc#992: Quantum LPS 525S:\ :ty#winchester:ns#70:nt#6:nc#2444: Quantum LPS 540S:\ :ty#winchester:ns#125:nt#4:nc#2113: Quantum Lightning 730S:\ :ty#winchester:ns#63:nt#16:nc#1415:\ :pa#161280:oa#0:ba#8192:\ :pb#96768:ob#161280:\ :pc#1426320:oc#0:\ :pg#1168272:og#258048: Quantum PD 80S:\ :ty#winchester:ns#34:nt#6:nc#832: Quantum PD 120S:\ :ty#winchester:ns#42:nt#5:nc#1114: Quantum PD 170S:\ :ty#winchester:ns#42:nt#7:nc#1117: Quantum PD 210S:\ :ty#winchester:ns#49:nt#7:nc#1189: Quantum PD 425S:\ :ty#winchester:ns#60:nt#9:nc#1540: Quantum PD 700S:\ :ty#winchester:ns#70:nt#8:nc#2441: Quantum PD 1050iS:\ :ty#winchester:ns#92:nt#12:nc#1859:\ :pc#2052336:oc#0: Quantum PD 1050S:\ :ty#winchester:ns#70:nt#12:nc#2444: Quantum PD 1225S:\ :ty#winchester:ns#70:nt#14:nc#2442: Quantum XP32150:\ :ty#winchester:ns#109:nt#10:nc#3850: Quantum XP34301:\ :ty#winchester:ns#118:nt#20:nc#3561: Quantum XP34300W:\ :ty#winchester:ns#107:nt#20:nc#3907: RICOH RO-5031E:\ :ty#winchester:ns#54:nt#15:nc#710:\ :pc#575100:oc#0: RZ24:\ :ty#winchester:ns#38:nt#8:nc#1344:\ :pc#409792:oc#0: RZ55:\ :ty#winchester:ns#35:nt#15:nc#1218:\ :pa#32025:oa#0:ba#8192:\ :pb#59850:ob#32025:\ :pc#639450:oc#0:\ :pg#547575:og#91875: SEAGATE ST11950N:\ :ty#winchester:ns#81:nt#15:nc#2715:\ :pc#3298725:oc#0: SEAGATE ST15230N:\ :ty#winchester:ns#111:nt#19:nc#3974: SEAGATE ST31200N:\ :ty#winchester:ns#85:nt#9:nc#2692: SEAGATE ST31230N:\ :ty#winchester:ns#104:nt#5:nc#3978:\ :pc#2068560:oc#0: SEAGATE ST32550N:\ :ty#winchester:ns#109:nt#11:nc#3495:\ :pc#4190505:oc#0: SEAGATE ST3600N:\ :ty#winchester:ns#79:nt#7:nc#1853:\ :pc#1024709:oc#0: ST83220K:\ :ty#"ISP-80":ns#102:nt#19:nc#2652: SUN0104:\ :ty#winchester:ns#35:nt#6:nc#974: SUN0121:\ :ty#winchester:ns#39:nt#4:nc#1520: SUN0207:\ :ty#winchester:ns#36:nt#9:nc#1254: SUN0327:\ :ty#winchester:ns#46:nt#9:nc#1545: SUN0424:\ :ty#winchester:ns#80:nt#9:nc#1151: SUN0535:\ :ty#winchester:ns#80:nt#7:nc#1866: SUN0669:\ :ty#winchester:ns#54:nt#15:nc#1614: SUN1.3G:\ :ty#winchester:ns#80:nt#17:nc#1965: SUN2.1G:\ :ty#winchester:ns#80:nt#19:nc#2733: Sabre ST82500J:\ :ty#XD7053:ns#82:nt#19:nc#2609: Seagate (CDC) Wren V 94181-702:\ :ty#winchester:ns#48:nt#15:nc#1543: Seagate (CDC) Wren VI 94191-766:\ :ty#winchester:ns#52:nt#15:nc#1659: Seagate (CDC) Wren VII 94601-1.2G SunOS 4.1.1:\ :ty#winchester:ns#70:nt#15:nc#1925: Seagate (CDC) Wren VII 94601-15:\ :ty#winchester:ns#71:nt#15:nc#1905: Seagate (CDC) Wren VIII ST41650N:\ :ty#winchester:ns#89:nt#15:nc#2070: Seagate Elite ST43400N-3.5G:\ :ty#winchester:ns#99:nt#21:nc#2736:\ :pa#2843360:oa#0:ba#8192:\ :pb#2843360:ob#2841993: Seagate IPI ZBR Elite:\ :ty#"ISP-80":ns#78:nt#17:nc#1893:\ :pa#34476:oa#0:ba#8192:\ :pb#132600:ob#34476:\ :pc#2510118:oc#0:\ :pg#663000:og#167076:\ :ph#1680042:oh#830076: Seagate ST11200N:\ :ty#winchester:ns#80:nt#15:nc#1714:\ :pa#2056800:oa#0:ba#8192:\ :pc#2056800:oc#0: Seagate ST11900N:\ :ty#winchester:ns#83:nt#15:nc#2619:\ :pb#498000:ob#0:\ :pc#3260655:oc#0:\ :ph#2761410:oh#498000: Seagate ST1239N SWIFT:\ :ty#winchester:ns#35:nt#9:nc#1264: Seagate ST12400N 2.4GB:\ :ty#winchester:ns#82:nt#19:nc#2668:\ :pa#32718:oa#0:ba#8192:\ :pb#65436:ob#32718:\ :pc#4156744:oc#0:\ :pg#4058590:og#98154: Seagate ST12550N:\ :ty#winchester:ns#80:nt#19:nc#2747: Seagate ST1480N:\ :ty#winchester:ns#64:nt#9:nc#1456: Seagate ST15150N:\ :ty#winchester:ns#78:nt#21:nc#5119:\ :pc#8384922:oc#0: Seagate ST410800N #!/bin/sh delete_old_address() { if [ -n "$old_ip_address" ]; then ifconfig $interface inet -alias $old_ip_address $medium route delete "$old_ip_address" 127.0.0.1 >/dev/null 2>&1 fi } add_new_address() { ifconfig $interface \ inet $new_ip_address \ netmask $new_subnet_mask \ broadcast $new_broadcast_address \ $medium route add $new_ip_address 127.0.0.1 >/dev/null 2>&1 } delete_old_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet -alias $alias_ip_address > /dev/null 2>&1 route delete $alias_ip_address 127.0.0.1 > /dev/null 2>&1 fi } add_new_alias() { if [ -n "$alias_ip_address" ]; then ifconfig $interface inet alias $alias_ip_address netmask $alias_subnet_mask route add $alias_ip_address 127.0.0.1 fi } delete_old_routes() { route delete default >/dev/null 2>&1 if [ -n "$old_static_routes" ]; then set $old_static_routes while [ $# -gt 1 ]; do route delete "$1" "$2" shift; shift done fi arp -n -a | sed -n -e 's/^.*(\(.*\)) at .*$/arp -d \1/p' | sh >/dev/null 2>&1 } add_new_routes() { for router in $new_routers; do route add default $router >/dev/null 2>&1 break done if [ -n "$new_static_routes" ]; then set $new_static_routes while [ $# -gt 1 ]; do route add $1 $2 shift; shift done fi } add_new_resolv_conf() { rm -f /etc/resolv.conf.std if [ -n "$new_domain_name" ]; then echo "search $new_domain_name" >>/etc/resolv.conf.std fi if [ -n "$new_domain_name_servers" ]; then for nameserver in $new_domain_name_servers; do echo "nameserver $nameserver" >>/etc/resolv.conf.std done fi if [ -f /etc/resolv.conf.std ]; then if [ -f /etc/resolv.conf.tail ]; then cat /etc/resolv.conf.tail >>/etc/resolv.conf.std fi cat /etc/resolv.conf.std > /etc/resolv.conf rm -f /etc/resolv.conf.std chown -RL root:wheel /etc/resolv.conf chmod -RL 644 /etc/resolv.conf return 0 fi return 1 } if [ -n "$new_network_number" ]; then echo "New Network Number: $new_network_number" fi if [ -n "$new_broadcast_address" ]; then echo "New Broadcast Address: $new_broadcast_address" fi case $reason in MEDIUM) ifconfig $interface $medium ifconfig $interface inet -alias 0.0.0.0 $medium >/dev/null 2>&1 sleep 1 ;; PREINIT) delete_old_alias ifconfig $interface inet 0.0.0.0 netmask 0.0.0.0 broadcast 255.255.255.255 up ;; ARPCHECK|ARPSEND) ;; BOUND|RENEW|REBIND|REBOOT) if [ -n "$old_ip_address" ]; then if [ "$old_ip_address" != "$alias_ip_address" ]; then delete_old_alias fi if [ "$old_ip_address" != "$new_ip_address" ]; then delete_old_address delete_old_routes fi fi if [ "$reason" = BOUND ] || \ [ "$reason" = REBOOT ] || \ [ -z "$old_ip_address" ] || \ [ "$old_ip_address" != "$new_ip_address" ]; then add_new_address add_new_routes fi if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_resolv_conf ;; EXPIRE|FAIL) delete_old_alias if [ -n "$old_ip_address" ]; then delete_old_address delete_old_routes fi add_new_alias ;; TIMEOUT) delete_old_alias add_new_address sleep 1 if [ -n "$new_routers" ]; then set "$new_routers" if ping -q -c 1 -w 1 "$1"; then if [ "$new_ip_address" != "$alias_ip_address" ]; then add_new_alias fi add_new_routes if add_new_resolv_conf; then exit 0 fi fi fi ifconfig $interface inet -alias $new_ip_address $medium delete_old_routes exit 1 ;; esac exit 0 rpc_calladler32netmaskzcfreeinet_addrvprintfsendrecvdvma_initdonottwiddlegettickscloseallnfs_mountobp_xmitoopenbootfile__ashrdi3crc32nfs_statinflate_maskinflate_trees_fixednoioctlreadgateipnetif_putpeekcharfile_system_ufsnfsysstrncpyprom_initnet_closesocketsufs_seekarp_listfilespanicbp_server_portsendudpinflateResetmemcmp_ureminflate_codes_newxdr_inaddr_encodeinflate_trees_bitsinflateSyncinflate_codesfile_systemufs_readmemsetmainarp_replyufs_opengetcharinet_ntoanfs_seekifnamereadudpcd9660_closecngetcstrcmpzcallocsocktodescxdr_string_encodegetdevtypedomainnamelenprom_open.urem.remrpc_pmap_numinflate_blocksxdr_inaddr_decodeobp_recvinflate_blocks_resetdvma_mapinprom0_closenetif_getdbufprom_boothowufs_readdirnullsysinflate_blocks_sync_pointin_cksumgetpropinflate_trees_dynamicinflate_set_dictionaryprom0_xmitkdoprntinflate_codes_freeexit_divesymufs_writegetpropstringstartfile_system_nfsbceaarpwhohasufs_statnetif_closeinflateSetDictionarystrlenopenreadether.umulhdrinflate_blocks_newinflateEnddevswprom0_iopenobp_closeinflateInit2_dvma_freecloseprom_bootfileget_crc_tablefbuffreelistrpc_pmap_putcachefreepx (08@HPX`hpx    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x    ( 0 8 @ H P X ` h p x  (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx (08@2 `,>,"*` €>>@A # >>@7  @ @" @ Z?>@&  >0@   @n!= ` ܒ`.!= ?" @ 0!"@>P4 @ 䀊!-   :   `€.`4 ``` `$!:%>@a @h !:&6!:! `B >! 㿘`>,#ē*` €>@’  !(`B >!( @  "   2  ">@  > `  c耢+'>- @* €` b2  >``2 `Ȗ @ , c *` 2` 2  >#\  >``2 ` @> @@Q` a>P @H` ">` @?` $>p @6` (> @-` @> @#` @> @` @> @> @ ``>А @` > @` > @` > @` > @ܖ` >  @Ӗ` @>0 @ʖ` >@ @>P @ѐ >``2 `X#\ږ  >  2   @  !=2  d  !=*  .!=,`c  >  2   @  !=2  d  !=*  .!=,` >  2   @  ` @", `* ܐ * @`(  !"`(, cӐ `> &(``2 `k  >``2 `a  >``2 `@W  >``2 `hM  >``2 `C  >``2 `9  >``2 `/  >``2 `(%  >``2 `P  >``2 `x  >``2 `  >``2 `Ȗ @ R, >``2 `  >``2 `  ``2 " $@(,   #\> 8> @#`>$˔,&( >``2 `  >``3` `` >``2 ` >P@ , >``2 `xX #\@  (.X&, >``2 `  >``2 `{  >  3`   `@\   "(, `$ ܘ `?ȑ*` *  *@ 2  `* *  @ "  != d  !=  .!=, "&,c >  3`   `@"   ", `$ ܘ `?đ*` *  *@ 2  `* *  @ "  != d  !=  .!=c, >``3` ` `@ V,` (  > P@   > p@ؒ  @2    b700@Ӕ !=  ܔ.!= pb" @ ,`+c'  > @ , c  > @ , c  >` @ , c &,c >@!㿘.`6``= 쀦@ !h.` ?` **>2@l 0'2  + 2 !h* "@`$&`(  .`X  2!> "!0!>?6!>!0B@[>!0㿈!\   = !L@" 6!^5? `@ ؐ`  !\ !d  0 0!` 76!`7 !P2!``6!`7!\&!d!^ 7?6!^@ 㿘 > ^>",@ ,  2  ? ,  `  `? `  !L -- `2`45`` 2 6!\.!<!= .!=  `@#h>  # `'`> ^ >", ^@  >6@&H -   ``2  ?  `  ? !L >6@`@j #   +- `@@4@4  `6!\.!<!=  .!=`@!^   < ,` 2 "@*`" * *  @̒Οʀ  ΐ2!=2   ։!!!=2  2 !=2  )>!\ؐ@  0"&  '>%>  @٘  `"耢`# !=> .!=!\& @ !=2  != .!=#   *" @ 2@  `} |# > !h> #-  `2 @>x@ƣ @`@1 4`@ "R ``DE>@G`@=>@". ``@`@/>@` @!'>)>' $>" > > Ѐ> >!  > !>!08@H  >H@U # >@z!p㿈  i 7 @ *  @$㿘!=    < @,`x!= !=* ` *@  .!= .`*   ܑ* ??c#    2` 2` @ >$  @m`  2` (7 $ 9'䀊 _ 87 ?!a @4  @7@7@2 7 2 * @7 ? * (@4 > 2 #\#` @   $ '.`,` 7 䀢  !=2 !=@ *  `@.!=`2,  *@ * .`$ @4 ' @۔``  *  2` 2`  `!=!=  `@.!=0` p a.`* * " ܑ*  H $!    k$, 4 4 , , ,  ! <  4<  !4?* 4 @  @    @& ` #&  " >   @      : !>   @   :   : .`*   ܑ* @@` @* @ *@*  $@  <*$* $@!   4`,`,` 4`,` ,`   *` `  "` `  @21@@  @2(@ %7 @@  $@`* @2  *@ * $@ 2  * * @$@@!>3` #\ ` 3`#` ` >#d ` #h@ `2 #l  @ @>3` #\@3`2` `#``3`#d`#h  0 @o `???ì#c !)> 4  $ , 4 4    )  $ ``2  2    ` 2 `  ? : @2       * 0 *   , $ , #\ 2  #` #d  p@ 㿘A!=2   > @   2 " H!=2   !=  0.!=!=2   >@@  6!>5 ,`2   (!h *  ? 2`"  $ 쀢@!h* "@ $ " $ (  2 $$ ( $ ,@ ̐`*` 2  Ϣ 㾐 > # '!       @  `!S@2  P=` 2  2p?>`@{ >x@s a?  @b `    @ ` >@R @?>@H 6?   @$  2) @ # `  @Ē    ` @@   @ @H  >@7"㿘 ؒ   i  ؐ`  a  `  `@` 2  2 ` f 8`?`f a `&&6* 2 <    ؠ  5  ؔ`  -  ؔ  % <<6 *`6 ؒ    ؐ`€   6  ؐ`   < ؐ`   ?# @ `*`2 @6㿀`  ܑ2 ` @ ` * * $@ (2 ``2 * * @$@`?,` `c,` `,` ` @ * @ @$@   2`  4 ` @ $   @  $@` @2  * * @$@` 2  *@ * $@` 2  * * @$@` 2 *@ * $@` ,`` * ` *` 4``!>`*@ 4``> * @3`$@ `#\ ` 3`#` ` #d ` `#h@ 2 #l @  @ 3` #\@3`2` `#``3`#d`#h>0  ` @  %>` 2  * * @$ `, ` `*` 0 $ `,    `  ,  2`   p,2   ($ 4 ` !4  $4 ` h4 `   4 `   4 ` @  4 `2     4  4 #\ 2  #` #d p@ |  <2*  *  @$ , 4 ``` 㿀.`*   ܑ* 2` `**` $ ( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>#` 3`#d #h>2 #l ` @ Җ >3` #\3`2` `#`3`#d #h0  `@   +>  `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `p@ / <2*  *  @$ , 4  `i 㿀.`*   ܑ* 2` `**` $ ( `  * * @$` `,  `,  , `  < * *@ $`  2  * *  `$ 2  * * @$2  *@ * $2  * * @$` ` `* @4  `! 3`* 4 `#\ !>#` 3`#d #h>2 #l ` @  >3` #\3`2` `#`3`#d #h0  `@ m  +>  `+  2  * * @$ `) *` `+   *  p@" `* `*`4 (  !4  `$4 ( ` (4 (   4 `(   4 `( @  4 `( 2     4  4 #\ 2  #` #d `p@  <2*  *  @$ , 4  `i 㿈` `/``+``(` `  `-   5`@ 5- @@@-`4,- @ ,` @ @  @ܒ > '@ 7   @ >   /E<?` `/`` +``"(`! `#  `$-   5` 5- @@ @ -`4,-@,`% @ @   @  > '@ G7    @ #?@ >@  $@2 > @2  $@" >@"/`  $@)    2`2  <?#?  >   2`   2`2` @  > ` >` *` `+ `@ ` #\'@ ߔ` ` * @6$2`` ` * @6`.`.(2`.@2``.`6 0@ 2?0(2 ` * `*  +     +     +    +   0` 2?0(2 0` 2?0(2 ` * `!*! 0`" 2"?0(2" 0`$ 2$?0(2$ 0`& 2&?0(2& 0`( 2(?0(2( 0`* 2*?0(2* 0`, 2,?0(2, 0`. 2.?0(2. 0`0 20?0(20 0`2 22?0(22 `4*4 `5*5 0`6 26?0(26 0`8 28?0(28 0`: 2:?0(2: 0`< 2<?0(2< 0`> 2>?0(2> 0`@ 2@?0(2@ 0`B 2B?0(2B 0`D 2D?0(2D 0`F 2F?0(2F 0`H 2H?0(2H 0`J 2J?0(2J 0`L 2L?0(2L 0`N 2N?0(2N 0`P 2P?0(2P 0`R 2R?0(2R 0`T?0(2T`㿐!=>   0>a.!=`x &  0& &  d$`$`$`  ! 4 4`  >a ``& !)4` ܒ 4`  4` *@6  2  Xd """ `  2 2$ `22 ̒  *@6   "A 'H /d * %    & & H 0  熔    2  `' w ?` &  & H 0 BҐ!g!><͐ !H /d * %    & & H 0  &%"`*' > 2$ @2`  22`   , 2 % 2  2   2`  2 2`  4  ?` &  & H 0 4`!><"$@N     `("$@A 㿘 <?#@@& <@|㿘   >  T`I>a "# C# 2 (@*`@ ܓ*` @ 5( : .>  T`< ?#  a `;# `?Ȗ*`2 (* @ @ " 2  !=  !=*  `@+!=* 3@㿐 >c a@h@Z `   $,6 H /d * % `  $`$`H 0  a=2   4K``ؐ`  ϟ a=2   & `  ``   ``   `?` $``$`H 0  $, e a= `  0,a=` ``   ``   ` =  $,`   $``$`H 0  2`@*` ` "$``"$`$`?` $``$`H 0 >@Ւ   !2` /`$`@` `` *` ? $`w$``$`H 0 0m f"0` g e"U T` h"9 N`  h@z#> w @m $a>` 67`a>>$`a>@~ -`> `  @$`(@r ` "$``"$`$ >   8@ah>ea@4>   @4 $`?` $``$`H 0 㿐⡐ f  g e 0 h 0   `, 2  &`,   "`5 "  ` ؐ@  ` 2 q#蠄?2 ؀`2 ` 2   "`,`,   &`,㿘 @  *&    @ h *@&  @> ` X@В  * & @ `  $ >@ @8>  #' H o*@ e   $$H 0    6 h*@ * * 2  "  > @{?`$$H 0 @ > @b?`|$$H 0 s & ؐ@ N ` > @9 @*@-& @-> * $` > > @ "  쀢8 h* "@ *  & ,& 8@  @* &   h@xp#> ؐ @ΐ  & ؐ`€4@@4B4*l  4@ @  77" ?`$$H 0  & @y @    4` ,`,@ $` ,` 2  " ,,  `, `,  `,  `,  `,  `, 2  "``?# ? ** @2@ 2@ $ 2   `, ` , ,  ` , 2  `  4 ?# @2 *`@4 2  `  4 ?# @2 *`@4 2  ` 4 ?# @2 *`@4 2  ` 4 ?# @2 *`@4 ` ` `$   * ?# ?1?`   2  "  *  *` 2  2 #2     *  *` 2  2  $`?؆ؐ`4B />`@ ?` $$H 0  >@!㿘H /d * %    & & H 0  ؐ`   ?` &  & H 0 㿘  H /d * % `  $`$`H 0  f)> g e"P ,U` h"2 O` >   @t  B h>ca@@D @v#> I '@^ ` ` ?` $``"$`$` &> >  @E h>ea@>  @  &   & ,F`?` $``$`H 0 㿘H /d * %    & & H 0   `'& $  ?& ` &  & H 0  C"@ "` >@ݒ 0 ?` &  & H 0 㿘   &  "@ "` >@ 㿀`>` (.` €  r /m?>@ .`*    ܓ.* @*` @( `&  "# 2  ` ` 4*`` " P` ` ` *`0  (  ! *`@uސ#  @  " > ( > "h > "h">" >"@`.*  > `#\#`pf>_ >@) 0% > ` ? & Q  ? @` & >ec@  & @ >: 2 /-> . ܑ*  (c @ >#\2` >#>##`#d#h #l #p@Ԓ 0Ѐ>@͒ 0 '  ">  >)"h>%"h"> >"h>"h>##>#> #>   >  D$ >0@  2  @2     !  &* *  (  ( @2`@2 `@2`  @"    M  (* *  (``@2 2>P@7 03<.@ @ *@ &@ >`>`&@"&`  `€        ` €* * , >p23 @  㿘'P'T`'X /@ > @ @ŒP>@ ttt@@ttɈ,̌ҠҠDҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠҠdddpPPX|P    2     2 㿘 H>~a@@h"Ȁ 2"Ԑ  @ov &""Ԁ 2"Ȑ  @om &""Ȁ >"Ԁ 2">@-!00D > >!@@% 0<#* ">"@!p" @s֐  `.  . "*"@ *`"  *  , @ső*  . . &  @."" 6 f6 j>< `$& |& t& @ > `*"@ @ *`㿘  @!> #!>! @ٔ!  ."`  #! >!@ɔ! ."   o!"` W>>h *` €     `  "` &"  "` &"   "    &". .     .     `   `   `   `  " @d! `   `   `   `  "  `  㿘 @>!@8 > c!>! @/!b  ."`  㿐> #`>"!@!> # 2"> d>"@b#\ L  @W  $#" 2  & & &  @t" ""??06 ."6" "`, @ܐ Ȩ  "$?   $ ,  "`, @ʐ    @ $@" ,@`,   2 ?ڬ@ې!&"&"  "   :   : `!`*" *** @` ."㘀!>! @!  ."`  0 ."@㿐` `,  ` > #` >`/"@`I`J@r ."`` 2"`А"@ >  @r #>   @r# @w`" 2 #!>! @H"W  ."`            * "Q @q ,`"* "@qۑ* &`"  "  2`   `2 "􀌠"?"  "          ` "k`I" R`/`@&"&"'    `  @2 "  ` "  `  " #!>! @"n  ."`  #! >!@"q  ."`    ""`@@`/#!>! A@"v A ."`  A0۠  " "    `  ` `@`I.`,`,*`J *`@  `..`." p 2o &"&"'    `  @2 "  ` "  `  #!>! @("  ."   `!" @6"."#a>! @"  ."`   #!>! @"  ."`   "`" @ @0E @g # >@ߐ"p#!>! C@ה" C ."`  C0)`!" @6"."#a>! F@"Ő F ."`  F0#!>! B@"ǐ B ."`  B㿘H /d * % > d"@@&` H 0㿘>  ` `@? `H / * % > d@Ő"@H 0` L@qx>}`c@`  &`  㿘  ` !> # `>@N"# >  " @D``*    @,`  ̔ 4$  @k[  2@q3$ >  <$ H /d * % ` $ ` "` $`` $ ,` " H 0n 2$ N  $  $ @ $  $ D  /  $ @ $ < $$ D, HH /d * % $`$ `"@%`  $ b`@OH 02  @ " @̐ @   @Ð 㿘> #`>@""" !> @ "`@ ֐` ""  c @"@ +#贆2  㿘> #`>@m""`" >@"``` `*     ` @  ` "`  @  !H /d* % ,      ϐ &> $  @j^   H 0@@p.$  <$  "` $$ , " >  $   "$  `      `  H 0w@=,`I  2 H 0h@ *`  *`2    *`22 >@# ,  , *# ,`JH 0      , @``&   㘀 @``"`& `@"` $` & 0 "@>`#H@v`@`2`㿘``/  *  > c  >@`#X@on  .`/  *`,`,``  4   #&`@&`<&`D&` &` $,     ה   2, @ , $  @2 0 &@ " & &  &`` `&` " 㿘` *  ,      > c  > ,@#p@O``H (2  , `>*`4 #2@  , 2 `H, X` @  $ , $ ,`H > 2`D`D$ (Z0Q$ ( c `$  (`" ,>@# ,`2>> 4@#@#@7 @2  ," &  ."* , 2 ` 2  ` 2 4`, " ``"` ` "` ` `"@@jq  ڒ`@q%㿘`  `*  ` 2,``  ,`  2  >>>#@2`I*"`I `J*`  "">  (@ ?*`  ?&` @``"`& @`"㿘!> # > @ h#!>! @$  ."   "   㿘``> 0"&"""@@A x @€ "` * ,`  '>  @€ , &  % `   @€ , @ € "ܠ  '>  @€ , & "ܒ@&"㘀  > ` >  >  "@ 㘀 """ܲ @ > !> "Ԑ @ "ܲ`@ *"> @ "܁㿘!> # >  @y#   > #> @@n` &@> @g Ƞ  `@ " 2   `   & 㿘b   bb  b* * >  @9`!>  ? `*   `@*``       `` `    ,bݰ `.@  > ! @`!> ,b$` ````+`b`@k . "* b@k* & bb  ` 2`` "?b  `  `  `    !> # > !p @%J#!>! @%J` ,b`   bbĐ @ ` @# > !p @%L#!>! @%L` ,b`   bbĐ @` ,b4b< $bD>$b# > !p @f%U#! >!@^%U` ,b`   bbĒ`@ # > !p @I%Y#!>! @A%Y` ,b`   bbĒ`@ 4b,b 㿘> #`> "@&!"܀ 2"> !@ 0#" >  @!"&"ܒ `."# > " @"" #!>! @%  ."`  ""> @"00"܀` > !p @%#!>! @۔%  ."`  ""Đ 6"Ē`A3."" "Ԛ "Ԛ  ` ` `  ( ` ` ` `    `  @`?`##!>! @%  ."`  0"> "H@ " &"  >  >  ` " *  @ "N>h * €#"> @^"`" 6  @/` "> "p@R &" ! " $D" ( ."#"> "@=""€ @"{ #"L!2"> ` "@' #b> @!"#! >!@%  ."`     ,`    *  2    I   J*` ",J" ?*,J,I *U"> ` "@ߒ " `."  ,  "`     `   `  0"> ` #@  , `$,#" > @#0"#"> #8@ "#"> @#H  $"`." !$ #"> @#X"$<"$D#"> @#p<&"D&"#"> " @s#" `  " `G#"> ` `@b#" ` O# `,"   `,," "   `|"@` > @D#"`2  , `,# > !p @4&P#!Z>! T&Pd @h  @h!-`@*`@*`" "C@hՒ ,`"* "@h͑* &`,`"* "@hÑ* ,@` > #@"`21  "@6 ",   ,  `,# > !p @&m#!>! &m@  ."`  ""Đ @`."6"Đ ," ."  `+ " @hu ,`"* "@hm* &`""    2  "? "           ">  @x#" ` 2L,  @, +@ " @h" ,`"* "@h* &`""    2 `` "? "              ,@` > @  ##""> @ 0@` > @ 8# > !p @ &#!>! @&  ."`  ""Đ @a`" 2> "`2 >  ` S""  >  @ڒ #6"  @"Đ @͒ # > !p @Ŕ&#!>! @&  ."`  ""Đ @` > !p @&#!>! @&  ."`  ""Đ @` ."6""Ā #!>! @&  ."`  #!>! @x&  ."`  " ."&"܁㿐> #`> "Đ! @_"" @" "="#!>! @P&  ."   6")&"Ѐ "> # > "Ɛ!p@:&#!>! @2&  ."`  ""Đ @"."@ 6"Đ!P @&"Ѐ 2""Ą "ƒ    * 6"6"6"€&"@"""є ǀ""""s  "” """    " *"ȓ*`* "Ȓ`* "*  "* "`&"  ,  , " @f ,`"* "@fy* &`"    2 "  "  `"?`"  `         ]"Ȗ    `"ȑ* *"Ȥ*`"*  "* I&"" > ! @l' ` "Ȑ 9*@ > ! @]'   I"* J"* (&"Д "Ȑ ."*@ ` *    ` , , *@   "Ȑ  *@ *@  "."*@"&"" 2" "̐"#!>! @']  ."`  0U"@8 " '"̖ @ `  `  @2 "  ` "  `  #!>! @ؔ'f  ."`  #! >!@Ȕ'g  ."`    @x> #`> "@! @ 2 w  € . @€ " ` .  @€ .  @€  . `$`" @ 2! &"㘀 > "  @t  <  -& < @€  㘀! >!@_'  ."    " >  @N!^   > !@  0@Y  @( @€  㘀! >!@,'  ."   ѐ "  2  "`, @"-""  ."ڰ "> " "!@" @€   㘀! >!@'  ."    " ` ." € "C  @?2  >  @Ґ"8   @ 2  2* " "& " 2"" > " "X #\ @  2    ?D#\> "@" B>  @""`㘀 > !p @(1㘀!>! @(1  ."`  ""Đ @` > !p @o(3㘀!>! @g(3  ."`  ""Đ @`."6" ` ""6"㘀 >  # @K ` @€  㘀!>! @<(;  ."`  㘀!>! D@,(B  D."`  D"?`q>h!l*` € ",`  *  ` 2  2 4 `8*`` " `"  "`  "@ @`ޒ `2" "> @` > @ې#8` "*  `." ` ,`" 2>  @ǐ#X `> @#xѐ> @#@I  T"`,W& "?`h>h!H*` €>  @#o "  > @#> @#X""   € >  @  ?#>   € @w`8 ?   "6"ƀ 6"6"."㘀 > @` @@ $ " & &  $ `$ & " `.">  @C#SD   $"" "" >    X"#\@* : ."㘀 >  @ ` """`."㘀!>! @)  ."`   " " "" 2"" ."" >   @  ʰ 0  2;> 2> @7 `   *  `$>h!4*` €㘀!>! @̔)/  ."`   ! ` 2 " I 2"> U! > P! ` 㘀 > !p @@)>㘀!>! @)>  ."`  ""Đ @`@."6" ` D ",`,`" ." I`㘀 > !p!@|)F㘀!>! @t)F  ."`  ""Đ @:a > !p @`)H㘀!>! @X)H  ."`  ""Đ @`㘀 > !p!@C)K㘀!>! @;)K  ."`  ""Đ @a."6"Đ t&"" " " @€  f @€   >  !(  #`#\@  㘀a>! @)k  ."`  㘀 > !p @)l㘀!>! @)l  ."`  ""Ē`@ 6"."㘀!>! @Ք)p  ."`  !" !"䀠 >   !x  ` #\#`@ !&"< &"D."u&" ! @ 㘀a >!@)  ."   F " W  `.">  "  @  "܀> "P@| ""ܐ ?,H""Ԓ@㘀 @ >  "x@k >  ! " $D" ( .""@W &"㘀!>! @N)  ."`  0> " @@   " 2> 2"> @"   "0 @z @ > #! > #> #㘀 @> @"&"㘀 @" > @" /"  2"㘀!>! @)ސ  ."`  "` ."㘀! >!@ޔ)  ."`  $ > " 2 ">  # @ǒ """@ ߀ ."Ò`?   #H @  ]&">  /#@@ @€  㘀!>! @*  ."`  " W/@ &"&"`'"" @ `  `  @2 "  ` "  `  㘀!>! @X*  ."`  㘀! >!@H*  ."`    @ @/㘀!>! @.*  ."`   &"㘀 @> "@#㘀!>! @*!  ."   ""@8 " '" @)&"> @#" 2"㘀!>! @** ."   ""@8 "' " @ &" ~$     `  @2 "  ` "  `  㘀!>! @*7  ."`  㘀! >`!  @*A   ."   `   @N  @> @y#"`."㘀!>! @n*G  ."   &"@b rM+  ."% @"@_ 2В@@@ '"@  ? @ 2 @֐@-@$  㿘` 'А @&`&`  @ ;" !'!> # > !p @*#!>! @*  ."`  ""Ē`@ 6"."А"@@ #@^'> $ >  '@^#`@0 tp  `` *``@   €  @ >  >   "> #\  #`#d" #h"#l"#p"#t" H#x #|@ DH /d4 * % @  > @ | 0!> @  $,h   " @`> @ `  `*  $ H 0㿘>  }H /d * %   H*`  `(6 2  2 4 `8*` " `"  "`  "@ @[*  `ґ*`H 0>  *"@ @J*`㿘 @€  . @€ " ` .  @€ .  @€  . `$`" @ 2! &"> #`> "  @ <   P    P 㿘!6"< L "( 4!! +> .`4 @ `, 2 .* 2. 0a +> @@a"8@"> > @!@! ?%#4! @( "%2  ?# @2 *`@!(`"!.`2 2g"."?g >  "#@> " ."? ."?2@f'0> 4`P@~  "?&@:@??@ # @2 *`@&@:@?@ 4  >>>?!`x"$$$48$ $@Đ@D!(`" !>>D 3 @9>>>"< b&!&!&!&!"? > @"@"<?`6*`>~#d €"8@(@i!(`" 2"8@???@ !   " @ @" " !@  !@!@8!! (@"!2 ! &"0" ( 2 @  ! X"2`@ ސ 㿘"8@ L!?@?!@ʓ?@ݐ@` 㿘! ! " ( 4  ?# @2 *`@>  #3> />  @  @ɗ " @sbp @px   &"@ Q +  ?4 @ F     ?# @2 *`@ 2`, > Б* > @B"> , @}㿘! !" (#2  ?# @ `*`2 @!( `"  p5> 2 4`5  3> />  " @bp @x    @  ` &",`А* `@> " ,`> "> "> @"> @㿘 ?! L"c# %     * 2` 0  k `@$@ސ">  !(@ " 2 4   !4 "> 2 !  ?#4 !(`""2  ! , ``$ ">?   `* `$ !# " ( 2`@  ! X"2`@  !(@"!2"<      "?&@:@??@ # @2 *`@&@:@?@ 4 "< 7 ( 4   ? 2`*    ? 6 ?# @2 *`@44 4 "8@"@{! ( "!2 6 *  x 4  6 *  p 4  ?h 4 @!Đ@   4   H4 @ (8`@ {@U58!  L" (!2! "R`8 `8!?0(R`8 `8!2㿘!@I 㿘! ( "#4` "   @4`2# 60  @4`!%  X" 2`@ "! (  2@  #   @4`㿘! ( "$4`  ` ?# @ `*`2 @`   ?7?# 2 , @4` ' . 4`Ӑ#"8@k(!@"#2 "<   `?# @ `*`2 @`  ??? # @2 *`@4`  @?# @ `*`2 @@  `?# @ `*`2 @`  `?# 2 *@ 4@ 6 ?# 2 *@4`!(`"!!2@t 0!(@"$2 `;>~#x.` € ">   *`   4` &"<  4`0   ?# @2 *`@4` 0#"<  ?# @2 *`@4` !#"<  2D!! (@ "#2   @?# @ `*`2 @@  `?# @ `*`2 @`.`  ?# 2 *@ 4@ 6 ?# 2 *@4`-! (@ " 2   `?# @ `*`2 @`?` *.`? # @2 *`@.`4`#!(`"!2  㿘"8!  "@ϐ!!&`!g&`! &`"< S O P> !1 (@"##2} `?# @ `*`2 @`! (@ "! p2> !* 2&`!(@ "$2 &`@  ` ?# @ `*`2 @` ("!`  &`&`> "<"@ !(`"!2 㿘 8a $@ @b Ԁ   2     2 > @# € @Ò @ & € ! " `e$ X`& X Ԁ   2     & & $  ?& @Bv`  ?# @ `*`2 @@ 0  b?`:@??@ # @2 *` b? : ? 4 8$y6 8 % ?@b  € #4 Ԁ   2     & & $  ?& R b2:`@??@ # @2 *` @b2:`@?@ 4 , @H/` /b<`   6?# 2 ,@4 ?<#4 b> jȴ> "  3> 2   $  ?  @ @,`H /f * ' T * 5 @f   "# 8@  <"`< < 8"`8>  $@Z!  ( $ 0 , @T3 4 $ 0 ?4 `@EH 0 2 d`> "  3> 2   4 `  ?,H /f * ' T * 5 @   "# 8@  <"`< < 8"`8>  $@!  ( $ 0 , @S 4 $ 0 ?4 `@H 0 2 ,2H 0 T & T  b<    b<    @ ?# @2 *`@`@ː  @  " @ ԁ㿘! ( "$2`  `?# @2 *`@`!(`"!2 2   " @_ 㿘!6"   ,`  `@L& )"<`` "4 `c& "0 %8%&"0&"4@8"<""4  & @` H4  ;6   &"4"<    `2"<㿘?! L"# ) &+  @2 *`@4`  @/ 8 {v48  @ "i!h 4`` @2 *`@`  2㿘! L ""<   ?# @ `*`2  @"<    @~@2 `P g@z 2`L`P 0$`P`, `$`L @@"  a "<   ?# @ `*`2 @    @@x0B  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0   $㿐"("* @ L! "?"@H /f * ' >  @g H 0 " 4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ 2$ ] ","(@2"( 4@z "(`  ?"@&"(  $4 $ @($ $ $ `) ܑH /f * ' > !@  $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ 'H/` /"<`  `$> " S"("* @ A"@H /f * ' >  @Ē H 0  4 H /f4* ' 5H 0  $ $$ 4  H 0@T 0"(`  ?"@&"( 쀢`+`*H /f * ' > !@u $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(@8">   4 # "$   *$ $  4  2$ *@$ %@&@`J  @4 ?c?#    * 2` 0& #  ?#c #    * 2` 0 F  $H 0㿘H /f * '  L@/   H 00na2@a1@Sa @a@"48Y 0!5@a@"M 0 !6@ 0F8 48 ` -h@C08!@2Ҁ%8. @ 2*$@0(@  28@L8 ?48 `@`=0@@` 4@  H 0㿘H o*@ g H 0㿘> c  @  `$ 㿘"8! "@ǐ!"< 2 !(`"!2 4 4   4   @4  ?c?#     * 2` )  $  ?#c %     * 2`   " - `@$#  P4 . 4 ! (" 2`@ ! X" 2`@!h 4   x4   p4    4 @㿘#.@ ? c  . 2 @ 2  @ . 6 㿘?!#" c)    * 2`    ` d2`2">>   #8   >  #`@ 0 㿘"<  "Ő 2' !` "?# @2 *`@2  "! ` "? c *2`   㿘H /f * ' "> ",", ; H /f * ' >  @ߒ %H 0," ` 2`H /f4`* '` 5`H 0 ""` " 2 ""( ?"($ ,"(&", 4@vp H 0㿘H /f * ' " 4   "@@$ &",@v&"(H 0 ? 0*  ?0(2 ? 0* * ?0(2!*` 2`"? (0 " 㿘ʒ  ƒ  ?㿘  * ͒ @    >㿘! "`($2"2` ˔  ǔ Ô  x u T o  * 2 I  c  , { *  2 8 Q 0 !(`"!2 㿘!! "@($2h t  p l h  d `   !(@"!2! ( "#2  ?(0!" ߒ` 6 ? @0*`2!("!2`㿘 ?#c #  `  * 2` 0 `l  $SpSxSSSSSSSSSSSSSULUTU\VPUdUlUtVPVPVPU| ,,,,,,$ 8888(00H`X004@,,,,Pp|, ,0,ԝ㿀@f< 77@蠒 "!> @N" @^@;> @@ 0  H ?>>>&%& 0 ` ؘ"48$$$$H $.y> c@C > c(.@> >  c0@9.< )+) d6!6!6!6! 77  6!6!6!6!6!6!6!6!&.@W 2 6!?# @ `*`2 @6!/ "#!  <@aO%<<aO!:/@"_ &!ؐ`&!/"e@!ؐ &!"#!/@c&!ؐX&!"&!/"&!ؐ&!/!@!ؐ &!"$&<aO 77@  >䀢 !ؐ &!ؐ/@saؐ/,@O T<ƒ 77@  6!!>>✐@   @ ! @ !؀ $ @ !؀ ( @ !؀!" @y ! #  @q ! @l !؀ $ @d !؀ ( @\ !؀!" @T ! #  @L ! @G !؀ $ @? !؀ ( @7 !؀!" @/ ! #  @' ! @" !؀ $ @ !؀ ( @ !؀!" @  ! (  @ ! @ !؀ $ @ !؀ ( @ !؀!" @   @  @@J@ʐ> @#8!> #`&!> \@_Ɛ!@b& @ @z 㿘!؀  0`8 2!!/ `4`h!@ ?<#2!/ 2d2@Ѱ / 2d2@!`!/ 0`@?# @2 *`@/ 0`@!/ `4`h!`67 ߐ#p2  @!/ `4`h!@  !2 @!/ `4`h!@  "2 1 !`!/ "D@?# @ `*`2  @/ "D@!/ `4`h!@  (2!Ѐ @  @ې!/ `4`h!` ?2 @!/ `4`h!@  $2 !/ `4`h!@   2!/ `2`d!`6 *   2`  @- > #! 0'@ !/  @@?# @ `*`2  @/  @@! "*` hH /f * ' >  @˒ H 0 " 4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ "PH /f * ' > !@ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   $  @՘ D ? c *`2 @ '2%>  2  " <  >    >  ,,  <  @#@0Z, D * 2`   @#p0M `(I  @ B$ W$   @ D 29P4 hc? 1#8* @H /f * ' >  @ H 0 " 4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ "PH /f * ' > !@ɒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  ʗ,  ??$ (  " $ =$ !• :3 ?c * 2 `>@  h>  2`*  @8#0۔ D < <@`  `<@8 h > @! P$ @$ 3 ;?7?c * 2   h>  2`*  @ 0Z$ $        @ D P`@$Pk?c * 2  h$ $  @t . 'L $L.܀`-v@"*!. % 2$!  @Է @ d  h >  `@ @ҦP )$P @іȐ@B?!• 2 ,@} , "!@Ԓ! "`@@ > @qԐ  0 8`2 82 6 X" X T" T㿘>  *"@ *`@ok/ 0 8d!H /f * ' <  @ H 0>  @$ 㿐!` 0!/  @?# @2 *` @!/  @  @ ?a# 2`* ..x+  @(<0@`> * 2` ?  `+/,?#   <!@ !/ 8p@ @2 *`@/ 8p@*`2 88 *` 2 @" ?ߖ/D/H/L  $`\㿘0?#Oc # !` ! @ `*`2@ @ !@" !>  $!!/ ``!`6?#2 .@2!/ ``!`6?#2 .@2!/ `` !`6?#2 / @2!`!?#@2 .`@0#P?c#2?# !@  /!  `0`  2 /!  `0` `#   * 2` 4h 2@  0  ??2!  < 㿐/ !؀ 2   @ >  @ !!ؐ &!!/ 2d2@!/ `4`h!  ?<#2 <(777@ 㿘/ #!!  * ` !!Đ#*@ Z㿐/ ?` @@" `<`( <ٰ `# 77` ! ܘ 2˰ ` @Ȗ 8 2ð !@  !/ `8p@?# @ `*`2  @/!  `8p@$@   8p@?# @ `*`2 @8p`@  6`6@`/  8 p*?2`!   2`?@2/!• 2 /"`@ 2/$[6` X? @"`  @<*@F 0I@BD@D `?# @ `*`2 @`> <*` €         ?#  *`2 @a?# @ `*`2 @ 4` !*  2 !4 4  4`4  h`?2/` * 2` 2 /"  777?`@  @. @"e.@"T``77` @ `*`2 @` H> x*` €          /* <`( 77` !*  "2 !  2. .   ? #!• "`?`?# @ `*`2 @7$ 7 <x `# 77`"7`* @` Ȧ̐@H/ &  7Ȑ<$7ʐZ 4  `P ` @M 8 "!F / `8`p!`@?# @2 *`@2!/ `8`p!` `?# @2 *`@!2@``/  8 p*`?2` !2 `!!    㿘68>       @ X / !*@@ !`6?#@2 .`@2/ !.@@!` 0?#2 .@0cP?2 #.!`!/ @  * 2`  `0/ @ ` 2!` < 㿘 8 "/   8 p7 ? ! ?6 㿘v 6 2| /  6 l7 ! 3 !/ `6`l!`6  "42!/ `6`l!`6 V"x2? 6 "!C @  /!  `6l?c * 2` 4 !/ `6l@"4@@  6l?c * 2` x 6l@"x@ 㿘   >   @j 0#P?c!` !/ 0`@  (/ 0`@  `- 2!`6!C <`!/ "D@?# @ `*`2 @/ "D@&!/ `4`h!@  (2  6 4  :  $ !/ 6l2@2! 0 0@F= d< 8  1@77  i0(@F, d,!    `     @L  , 7A㿘`?  0@ 0@"` @"T4@ [ 0@"`@"` @"`  @l@"Y` @@ 0@"U`ఐ*@"`-%@"` @@R 0怢@Ő ౐@%@"`٢ @〢@"`Ѣ ` `@ 0 !, 0` @  `*`2!0@ `  *2!&  * 2` 6! * 2` 6!` * 2` 6!` 2`*  6!!!@ w * 2` 6!` * 2 .y * 2  . * 2 .@ E`e * 2` ]6! * 2` U6!` * 2` L6! * 2` D6!` * 2` ;6! * 2` 36!` * 2` *&.` * 2` !&.. D0  * 2`  ?&. &. *`2@ > !@  0> #> ` 'H o&*@g؀  0H 0  @R   H 0ca@  !ꀦ@a}@ 0! !耦@0!怦@0@J-  0H 0pc!뀦@Z, a2@a1@a @"K8 !ꀦ@B 0Pa@V 0Ka@"Ha}@ 0Aa@ !耦@  080a׀@aҀ@*a|@a5@ 0'a@ 0"a瀦@"8a怦@ʰ 00 !6@j0!逦@ 0 48 ` @@3y0Ҁ%8 @ 2$@08 2P8 P܀! P• )< !777  ܀!• < 777 T8@אT8 @"T8@T8 $@@ 4} @$ " !8 "= 4 ?!7)0Q`〢"8a`0F80B,! T +>7@I- @C D5 D/ 7?# @ `*`2 @"77` @ * 7Ēc * 2`  77   x<* x7$v$ / *?`%"S+ 4`"" 0m!7` ?+  ``-8`50Z`〢"0S@Ēc * 2` 4    <  9 0)ް ڒ 8 + 2 ?@-؀ ǐ-@؀ @@%؀ %@؀ @+`   8 ݔ$ 8 @  @ 2$Ŕ$ ~@ 7z < aA"77’ g ?# @ `*`2 @ \Ȓ@x !R ! KȀ G ɒ@B >Ȓ@Y   ?@BC &4 < 77 *`7 ͒l8`@-0@c@@ @$ @ H 0c > @he!@`!ب 0 'đH /f4 8* ' 8 @ @ !!?# @ `2*`@ <7777!  2`*  77ڐ7!<  2`*  77Ґ7!<`  2`*  77ʐ7!<  2`*  77ܒ7!<`  2`*  77Β7!<  2`*   777!<`  2`*  77!؀`@<!  2`*  -777!؀ <!`  2`*  777.p  ?@AP &.<*4 .7r7t v7p ِx. "%.!•`"  ! `2. H ?@A+ &.< 4 * 7JN7H7L T!.   &@A ?.<*4  7"7$.&7  ;!?# @ `2 *`@<77 7*.y  ?@@ &.y<*4 77 .z7t  <77!g !•`< 8! <!777 <  777!؀ N!?.ޠ# @ `2 *`@< 77ܢ 7ؐ֒7.<  * 4 ౐77ԐȒВ #<6.6../`$.܀  ` /#!4 !!777ʒ!?# @ `2 *`@<* 777Ȓ!  ` &:Ā > !P@~= Đ&!В&:Ā > !x@~1 !&!/`2d!`6 *   2@ԐH 0>   8*@ "@ /5 8@d.*`㾀> #!"'  "|@O"|`& &  & "| " >?c? #@&  @?..* b|  22///.s      *``(*    '"@ ,, @G`` .@?.`.`. * .``@( > !` #" @ #"@ , , @@  `*` 3   #" @ .@`@ ߘ 8 @3 3 3 .@.`.`.` ` #"  #"@ , ,  #"@ @ .@``c > @e!x> #'? @?B`.2 * @ `@./`//Ȓ〤 `    @*``(* @   '"@ ,, @G:`` ? @( > ! ` #" @  #"@ , , @ @  #" 0@@  * .@`@ ߄ 8  ` #" @  #"@ , , @ @  #"  @ ,``( @0 0 0 "   h f> #\!@| ?  > @d"P؀  8$ Ԁ >  25  ` ` & & $` ?& `@>v D(7Ѐ $`@  2  8!2  @E> @|I"@X Ԑ € ע@ Ӣ h h   5@!"݀@2`Ҕ • ( 77܀ @7Ȑ  ސ ސ  `*?b#777`?7 7• 2.`܀ ) ` @ ܠے?`# @ `2 *`@7ܘ D `  <J ,` @Ӗ?# @ `2 *`@7ܘ D `?| D+ ,?c 2`*  7•` ܀ " `> "@@{ ,` @Ơ D Y` R . , @~ג@ċ!  ʘ > "p@{n 8 $6 66 8P!؀ 2 `@=m D!Ԑ ?# @ `2 *`@(777  D <!   >   @{1" 㿘@_!؀ @a/! 0/ 2d2@!`  l  84 6 {4 8㿘>  @{ "M X & X㿘 h @"ΐ"! > #&!@N)!@㿘H@< <a  776?# @>  `2 #*` @<! #@"    @2  "&/   > &/bȐ &// $@< <a 77?#  @  `*3 *2 *`3` @ 777@<  77ې? @ ` 2 +`@  2`+  ( * ("@* *`@ *`*  /2*  777`T&/ #v"2K/@ " @y0$ > #H> #(/# c#\@:#`c@A9@: d#d d@A3#h> #@y֚㿘!?`#`  @> *` €        ? ` ``" ` `"   ! " `@ 4`@ * @!!@j @Ғ6!6!  㿘! ! b!!/ 2] !6! ?c "   K "! B " !>  6! 6! 6!   6! 6!. !  ``> Г*` €      6! h "!!• !쀣!@"!7!`@0 $ H㻐 h 2! &`^&` 26! <&`D"77a , ?# @ `*`2 @`"```  &` `  &`` &`  &`` &`` &` &` &`!•   < <aC"77! ?# @ `*`2 @` &`㻐!ت  ? z .I D?#  `  ה Z-   * 2` 5   h< #5`5@Ò 2I 2C?# @ `2 *` h@<  777 2+b 2%?# @ `2 *`@ h< 77 2G " h " A 㿘!؀ .1 .> &`.  @?&`?.`c    ,  ` @ `*`2@  "J `  㿘`6!` h 6! !"`! "`㿘  .    2` >*`2H"2B"2<"26"2?c 0(2 0(2  (2` I2b2?#(020b2"?(0*2b2?#(02bb2?#(02b (2 2  㿘`  ` >!D*` €T""z6`?# @2 *`r@E"B"?"`?`#   2 3 ** bb 6 b6 N6 `?# @ `2 *`@*"6 "6 "6 "6 "6 "6"6"6""6"6.6" )6`?# @ `2 *`@ 6 6  `?`#   2 *b *3 b 6 6   2 `*``8*`2` 0<$ܝ㿘@ @    ?6@"@&@@$@㿘**`!` &㿈!> #' ` / ` * ` * ` *   Җ # > @^#P㿘 h /> #`@v@@8N"!•  4!&/$ " p!"? x$" >a(@\F㿘 h  "@> @v#" @8( 6"" !"  " ?#2 *`@6" 㿘 h  "@> @u#" @706"!?"# !"  " * 4 6"k 㿘 h /> #@uĔ̀ D4̑H /f * ' @\ "$'> @\   h @u @ @3 @3 `$$!؀ > *#H i  6 2?H 0㿘/H /f * '  }  @w?;c#c 0 Q P$  0  h  @F> @uK #   4 ` "`$ "  @4 $$ "@$ > `V@[L.", h  @> @u 8    4 ` "`$ "  @4 $$ "@$@W  @2 0  @@[  H 0㿘 /H /f * ' ` "`$  "@ 6  &" $ $& "Ѐ  > `"@5p @ZҐH 0㿘 4? #o@Z < *`a  **2 ` "`$` "@ `"  "`   "@ @ "@2m @2j aА?$aЁ㿘```  @; q D @0  L @6o D,`!ԓ;` ,`  g `;`*  `2@ `g;`* ` ?* `@ 0 6 4& & "$ `&  "` "& & !В$!Аʔ >c@Z;> "C@Z9㿘` q`` @;` *   " ` `  `` @  `?    /'L C'P?#  2`*  ? 2 *`'PL'LP't 'pp x" 't h`  'l@ >  h@sl 4> à   aЀ'   ""!" "" h > @s H /f * ' lH 0>  b@Y/`2   "!v h!  v  s 't 6""!" ""q` 2c   -tS @  x  @/v  &@x""!" ""`  @@"@$  h > x @s%| 't= `0 @`-"` @ 0' ""!" ""`x   @ `` @@06&@'t    >  @r2` ""!" ""`   h > !@rޒ@4 ,6"l!?#{ w s @2 ,`'L@6L * 4 'L2L-`'L2`Lt  'Lp x* t  $ &?P> #/''L'P ) ?# @ ``*`2 @ ?'LP'PL ?'L'P Ԙ ! / ʘ >  h " .@Z`> @r_!0.2  h.@4 ` h > !X.@rJ.>  3   2 B > ' , :, <""""!" /'     " : " : " :  < `, : , < : < `, :, <, < , :& ! : < @, ;`, :? ` h > @q!@  4 6  h 8> !.܀ `"  h  ` `  h &>  !耢 2   h > " @q’ h   4 h " > @q"X >  4 b פ @W͐ h > "@q@3 6"!?'L#~? ~; ~7  @*L2` 2L,`'L2`L  * 4 'L2L!'L & > # > @Yِ"㿘/`L   h  @L> @qQ"0㿘/`3 2 ` h @3> @q8"0 ?8 0# 2`㿘 h ?`,# @ `*`2> @ @q#` l 2k @> @q#0` @2` ` P"=>  "+>  0   > I`$ @'> C`"4>  & )> 8`- 0> 2`> @p#8A`@p#H=`@pܐ#X9`> @pא#h4`@pӐ#x0`@pϐ#,`> @pʐ#'`@pƐ##`@p#`> @p#`@p#`?# @> 2`#@p ` ` `2 *`@>   @p ` ` , `< BđH /` * ! `?# @2` ``P( `` "!`0`"0`` `"0ϔ 0 ! 0 | 0 H 0@k㿘B "    > " r @Vh0 㿘 @ .1 H / * !  ` > "`J@V@`;>  H .H 0  H 0 㿘` 0  /`8 S@`> @o 0K` !@    `! `? `8 3@Ґ > @oא @0+H /` * ! ` "`8 > `8  @> @o h H 0@Y `~"@UĐ`?# @ `*`2 @48H 0`  5` 8  沐 @G  / "6``@``@$``d $`db"&`l $`l&` 2" $``$``8 d$``@`? `>  h @ ".@`*`> p € @6 zu  H /f * '   2         fH 00ݠzD  ֲH /f * ' ܒ 2  7 4 7 67 87 :z'/H 00 @6 z  H /f * '  " а H 00'  H 00|/4 > ⸠ }@TH 00h @6F cy˔  ]̒ ` ?@W4̐'I  y I 'H /f4* ' &   "Ȓ z  47  7 67 87 :/y@   @H 0   yy> @n)  㿘@   Hzǔ >>>?&%"`""& & & 6 h& x& 0  &  0@v@! 8&!! @!  @ @" !> @ @@@" > @ " >         &!&"!@l& @~Ɛ!> @mː!> " @mŐ!> #>!@ @@ז &!> @l !8! *&"" *`&"*  * &" &"$&"㿘H o*@ g@ H 0h h! 77!!+`!*!+ !@ !  77ސ 0@^7!&""&"@!3`7&" |&"?* !@"" 3`7|7?* !7" ! 6"  " , !"@!3`: /7Ԑ7/7֒П ! f"  0"$, !"@!3` /ː7/77Βȟ " f㿘!  㿘!  | d!`"!@!! l"!  !, 2!4  | d!  a" !€ !"?!€ !! !B h6 f @ ;6 h@Ð 0!> !h@lÒ !`@㿘 > "'>  2H!H /f * ' V* 4@  ""8@ <"`<<8"`8"($@d $0,@*k4&0 ?6>  @d|H 0N@H /f * ' V* 4@P  ""8@ <"`<<8"`8"($@dD $0,@*4&0 ?6>  @d/H 02j ; <!" <㿐H /f * ' >  @bQ H 0 #+>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ 2  @ް 0 0 $ $ $  '􀦠~> " 7ܑH /f * ' `@b H 0  4 H /f4 * '  5 H 0  $ $$ 4   쀦1H /f * ' > !@aȒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ( ' $ 8 $ ! $&@㿘%. 2 |   &  \ `& | @n 0@z㿐"; 2  > !@k  > !@k   &    > @k! ` & , " @*`  ! :/77 ! " ",  !  " @&"㿐T"`@ ;:6 h @> !@j˒  @> "@j’ 0@h0L !Ā`"@@  &  >  "@j  `&   & ``  "   &   & " " "?&""  , " ! `" h 0@m&"" "6 f㿘!€  ?L !  !  @   & (  &  >  @jA"8'   >  @j6"P `&   $>  @j)"h `&   """ A 㿘> b @h  X`f& X㿐 8 $@ @hb +> b,@a  b 8d6 8b@ib  Ԁ  @tL    ğ€  "=$b   & & $  ?& "1$b  , ",@m ,@b$*`    6 60 /77a a  Hb " b  $b 8$6 8$b 㿘H /f * '  0@w?   H 00\a2@a1@5a @a@"8G 0!5@70 !6@3 0<8 48 ` J@̒0.@  2868 ?#48 2 @50@{@{ 4  !Ȁ !@~ H 0㿘㿘 8!9<6`6`6`6@!h& @1  *;n # ?  @?`   @2?26 @22*@  * @6@ 2  ؐ 8 = 6 8 8<"6 86@6`6`6`㿐!'uu@㿐!'uk㿐!'@*ːx> "!耢!""#'2 "@ &"> t"" ?`@ ."< 4 @ ."=& 4."= H I.">>> b>>&"t&"&"&"! "4"?" ! $!&"H`-&"@"   ", , #\#`@$ #\#` @  *` ,@ `` t  ,"`>}"&"@- > "@h/   "P * @"@*`  &"L > @P# h> " ! !#"! ' w#,w !,w# `' !]c `Y ",  `/>  w d  c   , ,  H,, @, #\#`@:#\#`@ @/ϔ " I,, , #\#`@#\#`@@/ c   ,c > @P# 㿐` "! @"> ((( ( (>(  ("` d`e` " @? ` +@@`2` 0S /`D/` "=@`0  /  3@   /   2  3@  / ׀> @e#0"@> @e#P`2`  / @3@` @``>  cp@e @Ʉ㿐.`2 D@@ 耢 F$@,`4 #\#`@.L&. 6 #\#`@ @㿐" ? !@ "#\!#`@"?# @ `*`2 @6 \ "*@ 2 *` 2 *` *`; *` ` *@ 2  3@`0 ?  +@`` "\*@ @*`*` 2*` *`;`*`   *@  d2 2 0  *  `@?㿘@ͽ㿘"    ! *`v! *`v ?<!!* 㿘>>#(cd>! 8#&!&!>~>~&!&!l @XԐ???@t !̀   " @P @o "0@l 㿘!?@u?㿘@uܐ! 㿘@u!!&`!&`㿘@u̐!㿘@v!! ! `@(㿘" > #> #v㿘" > #> #vt"!؅0!(㿘>>!a<>! 8!d&!&!>~>~&!&!l@Ԓ ???@tr !̀   " @Ζ @ "0@ 㿘!?@t?㿘@uZ! 㿘@u|!!&`!&`㿘@uL!㿘@u!""(㿘> cؔu㿘> cؔv㿘>  P> \aȀ> @e_#0N#> d>    @`  ` `(@ 2 P> d"$c0%#,0"c(` @'   )> d  > \  " 0> \!!%#, @!\ #> d $c$> @e! (0@'/#,c$"! ""P> d"@"> d"#0##(? 0   ` > d(   㿘#`c, `  > d@  #(> d#$c,@ " #(c,0"  " @8 @7+ ` > d> d, 0  ` ј ` c,  ,8DPH$$$ tT t t`" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @2Ő  &` &`&` &@`6$ $$@  㿘  @2 &    "  20   " "  ` "@0 @ ""`" `" ` " 㿘> ה80`B :0   㿘)> א#,@X 2$`? ,`9 `,`8 +>   (4`4 Ő`$ 8c(4`6X #> # `> @b X> @b  @n > @b  $ @g > @b   @` 8> @b #,M#,@XP 2$ Ґc(#,A  , 9 , 8  8 4 4  $ $> 4 6! ,> > # `> @a֐ > @aӐ  @( > @a̐  $@! > @aŐ  @ 8> @a c(@YÐ#,#,@Y?0 "8 8 ̖`B" : 8@ja  㿘H /`* !@S @4H 0>  > p,@G㿘 5  6 (  l> > >  Ȓ`ؖ@_!•* ` a> ڐ"0  `> aa"0> !c! @ $ p} @*$ >  0  8> #'!> ِ!̒? > צ"8!`> ` 8` J 2 @  l  8 #\` (<#`#h#d#l@#p`'`!> /` /` ``7` ``(`#(`8Q7椒 2 > > >  Ȓ`ؖ8@_2!`@ > > >  Ȓ`ؖ@@_&!#(`@i ``l̐? "` @Cl` t`"  pa̐? "a` @Ct` p`" `a̐? "a` @Cp`@@!> `> @X!ؒ@X#,#,@X@̒`B <@$̢`h > @I!`㿘`$ 2 @b&` `?㿘 $   @bF&  $ @2" 耠2" @?" 㿘 $ !> 0  @V )& l @k  "` `  "` *  >*`  t`@3S  "` ` @   @X8 &  㿘    > @^s!xH /`4 * !  : `"2 ` 2- `   @"[    `   @"I   l 2. 2 . H 0㿘 $     @2>  @WƐ & 㿘 $   lU  & 㿘.`0]> ` 2` @_!.`2``Q> @_!0M     * ` 2 ` " "@ $      *  %> )>    2 @_[  .@_U!8 @_P  倢6``> @_E!㿘 ">   "> >  :"> > @_/! > @_*! @_&!  @_"!  @_!  q!> @_! $  j#> @_! 8 ( c <a @ H@_ D K` >  c "> > "@^ `> @^"( T X `@^ \ K`  c`> "@^ `@^"(>  b"0@^ J㿘  > @^Ӑ!耎  > @^͐"8  > @^ǐ"@  > @^"H  > @^"P  > @^"X  @> @^"` @ > @^"h > @^"pxؒ"? 6" !!@" "@ ؀" " " `ah'" " @ ܀" "" dah'" "@ " "" hah'" "@ 䀢"  ," lah' , ,@@g  耢"  (" pah' ( (@ - -@ 쀢"  \" tah' \ \@ 0@> 0  "  X" xah' X X@ ] ]   " |ah'!h 2k! *`   `  `"  ah"  `*`㿘 $`$@2J `"G `` > 0=`"4 7 $ ` @26  `@21  `@2, @@ ` `2!  `@2  `@2  `@2  `@    `  @ > @]"x 㿘 N! "!h@!N!( &!@ !(&!&!!h 2N!㿘> !@ "  $@# 2  |  $ 㿘> ؤ 8 *@ L!8`!8@?$!$!!h 2L!8* * ( (*`00*0?# 3   +  + 2 㿀c> c '@_ 6@ 0R  `*   2 66@ * / `*  2 *  2 *  2 *  2 *  2 *  2  * 2 * ,/`2 2`2w6 > @E'"㿐 ?'L*  * @' * * * LL `2 `2.  `. . .L@?L @ * 2 B6@㿀!> #'  -@* '2 * !2 * 2 * 2 *  2 *   2 * 2 6@# > @D"p\> ` d o' kȔĒ``@@*`` 6@/ @24 Җ 7@@4 @̖ ` 4@* @2 Ö 4@  `#U *   2 4 @ *  2 4@* 2 1  @*  2 *  2 *  ~2 *  x2 *  r2 *  l2 *  2 e4@B``0@Ж U* 2 O 35Р G@ґ* A2 ԑ* ;2 ֑* 52 ؑ* /2 ڑ*  )2 ܑ*  #2 * 2 4@ > @C͐"㿐l'Lp'P* g j7  `    ``(  @    @t  @0@ > !Ԁ   @   `!&`" "@> ! $   $ $ @$   " `   , L4$ P@$ L ,,,gPg (` c-`  $` ,` \4@`4`$`$` 4`  ,`,``g|   + 0:@4` @@ /*@@ $ > -,! ` 4`4> - !,,4     @/) 0 (@4`  @ `,,    @ 㿘  @_  3沐 @L  @c0'@f!Ԁ   @G    !$ " "@S 0 ` @\ 0`@ɖ    `0&@@```` ` `  " ``@ `? ?/> ( ( %@     `? `? @  @ @  `?@ @ `? 㿘.`.. 2`2ė2㿘     㿘     㿘 @Δ   㿘@?2b "'@'@ꀦ2'@"bꀦ2'@b a@@"  a@@2 㿘`26@  @J  22` @Z    " 0$@*#@@*#@`*#``*#` `  *#`  ```" 0 "  " "  "" " "  '"/@0@ " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "@` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"@`` @" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"```@" 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# # 3`"`@ @` " 3 " #@ *#@ @# 3` # " 3 " #@ *#@ @# 3`# " 3 " #@ * #@ @# 3`# "` x> #`' $  2` `2 ` `$  ``5  "`5հ ?`5 `> D*` €ܐ > ܐ > ׀ H   @`  =  9 5!# @5&`(`?@-&`$`?@%&` @?@&`ܐؖ`XZb> נ`{ܖ   ` ܖؘ<J> ` `$ ``  `,ܘ@Yu 2 ` ܐ ؖ6 &` (`&`@&`` $ ?&`, `,ܘ@YQ `2 (" 'ؒ 'ܐ > # `( `5  > @WS"Ȑ  > @WL   > @?"0\> `'L''f'Pj'T@A  LP  7  2 2@İ'ԲT//`7䀦`> ِ!7-` .`4> 7! KLs 42`  > ِ!7 =L c2@@)-`.2`4 @! $@ @* 2`@'> 7q  *`2  ?*` 4%> 7] ?*`2  L `5 `&> X*` €LP\ 2   @{T@vT@qT@lT > # > @>"㿐h> ؐ  (*   'Lf'H`7^  "     !x  0 0!!`B  `"`> @R# h*  ( @ "  ah  `2> @Rؐ#  h(*`( @ " ah `" " `" b    㿈d\ `hl* 2 *` 2`#h#\#`#d Ԛ *#\#d#`#h * 2 *` 2`#h#\#`#d  #h#\#d#` p" ?`j> l*` €#\#`!-#d!  3`#h!p U> # `P> !#8@S!K F!x `$   `2<  q`04 $ 2  `2, a 0$"!p 2 !-! X2" "@ `!?c 8" 5@! 25@0 㿐?$ &@  0T`> 6`"t`> 6`"@`` `   `*`9 @*`'2`*2 '@y 2"8 *2 2`@ 28 @ 28  `$8`&@H> .#6' #\  @8  Ā$ @   " ` `` 8  ` (  @&# > @;z#h@> -"z> c. 6' 7#\ @  Ā$       _   (  &# > @;:#xX> - > bx#``'` `0+ؐ@’ * /"@쇒  @퐐 -,`@ *   / "  " " " @m  (,`@ x B$@?* 2  * 8 Ր?"8,`.2 2`@8 @ *  > @:֐#㿘 l& "   !p0 !p   x !x`@& (d'L>  ?> '  '  'D l'h'X''H'PL'7'-'β .`2 #\#`7#d#l\#h  B' `凜#` Β#\ '+ 7#\#` #l#d\#hP  ' `{#` Β#\ ' b`2 `'7> ׮ `aa`B  " > @N# `H`"``h ``2> @Nq# `H`"``h `2FaDa`B 8 b \ @& ` `L#` `P #\@V b eb [  ` .`3`#\#` `.` 3`#\#` 'b !    @2 #\#`#d#h#l b #p ; b  a*   2  a  b 2 b a*  2  a  b   )8 b 2 2  2   b   2 \* aВ% "@à  > ؐ!@E  8 ( B: (7K @I à $a̐ %& l & t& t t`"& pa̐ "a& p b . bL `. . . . ` 쩔 (6 $죔6 8`요#6 암 $6  `썔 (6 쇔6 8  ~6 $y 6 $-2 @ & @& <  2& D b %> @ & D <   '& D%>   @`& @ \l2. K`*  K 6 H * @?: 6 H   @ & @ . J& T& X6 `& \. b& & & .  (&   \ <@-r T  8( `B :()7   P  T#`#\\@-՚ < @->  H@- 8(`B :(7> ؒ@FT!X "@  J b F . J .` 3`#\#` 0  3` #\#`@r& @ \2* 2 O* 2 J6 L @ #\#`#d#h L#l#p  \@6  > c > @6Z#(d'L>  > ?'  'D h'Tl'X''HL'P '7' +'@7*2 #\#``#l7#dT#h\ V @ E #\ΐ#`}`" +'`7@#\#`` 7#l#dT#h\P. '  #\#``T`  ' 2 `'7> װ aa`B  " > @J># `H`"``!h `` 2> @J$# `H`"``!h `2XaD@a`B @8 b T \@ٖ `L#` `P T#\@R b `2A b b <   * #\3`#`` `* #\`3`#`C`'  a*   2  a TŘ b 2 b a*  2  a T b   T 8 b 2 aЀ 2aaЀ` à  > ؐ!@Av  8 ( B: (7 @ ' à  $a!̐ %!̀ & l& t& t t`"& pa̐ "a& p b . bL ` . . .  .  舔@6 $ (肔`  6 8z&6 s $6  k` (6 e@ 6 8 \6 $ U 6 $ . J& <& @& D6 H& T& X& \6 `. b>  &  & . & & ?[ 8( `B :(7> ؒ@B!  H"`T\@Ȕ  >  > @2#(d>  `?`  ` 'D ` h'H'l'L'''̲  '' :> ( X` @/`?7 ` /  > ؖ '` /  *`   /7Ɛ '>  XL-@\#\#`#d#h#l ƚ J 絔``" `<b`] 5b `탐 ',b\#\#`#d#h#l   犔``" ``2  `X  ' 2 ʀ 'u1> ע !!`B  " > @Fݐ#  H "  !h  2> @FÐ#  H "  !h 2!D!`B "8 "" " ``\@w L  `#` #\@O@ "    "8  " 2 !Ѐ`2!Ѐ!Ѐ` !̀ `> ؐ!@>S  "8 ( B: (7 @  !̀  $!!̐ %!̀`$`l$`t$`t`t`"$`pa̐ "a$`pL "`,` " `,` `,`L,`,` `eƒ4`$`(_ƀ`4`8WƒQ4` IƔ4``(Cƀ4`8`;Ɣ`54`$$`<$`@$`D4`H,`J$`T$`X$`\4``,`b>  $` $`,`$``$` < "8( `B :(7> ؐ!@?|  H#@ `\@  >  > @/͐#H`'L>  > ?'  d'DX''Ph'TL'H '̶ ) T#\P#`#d#h#l Ӛ C ” ` 4i -䰔 (T#\P#`#d#h#l   䛔 `  "B "䉔 " 2 ʀ`'n3> נ aa`B  `" > @C# `H`"``ah ```2> @Cސ# `H`"``ah `2aDa`B b8 b  `L#\ `P T#`@Le b = b 7  2  `` `0  `Ɣ ``a*   2  a Tꍘ b `2 b a*  2  a T~ b  ̒ T b8 b 2 aЀ2aЀ  aЀ` à  > ؐ!@;@  b8 ( B: (7 @ à` $aa̐ %à& l& t& t t`"& pa̐ "a& pL b`. b `. . L. .  R6 $ (M6 8E!6 ?6  86  (3 6 8 +6 $ %6 $ . J& <& @& D6 H& T& X& \6 `. b>  &  & . & & , b8( `B :(7 b   `L#\ `P#`T @Ko> ؒ@<]! H" >  > @,#ȁ㿀>  X@?` '\ ` 'm-> ר !!`B  "`> @AE# ` `H "@  h  `2@> @A+# ` `H "@  h 2!!`@B   #'d'  'P/ 'X' / 7 7> !> א#( % " 2l b b 2  b 2   T<T < J 21~  <@u @ #\ #`#d#hL#l #pl O a @ @\> < @U (J J`  ((4  @ @ @;> < @5>  * 0H X`2@+"`X X`#\#d#`#hL #l#plm >   X @ >  * 0` " T#\ #`#dH#l#h#pl  F @``#\< #`#d` #h#l#p3l < X" "D`T`@" "`\H< "@```T "`X*K*c* J* b `  `  2@  ` @   2` "` 2PX@ :   2@> ה8(`B :(  "` 2@ $`@ "@o j  '  `!@   P2 X ,` - 2 *@  ?2   *@6 . 2  ` $@ ,````  * &  -* & $`-` 2  8 4`  `"@@    '  `@ `2   2  " @`@#  @*"@@ ?"%~A!ۚ* 4y/``@ - "@ 3    " ` @ *4` @$ 4$@+   & &   `  ,` " `  ,` "    2  .  .,`>  "` ` ( `  *` ``8 ` *` ` *` ( *` *`? ? ` T?"% OA!@@ I> # `> @?# > ##\ @?/``@ - "@ 3    " ` @ *4` @$ 4$@+  & &   `  ,`  .,`b (> J $> ׀  @2 #\#`#d#h#ll b#p l :  4` $@V$`# `(ذ > @? B  #\>  h>  p#` 2> >  x #d>   0@?d`@  1  @*#@  2 ?"% 3 A!ۓ*  4 $ @  5 @  6 #\>  @?9  ` #`#\PX@ s @  2$@ @   @ $   $   #` #\ P   #` #\PX@-   PX@# lᰒ`B : la@ B ;at"`B : ta@ B ;a p  `B : pa@ B ;a> # > @' H`!>    #/' 2/.7`7> !> א#(4& y`2 l b b 2 b 2  2 ঀ@<T< T *`@  "@   " `2 ` +  ` >  +`>  "`   `   *`@` 2$@`@ `  @`$ "`  $  #\ #`?    #\#`ے@= lᰒ`B : la@ B ;at"`B : ta@ B ;a p" `B : pa@ B ;a # > @&5 ЁH`>    c': 0 @` `        *`    2    //$ 7怦`7> !> א#((& `2`l b b 2  b 2 ` 2l >  @@ *  " `@  "@ `" *`      ``@ ```@`@`@"7 `    .> ``` @S   "  @P  `v   `/>`"+`?`#\  @  > # ` > @<ؐ  ?@߰  * /?','0Y'4#\ ( @š  > # `ð > @<! > ע"8/?','0'4`0? 3> < +" ,  ( Ġ % 2" >#\  @  ?`Ԁ  > @<}!8  3 *  * /? ?? >  >\ :D>ې\#\  @Z  >> # `[ > @耦`7~> !> א#(ݒ& Z`2 ``l b b 2 ` b 2 `` 2! `@`T`<`T`<   ` 2 `쀢 "@C  >  *"@@ <#> # `( > `!x@;ޒ  3 > @;א!  ,> @;А!܍> !@;ʒװ    ` 2```@```@ `` ` @```$@"E`2`$`#`4#d>#\#l ,#h\ >#`4#d>#\#l`0#hL >  @  @ @  (@Y耢 sm >#\   @]  >> # `^ > @;L!Y /A0 /@ޠ,7<,>`7>> !> א#(& ]`2@`l b b 2 @ b 2 @` $ @`@` ` 2```@```@ `` ` @```$@`2`$`#`4#d>#\#l ,#hު> #`4#h>#\#d#l`0ޙ>  @   @ @  (@ #\   @  >> # ` > @:! /0 /2̐7,,>̀`7> !> א#(4& `2@`l b b 2 @ b 2 @` x @`@` ` 2```@```@ `` ` @```$@Z`2`$` #` 4#d#\#l,#h  #``4#d#\#l0#h @j  @e( >#\   @  >> # ` > @:" /0 /יĐ7,ד>Ā`7> !> א#(כ& `2@`l b b 2 @ b 2 @` ߰ @`@` ` 2```@```@ `` ` @```$@`2`$` #` 4#d#\#l,#he  #``4#d#\#l0#hU @є  (@̖ ? 0//H,7|>l`7~> !> א#(& `2@`l b b 2 @ b 2 @` 2_ @`@` ` 2```@```@ `` ` @```$@A`#` 4#d#\>  #l,#h>`4#d>#\#l0#h  ֚ >   > @J  @E @>  (@8 > # > @!\"@P!>  #/' v/r7䀦`7> !> א#(z& `2 l b b 2 b 2  2 ঀ@<T< T *`@  "@   " `2 ` +  ` >  +`>  "`   `   *`@` 2$@`@ `  @`$ -`  " %  ۟   `  " ۊ3  lᰒ`B :lḒ@ B :t"`B :tḒ@ B : p" `B :pḒ@ B :Ḱ # > @ p"X㿘_``)E * 2    277;  7`27@> ה8`B (: @   !  @     *`  (   7` 7@> ה8`B : @x> #'@ * /" @w؀` `8   ?"`8c  > @"p@q c`> #' ">  ` >  2b> @5"`` 'Ē @y 2   @+  @=沔 @  ' b @ `? #' > @5"@E ܐ ,` / $`b @ч؀`2`t> ` `T "`T "`t4 `@0ap  > @5b"2 x ap ˘ Ȁ 2$`ax @ 2$` Ē @     @  @Ā2  @'Ā Ā"vb 8> @5'"  @ 83  "  0 2 >   `" x "x4 `@^*`4  > 5ba,  "a, > 6b`0 "`0 Ĕ 9b@>   L`" Lb=Ę  @ &bĒ@"(.0Ā  "  Ĕ @Ā'Ā2b> ` `D "`Db 2&#؀`"#`8 ?"`8@d@< # > @"X> #' ">  ` >  2b> @4#`` ' @> 2   @  @沔 @  ' b @ `? ' '8> @4R# @  Ԑ ,` /$`$`  $`b$ $`  @  @    @K ap  > @4&#P2 xap ݎ  Ā  `Ȁ `̀ "ax`P ax @ ` |  ` ` ` x;  I @ 2`  @a  :@s @0 1 ")b`? ?  44`  @ @㽘 b " b!@`B:`b    @@ʔ b 2&@~db > @#x㿘      :  {   @ !  o*@f*``ca@  @]  "$ ]   @ N"@ & &  @\  "@& &  ;@  '3@* ,6   &    0% : 0 > 5b` "`> 6b` "`> a` "`> FP(`B :(  4` &  > ע"8> `Ȯ"0'`7 ''x'   @ "F 2> @2# @   7~ ,     7~ ``B <`7y  ??ؔ  ???'''  //  /?? #\#`S7~    _ #\ 'ؐ ~B   "   2+7~ԑ2 "@* Œ"@'耢`" В#\ @g* 2``7~#d#\#`x * `7~x`l' `x > ؐ;h#\#d#`x᧚ 7~ #\ 'ؐ ~ @   "   27~В#\#`x * `}7~x > ؐ;h#\#d#`x˚ 7~ #\ 'ؐ ~  ~@  " L  7~#\#`x Ě* `!7~x l'`B :Ḓ@ B :xp '`B :!@ B ;!x6 x 3> ؐ;h#\#d#`xٚ #7~xc* ` 7~x l' p' x > ؐ#d#h#`#\x֘7~> #@ & @? b8ਔ  Ж ~@ B ` ;  ` H    `B :0 x " $ t 2 $ 2 Tx   b   `?#\ , #` `? @3 T ~x    " `?#\ \ #``? P@3~ $~  x " ~ "`~ 7~ b8`B 7:Ԁ  > @2#~  !Ԁ`  @_  2!!" "" @b  #\#` @9 ~ @{x& 7~ b xޖ~> נ"8>  Ȭ"0'`7 '''   @[ "`= 2`> @0# 'k@   7 ` ????ؔ ?''/'/  *  ( ?` $ / ( 3. < +"* , %IFA#\#`Г* 2``c7b8  B: [7#\Ȗ  ܚ b8 Ԁ > @1̐#ؐ 7  `B < 7?  3ɐ *  * / ` :  #\ 'ؐ     *@  H  27ԓ2`*`"" '#\ @ʚ* 2``7#d#\#` * `A7 > ؐ;h#\#d#` 7 #\ 'ؐ O G ΀   *@    27В#\#` * `7`l'w ` t> ؐ;h#\#d#`- d7 #\ 'ؐ    @ y   *@  :  i7#\#` $* `7 l'`B : *  @ B 8!  > ؐ;h#\#d#`E 7;`#h#\W7> #@ & @? b8ด  Ж @ B ` ;  ` x    `B :0  " $ t 2 $ 2 T   b   `?#\ , #` `? @1l T     " `?#\ \ #``? P@1P  !Ԁ`  @  !!" "" @   #\#` @7.  @y & 7 b  9 `9\ 8 `8W" G4`K  I?$`$D 06` ?  =?0`08  6?`1  /?,`,*  (?`#  !?(`(  ?`  ?$`$  ?4`46`6" `" 2 <" "<  2" @"@  "`2  ""@"  " " "  2"""> "  2 " " 3 2" `"`  "`2  ""`"  " " "  2""" "`" " ݘ  2l ` 2 "` `"` ` `@2""" "``  n "k  2` 2"    "2"""" `` "` 2 `"` ` `@2"""m  "` @"@ ` `@2""" "`@ "   A" 2` 2"    "2"""" @` "` 2 @"@ ` `@2""" "` " 2@2" 㿘@2`@` = " 2 " "& 2# #" @"`"`"` " ``"&@2"`"@@" ` 2"     2 ``` " "&2# #` 㿘@   @-  &` &`&` &@`6$ $$@  㿘  @  &    "  20   " "  `㿐'> > #\cᘒ   @" #> > #\caH 0  @" %> > #\` 0  @" !> > #\`#l   @" > > ` #\  `  @"z aH@&a#cᘔ @&l  c @&f 0#lcP @&` > ڐ`P"`P" > ڐ`X"`X" 㿘> > `("%> +> # ` > > `@, >  " @,@P ` > ! "  (> > >  (`8@+) > > > פ Xb8'> )> 3> 1> /> -> @,ѐ  "@,͔@`X  @2 @> ( 8@+  @  ! 2 (( 8`@* (ԁ㿘> "|* @^ > ר b8`Ԁ > > aH@, |> !`@,"@|'> > ڔ P` "D @9| D` @ D *@/ "8`Ԁ > > aH@,g D> !@,b"@D> ڔ X`  @D` @ 㿘 ! 2 , , ?%> #> ` "` "@uE @$<b| ,? $b|0(&!> #> %> '> `""`"@ , " >   @8> ِ`(8@*Q! @$#l!D ,?$!D@U ` * `2 "` " `" hȒM =>   !& ( `>  "` P"   "PP & P "` "`"PP `>  "` X"   "XX & X "` "`"XX& 㿘 ! > > ِ" `"  "`> " T  "> ڐ!H@#0"q `"  "`> " \  "> ِ"@#㿘? * *@"*` 'P  ! "  > > >  (`8@)!J   "@ & & @ 2G ,!> ڐ!H@!  &@!H@! &@@> *`!@2 $@` " @`" @ ` * @`2 " @"`(@" ,> @`"@>  P P`"@P "`@ # @P"P@"` /    ` ,2`*       ` *  $   > > >  (`80@)+!u2 2 2@v @3 # @+  ,* @ "@ 2@ #+ @" "-`-@Z4` @vw> # ` > > bP@* > "`@*4`@% @4* 4 N/  #-,2`2  @*@ @> ת"8  7> 1> -> `Ԑ * ` %@"P@*,`2`@*p ,` 2 * #@#@s `"  "` "@> ْ@"s!> b|?` "b|` * 4@5$ *2$P  @ `! *`!2@ ,`&@ ,"`@"`,@ , & &" %&@ `! Җ , 6+> #> >   @` * " *$2  ! ` b8`` * b8 Ԁ` @* bP`"?`  @*@> `$"@) `2 b8`Ԁ  ,> > bP@) @> `$"@)4 @4 `$  `,2 > > >  (`8@(!? c *  $ `Ԁ  > > bP@)Đ > "@)@v ^&@!> @uE&@!!> b|?"b|  @@!!"|?$"|@u/`2 @ $ @ $@&@ * 4  @  " &  &   @& b8 Ԁ`> > bP@)p > "@)k0 > ْ@!q!> |@rq"| 㿐@` `* *`"'P'T    ! 2 > > >  (`8@'" 2r ,!> ِ"@  &"@ ]&> ِ#l@y > @!,"Q&D  "D> *`!2 $` "``"` *` `2" " (44 " ,`, $ ,"`"`, ,$> +">  X X`"X "` # X"X" > c > > c8@(Ԑ -`-> `#H2@(̗2   -`2 @    (  > > >  (`8h@&"D-` 2 $@@ > # `> > c8@( ->  #`@(3`P`# `> > c8@( -> `# @({3`4 _> # `> > c8@(o `-2 > #\#ؚ@(d%4 T C@@ * @r%  % " @> > >  (`8@&"q `*`@s@ @sђ   <` ` @`&  ` "@" `> > >  (`8@&f"" 6`+6`) # `> > c8@( `-2 > #\ H @(> ِ#l@U 2> aD "aD44  $" $$ - 5 @ > ג"8`Ԁ> > c8@' -`> ` p 2 @'ח5 4 h `>> ג"8`Ԁ> > c8@'ǐ  -``>   #\25 @'T4 % ! @sk     ` @`&  ` "@"36`> > >  (`8@%ܔ")"8`Ԁ> > c8@'  -``>   #\ 2@'5 > ِ#l@Β > aD "aD44  $$ "$ j-  @'"8 Ԁ`> > c8@'\ `-`- >  !#\ 3 #`@'N3`4 `""`"@> ِ#l8<  @6 "8> > >  (`8P@%r" Ԁ`> > c8@'% `-`- >  !#\ 3 #`@'3`4 `""`"@> ِ#l@> aD?"aD@P-$2 @*2$P 2 `! *`! ! S,` N` $@I> # ` > > c8@&ڐ > `!`@&$7& '@P .`* `!& P  T` `! *`!T  !`2> # ` > > c8@& > `@&! `! *`!@o 㿈>  `8'` @ *  `2 *, !!`B  ג"8`Ԁ> >  @%a> @%!8`$> ג"8`Ԁ> > a@% > !@%85`?@#> ג"8`Ԁ׮> > a@% > !@%͢8"&K> ْb  ' `! ,`$2  /> > ِ!@  > ـ 6> ה8(`B :(b|> א "b|$ $  > > a@%N ,> `!5`@%G2Œ & "P  ! vJ ` ' @xF 2U "> ْb3 ' !,$2  ( ""$`/> א]*!"3  & 80A`   @w͔  ,@wߐ " " ! . "` 4` " `"" ` *,`"(O @7K4` `G ` *C,`0A 6> ה8(`B ':( 6> ה8 `B : 8`Ԁ  > >  @$a> @$" ` 6``B <`   "  `#\#`@+  h>  8 @'Ԁ`@aa`B  T *` '7ԀT (  P &#\`w `  * @"Ԁ = (  / b `X  *T- 0R  * @)Ԁ ' #\ؖ   ?ږc c $? 1  6> ה8`B : 6> ה8 `B  :  6> ה8`B :`"  b   #\#`@)Δ  㿈>  8 \ @   `!!`B  ׀`2 `` ` G> ׀`2  `A> א `( =>  2` 7 @2 @`  ,  *`*$ 2`  4` 2 !`" ! 44 !耢  @t 2 @lo  > א"8  B: 7 "   ` #\#`@(*  H> # '  > > > >  (`8@B% `@L ' N @   "        *` "9  2 (4   /#\* ՚ $ 2 .쀦 $       (   `@2 "` & # > @ "0㿘 P`" h> @ ` h`> @ `@\> ` `  '  2 > > >  (`8H@%l  " ``"   ` 8*`` * "   `  @8*` * 2  ` " 2  w s2#\* 9 f ġ2 , ?쀤 Q?# D  @>? (9``"@ * @@ ' ,` ,` ,``  G'`"@ / ,` ,`  ,``#  .'$ 4  %@ 2*`@k > @7"h 㿘 `2 @* ? ` 2@`a耢@ ( @g6a 6`@&@   `  "`" ` ` ?  ` @@ ?||t㿐> > #\#,b <  @ !> #!> > #\"Ԛb"   @ > > #\b  $  @ !> > #\!ؚb   @ > > #\#b   @ > >  ؚb#\  D @{ @7> @#"1> >  !ؔ @l > "#(> "a> ؒ""""`> @ > ؔ""""> ؖ"""> ْ!"!"`%> $&!?@?#a x&T #al  <! # - Z $ $ 4$ 85> $ $ $ $ $$ <+b >$ $ $ $ $ ,$ 0`@$ (>  .  <@|> א "c ?  0  ?  0  㿘_c@ "G @G`4A `  *` , 25 `  ( ( *` 4 2% `  0 ` 0 @`a  `ah`a2ah`ap  ><(        㿘 @ٔ Ȓ    && & & & & `   㿘> "?   @Ȓ & 㿘N  N@ 2N1> !  " N@ . .`     @䡒 & @䙐   㿘N  N@ 2N1> w  "t N@ > . .`"``@w &@` `@o  $* $ @  Q $$ $ $ $ $ $ $ $  *q $  ` $ `$$ `" $`$ $  ""  ``@< &@` `@4   Ȓ @Ӕ  @ *> ` & `&& `"$`& &  "@$ 㿘 > : 6 Ā 2  ( 0  `* `% ` "`$  "@H   `"  "`> "" "@@5 , ,",( "(`(",` "`2(㿘 #> Y (` ,"`,&  , ("@`@ 㿘 à 2ah`0ah`al"al& alah"&al?&aà al @a@a`0 \Zap> ؐ"@㿘>     @W  ":  ఀ , ,``* `2 @"@,02`#P@  @ܔ  ! @޲  @=  4 `` $ `$$ `" $`   $ $ $  ""  㿘>  `. 2 `2@`@ 0`2`㿘. 6  >   ? "`"`""@ @? 0`2㾀> "> c 'i 0 `;@*`:@a0@"^ &@ "X* 0 @P$@0`2@"J'@D0 `9@<`8)@0" P@"80`I@ `?@.0 @+ J 0`6@!`5@0, @" 0#`0@`/@ 00: @" 0`@`@ $ W00G@&F@O09@8@H0 @ "D08 ': @<26@0 `:@ 3`;@2@@-?"@0#`0@`/@%0`6@0"`5@I@ P0: @0 0`@ `@ 0 `B0, @0 Ͱ 0`B@" L0'@"O0`+@ `@0 `@`@$>   `&@> `@>   `*@  0 .@ ">  @ " ,`N@ <  @->   @"I@" y @"L s  @"H+08@" &0 @"N(@"E \ 2@3  W0  :@ " . ;9@ >  I @  D `>@" @L `<@" 'L .0 )@ר  3 `@@ BL J 5 H07@"3`J@" HL`F@" L `D@ _L h Q `H@ L  x `3@%>  `L@" L `M@   5@"N& X0,%@ "$0# /@ "g&8 10"P@   -O@   耦@  耦@" Ѱ  q@  ʰ 0 @ "*8  @Db0: @>   @ " X @"  > ע"8`Ȁ`"`  @f > #>  $`$`̀$`В`@ `Ԁ  > @A" "8Ȁ`2    "> @2" ~) " x < 4 s * 0@` 4@@` $ ]&ے " W <4 Q Nh > ؐ 2 I 2  (d*4 @  # > !@ 2 8 !> ؐ"@9 00&" $a$a$apap$at$a$al0  @`"$aa $aLa " LaH@%a $a,"LaH " LaXaH* `4a LaX " bݐaX* `4a  b " b b "  bC 2 `0 b< 2  2  2 > !   2  ( a9 b   2 bLa8 "ap b  ap "  ap  $ax !@ 2°  ސ= " < 4   * *  ,@  "@ & , @ ª 2  ( !> ؐ"@ 0$" $pp$t$L` $l@# $"$L "LHL( $($$LH " LXIH* `4 LX " >X* `4   "  "   2 0  2 d 2 ^ 2 > ِ!   "L8   L8  p "  Ð p  $x<<<> !H /` * !   (.@  ( (@  $@@ @ h 2h  H 0耠q ( $hh`$l`""`2 hlh$l$hl""l`$hh"alh"`h"h$l "hƐ@ %@H 0H /` * ! !> ْ?!` %> ע `*  2`8" ̑H 0aH /` * ! !> ِ!? A` ` 4`"4 `@,4 ` "8d `H`( 5 " e02` e "  `b`8  ,` / 2{H 0.  2 > آ!@  " H /` * ! #D $ l$ t$ p$ >  $ $ $ $ M$ a@ H 0H /` * ! !> ِ!?א` `2 ` H 0" `l!&p` t ?!&x` p ?!&tH 0`> &@(&"@}& * H /` * ! !> ِ!?  `H 0.`* "* "* &R H /` * ! !> !? G>  `@.`* "* "*  @`@" `l!'` t ?!'` p ?!'$'D`'А"''А! " ଀```(`.`* "* "* &H 0"8"A 耢  > > "c#@נ @ ܐ > @> ""8`Ȑ`̒ `@׌`> #&`&`&`Ѐ`&`Ԑ`ؒ`@ $I J/9/8@H 76IB`74H " `  ` ` ` "  2B 2 B 2B "{ B "w @ "s H /``* !` > !> א#( `   6DH0B6F0  $ 6FH@6D H 0:耢`86 R> ڐ"0*`  " +&H> ڐ"0* A>  *  &`8> *`   @  2  * "&> "#  H o4 H*@ a H     :!:!:!!h 2:!H 0H /` * ! > !@ %> א '`@R' > `` L`$ 2`@Ð "    @E "` > ܐ "ctH 08 Ԁ`> @T#H /` * ! > !@%> ׀  `@^  "'@  "`` L`$ 2`@v 2`  > "#tH 08 Ԁ`_> @#\!Ԣ@ )> %>  `"a "` "`  "L $@ 9@ a 2 #  %# 4&> # @ . > ئ#@ . %  } L$ > !@ @  2 L $ 2  $@א @ Ē> !Ԗ$$"!"` Q # ԨH /` * ! > a> @> ! # #!"#$ 2"aL $ 2 @   2L $$aԀ`"a "` "`  "L $> @S  "@  "> ؒ@ e#a 2 H 0> ؒ``H> "`` " @ H @`2`H /` * ! > !@` >  &``2> #$&H 0a> #$@ 2Z  H /` * ! > !@      *     H 02 H 0(> #$@ !   'H /` * ! > !@    *  2  H 0@:H 0  .& m!> a "a&   2հ !> ؐ @֒ ͐4& DL0 " @ɐ0 $@ ݒ >  Ғ$(a`($,`""`H /` * !  ##\#` 2  H 0耤  &(2H 0yH /` * !  ##` #\V 2  H 0X耤 ( *( 4 H 0> D4rH 0.? I X   2! #  #`#\ "   +!> ؐ @  4 Y DL`0 " $`@@`0 $`@ E    ϐ ؒ@  H /` * !  #2 @     (   * (   H 0耠  (` ,"`,$ , ("̐> ؐ @ W$ $`(`($`,"@$2  ( ,`($`,$`( ," $ ,`$`(`("`,`($ ($ ($`,$H 0j> "`"e &@`2\"  *./ "B & `"> &@`25 O    * s 耢   d@  \ L H  dXH@ (P H d\H@ P  H P@ E d   H P@ y d H dXH@ P۰ Hذ d\H`#\PT@ :XͰ ʰ  d@> \ݰ  H X P@z d   H \ P@8 d  d`#\#` H T P X@Ț \   H P@@ d  H P@x d   H X P@ d ~  H X P@ dvL r  d h@ _ \k h  h X d@h ``L ]d#\ H X P T@  hQH /`* !@  H 0?H /` * ! @H 0)H /` * ! @ߐH 0H 0 H 0 > @# UUVV,VW@`Ѐ"Ԁ2 Ȁ<̀"Ԁ"< ̀ 2"`Ȁ"` Ѐ "`Ȁ2  ""`"І  ""̀" Ѐ Ȁ2"""> ̀" Ԁ2 ""3 2"`̀"` Ѐ "`Ȁ2  ""`"І  ""Ȁ" Ѐ Ȁ2""" "`Ѐ"Ԁ" ݘ  2l`Ԁ2 "``Ȁ"` `Ѐ `Ȁ@2""" "``ȀԀ ̀nԀ"k ԀԀ2`Ԁ2" ̀  Ѐ "Ȁ2"""" `` "`̀2 `Ȁ"` `Ѐ `Ȁ@2"""m Ȁ "``̀"` `Ѐ `Ȁ@2""" "``ȀԀ̀" Ԁ Ԕ A"Ԁ2`̀2" Ȁ  Ѐ "Ȁ2"""" `` "`Ȁ2 `̀"` `Ѐ `Ȁ@2""" "` "Ԁ2`Ȁ2"ԁ㿘`Ȁ2`@`̀ =Ȁ "̖ Ȁ 2Ѐ"Ѐ "& Ȁ 2# # Ѐ" `"`"`"`"`Ѐ`"&`Ȁ2"`"``" `̀ 2" Ѐ   Ѐ 2 ``Ѐ`"Ѐ "& Ȁ2# # Ȁ` 㿘@   @x   &`&`&`̀ &`Ȁ`6$ $ $@  㿘  @V   ̰   ̀"  А Ȁ  Ȁ2 0 Ȁ  Ѐ" ̀" Ё `́㿐> > !Hc(#\   @ > >  d  c8  @#\> ۘ P *P> ے + (XX> ("H @ 㿐|@ u ; @  "6  @  0 , @y 2%  H /` * ! @t`"  H 0 `" > @ #H&  p> #> ' x'А@ (  @  " `@    > ې"t @  2' [ ب    { @ߐ  t  @T @O   /뀦 2   /ꀢ@ //뀦   @ 2H @ @ѐ/& 'Ԯ Ŕ  3  @Ԁ   H /` * ! А@Ԁ  H 0@Ԁ2&@ ƒ  @@Ԁ @@  > # > @#xp> # ' x@ a  @  " @  } { @'Ԁ@N ؤI   d @  ]  @  2 /ꀢ@"     /뀢 @   *"'Ԫ`     )  `   H /` * ! @Ԁ  H 02& @J > @#X> > '`'H\'P'T`'' 'Ѐ`x @   @ 9 " @    > ې"t @   @`'''ȀW Hآ    @k  /@   2,/ .  ꀢ@%& 'Ȑ /@ʔ  /@8 2 @! @c/& '̐ / " `T  z `@`Ԕ@V 'P`#А@P"@a .H* @ؤ @o/'  " K   @M̀`&` H /`4'Đ* !'@@#@?  TH 0ā T@T 2"`'@`2"@P@ А"@@   @@ɐ̀H@6@  > # > @#x> # ' _0@  2T @ - "O @ I G A آ  < @p  耢 逢``* @۔ @Ò " /   /뀦  " l  æ`Ų`2& c > @#㿈@ D 6 @ Ɛ "1  @ 2 + @&$ @  '' 3>' ܒa@ a @  `>   &@ ΐ# 㿀>  ~@  Y @  "T  @ 2 N @ H&@˺  ''  'H /` * !  3>a@a a @[ `  @ۖ @ ` H 0  `>   &@ h# p> # ' x@ m @  "h  @ 2'b 7 ئ   N @[  G @Д     //m   0  & 'Ԭ`@Ф   H /` * ! Ԓ @  H 02& @c > @T   ?0/  *? %` `0J 8? `88 J(J  ?  ?㿈&@@ʳ   ' ܀  '>a@e > @ (  >a@Y > @ X&㿈@ʉ  #>'a@B > @m  a@9 > @d P> #'@j `2 @@ //' ܐ ` `/` /'''' ``   ``'`4$ @H /* ! @H 0 #  @  2    `0`  > @a ؁㿘> ۢ d@9    @ ``  , 0, 1@ $ 4 , 0, 1@$ 8`$ <`$ @` $ D `, `, `, 㿘 @ 㿘> ې d@㿘@ #> ` ` @ "&`@` & 㿘@   @ې ` "@& 㿘@`@ɐ``㿘 $H /`* !  `?.  P@q  p@n H 0&  x> # ',* ؐ   /  " > @! 㿘@8 `   "?*@ & ..  . .   "@?* & *`?`"`  *` "**`" p> #'@ 0` 2  ܑH /` * ! `` `   4 В @~`0H 0` ? > @,!8p> #`' 2  ܑH /` * ! `` `   4 В g`0@5H 0` > @!P? > @!x㿘@ȁ ``. ` . `. `4 &`8&`<& `@& `D& > @ c耢'g>  l* €`.  2] `& `"``S&``?`M&`ؒ`x  C ` >&``?`8&`xH /`* !  P  p H 0 `'H `  ` `&` 2  `??&`&`   > @S!㿐< H @4 > @ '"\? @B   @` $ $ '`"" ` H /` * ! @Z  `H 0`2&@ 㾐> #> ' | ''  H  @  8 > ے`'8" 2G`@@  "   @  "Q` ؀ $`'O E@W @T " "7$`耤   @ ".$` ؀  '8@f  K "`'$`耊 2` " `@@ʒ "` ؀ `@8 ? $`$`'`@ H H /` * ! @@  H 0@Q 2& @I # > @B!㾐> # '|[ '4 -> ۑ, *  H 4@   `@   ?@T " ؀ `@ ?$`$`' ӑ, H /` 0  * ! @2  H 02&  > @Ր!㿘?8 @ 1 @> &* "ْ?@ ` `H H 2 ⼠ `> & !@& 㿐>  >w @w p @&i  'H /` * ! > ۨ"?0@r '`$H /` * ! `Ȑ' Ȁ )2 H 0$ '7" ѐ@Ɛ `H 0` > & H 0 !@ 㾐> #> ' lF '􀤀 '> ېӔ H  @ǒ ݐ⼒ "`'`@ H"H /`   * ! @f  H 02&  > @뾐" 㾐> # \' |[ 2r 2o 2l '@@ , * q H A@e >> ې"z & `@`"@* $`  @Ò " ؀ $`'`@  2`Ƒ,  ! H /` 0   * ! @  H 0 2'`2'@ > # > @7"0㿐} > 䵒  > 6 '"@?  @ @#   @ ?$ $ '⼠ 2 @@K` ` $`&@ $`2& x> # \' m  " @    4 " `Ā " `@" @ !> ې & @'ܐ" 2+`@ @   $`'N  @M  @ؔ " " $`@j  "`'$`耊 "  @\  @ ` -'غ T  M , H   2 2:  >& 'ئز` `䀢 "`@@^ `@ܒ`@q$`@ ?$ $  $`M@L @<  ؀2& 2'  @< @,  > @#"@㿘>   | a q  "[ `Ā "W `@> Q ""? ` `@ @  &``@  b 2`@'  H /` * !  @`؀`  H 0$`Ā2&2& `> # '`?  @ 2_ @@G Y @ EԔ  ''''ĐԀ     "$ @"'Ȓ *$ '$ '̠2 Ж U J]АȒy . @ `& $` `& $` `& $`@  @`@ `<   @Q  ?@& # > @8"P㿘N "?N ?  ?@˺`4  @J ``$J  @? 㿘`@>  `N   f  ? N  > I ?  Ё㿘@2 @Ӕ  "N     `@Ȕ @  㿘 @ ؀ 㿘> ے"> ``   "``Đ  "  @@` 㿘   @ ؀ 2 㿐`"`"`<`> ے" 耢` `Đ? "`  @ ߐ@ > ``?"```   g s`2 & @ 䀢 "& @@ & & @㿘  @ ؀ 㿐  A l H /` * !  H@ 0 x@ 0  > > H 0& 㿘> ۠!H@ ) @ɒ  Y H᪒  & `` "`  "  @  @ @ 2& @  㿘  @ 2 ؁㿐`  ֖  ܀ " @b  " @\  䀢 "  쀢`> `?"` ``` ?"`  > ې!H@[㿘 ` @ʟ  @ʙ  ` @ʓ 㿘> ے"㿘 @   耢 2 @ 3   `@> ې P"   > ېb`   > ې"X@  ` 2  ` ``?"  `B > `B >  㿘 @\   耢 2 @ U   @> ې P"   > ېb` x >  "X@  2  "  ` `@`> @"h /`*,`@  H `B ; x @B :`/`@  P `B ; p @B:H>  #'@ H@ ` ` @ @ : 2) >    `' @s @p $ 2&    ϒ  &    &  @ ` > @櫐"㿘 `> @/"0 &  @ p> #`'? >  T> ۤ"` @  ` 耢 2 @ `x?2@6 ` @s > d  `",ǒ``8`4&> "0> ې"4 '  Fq `k `  `` ` [&@- +> )> ۀ`2  @`P@"X  Ѐ`Ԕ> ۖH6` B ݀`  > @"Ё㿈@  '耦'"   >a@DH>  ?# @ 'b2  2 *  `#\ \  @ # > @帐"H`  2  ?@2    ? ?耋@ 7/?? 7` `2 `(쀠x7` t?# ` / 2*@ Y*$ 4 `"``   `&  //2*@ * 2`/2*@ * &`2*@ * ` @* @'(`(`(`Ѐ  72*@ * `?   > # `C @Ƭ'@2`  @#\;`#h> #@> #H#l$2 > ("> > #P#H#X#p` #ta"> > #P#H> #X#x> #|"@c> ې"@z (  㿘` G 6`> # `> #`@H89`?6` # cc(> 1> 3`3` c # c2@2  28 Ԁ`( L #@, 28 Ԁ`> #@ 㿐> > "Ěc#\ l  @L > > #c#\   @B > ""㿘'>  )>  $"#> $b@ 2@# @> #   p  ~? x? z? |7 7 7 ///?i7  ,  L 2>   >  >  #P> #H ( 0> #X2 #\ #` "> > #P#H> #X#d#h#l#p #t> #@> #H#x$2 > ("> > #P#H#X#|` #a"> > #P#H> #X# > ###ؒ@O'> ې@"آ -%> @ !>   @2  @ 2 , ,@ 2  L L@ "D  2 > ې"@t /7 @l "  <`<`<@<` p> <` x"4` z 4` |4` ~4` ,` ,` $@@O,` @ @ l, +, K, k@$$@ 㿘 "  `@2  ` @2  `@2  ` " @4   ` @ 2  (  ` @`" @`*  2 (!$ ` @`"s @`*  2m !   ` @`"a @` 2[  \ ( ` "R `@ĸ*   `@*  2  F@ħ%*  2: %@*  2  21 03 ``)`(`@Đ  `@  !@Ă%ܑ*  2 ܒ%  `" @u`*  2 0 `@  2P   "" `  2  ` 2  `2  `2   `  2   2""` "`"㿘  @l > b`% @"` `4 |` 4 x` l4 ~` 4 z `, `$ p, 0 ``2@ p> " F? ? ? ? 7   7Ȓ`(7耊 * 7 "ؔ >  L#\L ,  8,@ 0> L  `@z,0  2 㿘!> ܐ @~!`   ,!Ȥ 1> />"->"+>")> *   @#4Ȕb$  0$`$`$`,`<$`,`>$@@$`@@ u@ 0`!`a`㿘H /f * '    ` & ` & & "` ?& H 0 `@B( 0ہ㿘@B" ` "`T @" 88 @"  8 @ @2   8"@2 82 8 `\> `  ' ``2 $F? -b / / / /''''a?''`a''@ʒ  ``'` '`''ܐ /  > ` 4 `@ *`4 >   0''̀'Ȑ @ c > @ 㿘#> ܠa $!>  `$!x$!|@ > *c4>#>#$a"|bh>#}x  $ $ $ H, <$ , >($ @>%a@~!`@@ , @ 㿘H /f * '    ` & ` & & "` ?& H 0 `@A@ 0ہ㿘@A: 㿘 a@ a @a@"  8: a@ !@22  8 " ? @*6 8(6 8 (# (&H /f * '  @ :@~@ H 0  㿘 @u* @*`"@*`"@*``& @&!㿘H /f * ' >  @ H 0 " 6 H /f * ' > b` 2`H 0  $ & 6 && & & 2@X  B$X`(0 H /f * ' > !@˒ & $H 0 $ (  & 6 & 0& (& ,& <& 8  2  @@$X `$X& & &  ** * * >  $|`@n$x㿘> ܒ !쀢``l H /f4!x* '!x   d 2  H 0v   `"!|@N 2  H 0` !|  $!| `@,` `  `( ( `<& <`@& @`D& D`H6 H`J. J`T& T`X& X`\& \``6 ``b. b`x x > ``"@& ` 8" & & `& `& `& `& ?& l`. `. `. `. `. `!@@JH 0 㿘> !!xH /f* ' ϒ  H 0  @ H p@㿘H o*@ g@  H 0㿘!x@ʐ!` ,&!x &!|@@?s 㿘@   ``"` " " " " $" (" ,\" 0`" 4    "  "  " " " " $" (" ," 0" 4 㿘   > 2< H /f     ! * '   2 ,@? ` ` && "` ?& `  0`& & H 0 㿘  6H /f     ! * '   2 ,@>Ґ ` ` && "` ?& `  ?& H 0 㿘>  @> @ Н㿘``8 ( "?`  4;`  8+ @    d 4 2   (  @9   B<    4  2 <   @(<  < <   4 `,   8`0& `(€`@ `  $@$`& `?$`  `2 $ (   @ c < $ (㿘#> `؀ 2 @@`؀ 2@> @  X  2  0 8 2& 8O 5 @D E @ 0@2 `ؐ   @E <`   <  ?  ? @3< ?<   @K< < $ ( 8 & 8@ϒ  #> `  >   `>'`@ @ $` 㿘 H /f4> * '> !`   Ԁ "   ` `" @  2 ԑH 0`>   `>'`@گ @ڱ 0> " 㿘 8 > &`&@ ؒ 2`* @ *`@=&@ &` 㿐 `       0 @ @@ <@ > #t`        !  `` ''H /f * '  H 0㿘@g  (   "$    H /f4 * '    H 0㿘N $ !> @D0" ؀ 2  @3 ؀ 2 > @)!   0  0 @E0@30@ Ӑ㿘N $ " @20   0  0 @F0@40@ ڐ㿘 `` `   @F@(@ 㿘 `` `   @@2@ 㿘     @˞@'@ `! ` 2; `     * :  "`!  `<@  `` @ `*  `(( `2 2 2 `b``[ `     * : `B"`$``<@8 ` 0?` 8 (  ::8 2` *`` *  (( 2  *(000****㿈>  > А> "p@="> "`܁㿐> #p`> @!0@-> #" : 0(@(b2*@ *@ b 2`* @ *`B*2*;@ C0((㿘 x @ ^ @q x $ 0 $ ("$ $ `2$ >  $ 2$ >  $ 2$ >  $ `$ # $$ 2 @"@ 1!+ @4  $    <>    * $ > !@@$     *  * *`" $ 7$ *  @V$ $$ 8@۠㿘@ 8@   (:"@ H:` P:` X:` `:`  h"`( l"`, p"`0㿐 0 # (@{& 0 <"@<* "@ *`"  @*  " * @ ?`$ `@o 8< `  * <  ,"  & ( )& ,` $&& 4 & 4   $  & 4& , $@U: `  @\ "   p& , & p & 4````@6 ``@`"`&"``&@ &```2 h l & l & h X`B > X ` ; @ B > `& ,@:o? H`B > H P @ ; B > P 㿘t&@`$ @|@ 㿘 @DQ ` "_   2X    @ * @@: F$ 0A><@  9 `5 ?# ` * @ *  ; @;  8 3` +`!  @ `* `*`@ *  ` 2`  @222+`+@+`+` 㿘@`  ` "&@"`` ?&`" 2 "00   "0@R< 㿘>  쀤   "  2   @ה  > @!p $$ @ ` $$ $ ?$`@K* $    ?: &  2`,$ `` 㿘 ? & > `쀢2 "`@ 2@"@@M  㿘`@ `1`  @,`r: .@``, 㿘`@$" &$ `&$.` "  "$ `$*`  㿘    `" `@ ̐$ $Ȁ`" $`@ 2$&$$̀` `@ &$̀פ  㿘` @ 㿘`> `> `> `> `& (`& ,`& 0`& 4` & `& 8`(& <`,& @`0& D@ & H`& L`& P@ & T`$& X@` & \@` `\ `㿐@ "&     H /f * '  >->->+d"`cl#\#`= H p@㿘@ѐ 2`  %  @ "  @%%@| & `$$$ 㿘  2&  B$Ȁ`"$$̀`@=  㿀 `"  L  T D `   @@@> ! `> !@&o  < @@"4`" |a @" d\ 2Z d̀ 2V ?& | 2P ?& | ے`2E *``@" |=  |?2 L >- #\  #` d#d#h  N@dd>3 NL#\  #` #d #h #l d@#p2 |  "" |"$d *``"  㿘  "  | " `@  @'$ |?" $$ ?"$$ |`*` "  㾐/   \ | " !  |'! !& 㿘`   > `@b!@7q0 7 @Ar " $ * 2 `$Ȁ 2& `@7\ 7`@ 2   `$  $ `C <`B> >  7㿘 $@ϐ  ` $ @& 㿘      `   8$@㿘  , @  @ , $  2& 㿘 p 2  ؒ @ @ ؐ`@   @  $@@  @ܒ \ $`L沒$`P$`$`"$`@@[$`<@$`$` $`8$`"@d"` @"$`d & :  $`,$`,`В2  $`($`(`(h$`$ƒ2  $`0$`0 )$`T    2l@$#而 @ @?@`*"  d@7*   $`\@" H /f * ' . ` @ $`H H H H 2 H& H"@$`H`P `@'`<$`D'`@@`  ``` "`@ @S"H 0㿘  H /f * ' 沒@"& & 8& "`=2  & ,& ,52  & ( & ( (& $*2  & 0 & 0     *  "@ @ # H 0 㿘   ,  `  %@ @%@     $ @_ $  H 2 ړ, `*`    P"       @2 "  4D2 `"  P 2 @㿘`4 @Ր`H /f * ' @T`P @ `D  "@`P "`<2  @ `D`P"`@"D&`D `D`@`* `" `H@ `H`H`H2`H"`H`*  @2 `H# #   `*` ` "@ # `*@ 9#@ `PH 0`\ @ ` @@ @ 㿀h@! 4  @4  `&` &`&`&`&`&` &`@#* &`&%b  & : &` &``ؠ`܆`Ԅ`````@`   "" " " "  &`&`  " " "  \>4#``d#d#h(#\#l#p  &`> @뤐"0" 㿐`   @1`? 쀣 + l  p   4  L 4$  L  "  쀣6l& $ p 6L 4L$ @ `, @@  "@   @  @/?㿘  ,`"@ 2 H  , & 㿘 "- @l &( `p@6    2@4   8     ے "  D  㿘 ``ԑ* "@ PK 4  l@ &D ` p@ $= @I & l7& 4. @!  `쀢@ "# |$,@" # |` #  T€  l  & L` p@ $ L ``* "@ 㿐@D       l  "c&   ԑ* &  "@ @   6  `8  `4 @$  `"$  l m  ` 8`6  * %2$  L 2$  HՀ`2Ϣ Ǧ`"     쀢 6  &  `& 쀥`R   *  L% L & 쀦B@ 2> @}"8 `2 , @@ ?"@  `$ `"@$  @2    H* " * "@  ؑ* "  `*`"  * " "   @I & `&@͐& 㿐@~    K&   ԑ* &  "@ @     `" H l 2 -`2 H L 2 H2ߨ?`"     쀢 6  &  `& 쀥`>   *  L&@ L & 쀦.@P 2> @ې"P` , @@?"@ H "@  ؑ* "  *`"  * " "   @ & `&@?& 㿘 @&   g㿘  ؑ* @`  `` <B`C <`<` ,  ,   R< <  <     = 4;    "@2 А"@@А"@@ @ 6И"?@ . ?/!  @ @$& И"?@ &   ?/!  `& & Ж"?@& @   ?/!  @ @& & `sд"@? `x `t " 2  $``($`$`ؐ<< `$@<@ ; $$ $`$`,6+ $`$+ # : @@ $`l?/!?@@ $`l`$`p $``( @4`4$`$ $`l@֐`$`4`@" `̐ $` $`t `P$`x  $`h`` <B`C <`<``P`2  *   쀢  @ `l  p  6 & 쀢 4&   * ' *`%   @ & &㿘 @ΐ ` @ * "㿘   `@@1 `2`  "$"`  ?$ "` *`@ ?$@ 㿘 И &  p  l |@ " ``2 А"@@А"@@ 4 7 " 0 0 h> "  pВ@ "?@  @ ?/! l @ @& l& p   ԑ* `@& 4& @m l   >4`@Đ@ƒ㿘 H /f4 4* ' 4  & l& 4@Ѐ`@H 0㿘> @͐"h㿘` 2 d ` \  `Y `"`&`"` & &  㿘`2`  "&"`  ?& "`@0Q 㿘` 2@c \2  ""@"` ?"`" 㿐@i "&     H /f * '  >7>7>5Ԙ"bL#\#` H p@㿘@= 2`  !$  @ @!$@ $! & `$  @  㿘  "  & @y @ @! @ ` ` T |   D@  "/  | >( @ ؐ 2#  | $#\#` ' ' ' ' ' ' ' ' N'@o؀   㿘  "  @  |  @    @  |  !`@ ! !& 㿘 @ "  ` @v    ` 㿘` @ 㿘  "   `@@ 2    2& 㿘\`! @? >@!  @6  & @ @ &!`" 2  "  "`  " m& ` ` 888  4" @ 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @    @S `*"  d@K*   &   "` `!@  `  0@ y& @2     @      @     0@ X& @ !(   @ "   " 0@k >& @ !h   @o &&  $& & H /f * '  $*` " $ 2  $`2`' ` 2`"`H 0 0.! " @ "    `2   " @Ғ  " @̒  " @ƒ   "@ @  㿘 "d   ^ H /f * '   `" @ " @2`  " "` 2`  ?* `"@ ?"H 0@Y! "    `2 z  " @g  " @a  " @[  @X @U   2    " 㿘`   > `@G"0 @7Z " `  @t "`   " `` 2$ $@-@$ 7`@  !!`C <`B @" "`?$`К` C :`B<<А@Ж"0@B<0`  @   `@0@0@㿘  2  $   & @,y?  $S  `"`&`"` & &  㿘 ` 2@v 2  ""@"` ?"`"  㿘  `4 `B >!`! ; @ B >!@,+  ?" `?" `2`  """` ?""`2!ؐ  @+ @㿘 @ @n! &!㿘 @㿘;   @ 0 >   >  > >!  >!  >! >! >! @8 4 $ 8 4  >!>! 4 @ 0 0>`@ C > @  @ > 8@㿘 4 @ 0 0>`@ C > @  @ > 8@Ґ㿘 0@ >`C  @ѐ > 8㿘      ` !```?&!`"{ X ! `"   p t@ H p@B* 2` 2 !!@2 > H H8 > H!( L@ > H!(  !(@B:2 > H:` : p  H > B   (@Y!(2 !!,2 !!( @ b >!(> !    &!> xa&!a &!@> P !ha   (@) (@C ,> X> ` X h@8  X2 h \ l@( h X P2  T"  @> P   b`㿘    `?  ( >` B > (!   ?`?&! " ,  H 8  H  L  H:@@j b !(@ (  x@ b @ B  > Hp H@8  t L@   Hp x@ b B> xp> H@ !!h ,@ ( `>  B > X Xf8  X2 X \(  X X f `@ B B > `> X X h@8  X2 h \ l@( h X P2  T"  @ > P   2t (!  : h??PT  8P2Ḁ (PḀ2P: h㿘  @D "" 㿘@ a  ""@ @ 2" DD8a "a "a  a  a   @  2! DD( !!""! "!Ā 2 @! ! ! !!ā `X@`@ @PD`DK  @ 8a2 DD8a #  " "   & `#  `@  2a`DD(a " "a""a "aĀ`2`@    @ ` D `"`8 88 2!`< <(!! 㿘  @h "" 㿘@   "H H 2 LL8"!"!     H  2! LL( !!""! "! 2 Ha"`a a" aa `XH`HS 2`LLK! H 8a2 LL8a"a "!"! ( `%  `H  2a`LL(a"!  "a""a "a`2`H!   P 8 !  T ! 2 P 㿘>  ؒ 2`* @ *`@* 2`  㿘. 6` .`@b2`* @ *`B2*> `ؐ * @p  㿘  (0 (2`*  > ج 2  @Z >@2ؘ?? 3`+ @+` 2*@ * @E >` ؒ  @ϐ  @8# , 4`@@4   >`@ ? c @ @ * 2` @ 2 E>`   + 3` +`* 2` ؙ2    @  >`   ؘ?? 3`+ @+` 2*@ * @ >`(:: @: `: `: `: (` : 0`(: 8㿘 2 (q(  B : 2(@ 6@(,@@ @ YB c   ?,4 ??4 @4 @5  @. * 2`  2 @ D@0B@c@b8   ?,4 ??4 @4   @   @ * 2`  2 @ D @ B @ F 㿘 2Z  @8T    B & @@ !@c, 4`@ 4   @̖ ? c @’ @ * 2`@ 2  @ E @ &B @c@d, 4` 0@4 @ ? c @ @ * 2`@ 2 @  (E  @ B @F㿘@` @``$@p 2> @k> h> _@]` F  r  `@ G 8@2>@  @>> `> `B> (d4, @,`   @b     B 2 ,( , @ @b D,4@4  @$ ? c @ * 2` @ 2 D> (>> > 㿘@&`& ` "& & `& ` & & & ` "& & `& ` & & & ` "& & `& $` & (& $& (`(> 0`0> 8`8> @`@> H`H> P`P> X`> `a& a& a& `> h`> p`X> x`h> `p> ``> `xP> > > & ` & ` & a> a> a> a> a& `` & `` ` Ғ `?(  㿐@  "&     H /f * '  >@>A>? ؚc#\#`L H p@㿘@ 2`   T  @ "  @ T & `?$ $ $  㿘  "  & @Z@Y  㿘  "  L 8  |`a @ 2   | L  N@q T 2 㿘  "  @ |  @#㾸ђ  @p |   @Gf  & 㿘   , @ " @  ,  㿘` @ 㿘  4  , @"   `" @   ,    2& 㿘.`` # @H /f * '   `@H 0  `.` .` @ @ @  @ה w& @ .`` "@$`" 2  "` "  "`& & ` @4$` &n&   `4"` @ 4`, ,`@b2`* *`b2*@*@C3`+ @+`b2*@ *@ b 2`* @ *`B2* @ 3*  @  /  @ `*"  d@*  Ȓ &   "`  `"   2    "@  @   㿘H /f * '   `" @   * "  @ *` * @"# ?# H 0    `Ґ  @’ @  㿘`  `` > `@"@#А- 7 @-є "   @ 2 `  2& @# 7`@U 2 0`   $` 8`C < B> 8> 0 7㿘` `7 @|3 / * "&  ` `@L `?$` ` 2   $  `B <   ( @ ; B < (ד* 㿘  2    _ & @#O?  )  `"`&`"` & &  㿘 ` 2@L 2  ""@"` ?"`"  㿘  `$ `B > 0` 8 @ ; B > 8@#  `2`  """` ?""`2 0㿘@&` & ` & `& ` > `(> `0> `8> (` & 0` ``’ 8`2  &  ( " ( 㿐@8.`? ?*@   .   ` 2 㿐  + >@8㿘@`` > " @ > d  "#<> #(@C5 @ > d   ?  "@> #`@2$ @#> @c@#  *  @ߖ ?> &#@ 㿘``: `" ` `"   2   @! _  * 㿘 < `24 `"0 ", "'  @ "&@`2 `  2 "  2 `"  *  2&& @ " "`"㿘 ? ? A ->    "?`"   " J g2  @耢 2 ??   d D ': `    2    ': T  * `` && 㿘`D ?` $28  4 :/# 2+#@6(#1> ` #  H:2H:"(: # @&# *  㿘  ?`"8   "3  2. > d c8*`  ?`>B!@*` € @*8 * *8 + *8 -*8 /*8*8"   8 _@ *㿘> a ">  "aa> ߐ"h>  "a@ׅ  > "  㿘@8 > @t 0 > > @k (0 a""" """"a㿘> !@ @֒ "  2  $@ > @H @0Ő㿘> ! " @ "  2  2 㿘@㿘> a  > !  #$t@     $   `   $㿘> a  > ! "$a@      $a㿘P    & & & &M& & $t e 0> @ѐ ( 㿘  Y G㿘!> ! > > @ּ P0!@ֹ h! >  %>#> @C "> >    @֥  @@֟`  㿘@+6㿘" @!㿘  > 2P@"  P`   > 2P㿘@  @ @ "  JK2 ` 2"  `@2@㿘  !> @8 @    2> #'@   > "p'l'p'tu/x    @' #> W `t#> %> !> b8t  t DB ؀`@ m e`t `Et@ a@ [ > & > b8@Fx0@ L /x@Ґp p> > "bh"t > "t 'p@ =@l t>  @ո@ :2#@ ' ?'lt `tAt "& pxlt a> ! `> "l> "p>  "btO@ #> "t> "bp# > @!㿘N> f`?@ߔā㿘> @l!㿘N> f`?@ā㿘N> f`?@Hā㿘@㿘>@ā㿘`>  >@Xā㿘>@ "ā>  㿘> "㿈> b|> bt'> > > "bp#"l"x#b|> bx )> '> %> #> !> @ Z "$$@ "$$@ @O`dג"> "x`> ""|㿘 @@w> b|P@Ā  > )"@]Ā (@ސȀ   > @Ԑ  `@H ` @@@A  >  "> #@Ծ@@pR`  ȑ,``` "@#\#`#d#h؟Āܒ> @Ԡ#㿘@(㿘@)㿘@)㿘@( 㿘@}(㿘@y 㿘>@3"ā㿘`> #0> c`@      ` "`> t#h > o#x`2 ` * @ *  `0@9@   2 `",`0 @ * @*`   @  > #@ג 2  @ > #@ʒ 2`0  @@ `0̰ ( `> `> # @@`@*@@ ޖ?&`> #Ȓ @   > #> #@ 㿘   2 *  *   0@ )>   2  * @*` `#@l 2 0 `@ ( 㿘    @   *   9 "2  @ -"@ '  02  0  2  "  02   0"   * 2""㿘 r 2@&@&`&  㿘 [  1/ '> d#H*  ``" *`  +*H` `  / *H*H*H &*H*HH@  @ *&&&&&&&&&&&&&&&&&&&&&&&&$$& %p&&&$&&&$&&%&$$&X&%&&%&%<'d((''(((((((((((((((((((('(((('(((('(((('(('㿘J@ !> @* "  @㿘 > ߢL@  `@  > @ > @Ҝ > "bl`1`>H"*` €        >  (@Ҁ`  >  8@st`ߔ  >  @@fg`Ҕ  >  H@YZ`Ŕ  >  P@LM`  >  X@?@`  >  `@23`   ^ > @$ h%`> @ p ` ` ^8> > @ h@ p ~  0   @1`@F "L@@DL@M6C> ""p㿘N > *! !?* : `8*`>H#L €>@ M -> >  x>  >  @Ȓ  > >  >  @Ѿ > >  @ѷ >   ^8> > @ѭ h> @ѩ p> @Ѧ 㿘> @ > @ћ @1R  @(*` 㿈@ # @ !> > = > `@"8 >  `@"8 >   "8@ `Ѐ >  @@` >  @X >  @Q ?'@  @F쀢  > !@B@Ğ0@?'@㿘!> ߀   ?> ""l 2$"p㿘@  > "8@h < > 3! > #0 > "t >  "l > "p > "h $ @ @ @ > !(@X > !( @K 㿘@I   2> ͐!(  $ 2> !( % $ @#㿐Ӑ / 0=  > !(   > !8  @X'@ '@J?߳'@? π ̀ @ݐ $@㿐 % @? !>   T!(  " @'? @ $@㿐Ґ , @?  #> !> Đ 'a(  !!H * 2 @'? @~ $㿘̐22898322l98398739875984987L984 49838989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898989898983㿘 N@ݤ  b$ "@$b$> b( b$*`: @݁.@"(`"@*@ې b$ "(֒"@ "("$"(㿘!> %> ( "$#> Ӑ""$ b,ΐ"b,$($"$㿘`~>K"Г*` €1> > ","$@ ( @G "$?&"$1> > "$b(:ܰ @:J"$ &"$> > "$, ͪ @+ "$b,? &"$ð > > $"(  "$@J@"$"(  &"$ > > "$,  J   o $b,@ J  0> > b$, \  > > b$( 0> "$> b(|" I y k 0u> ",1> "$` m J *"$@*@Ɛ "$@J"$@J^ >  > ߒ"@  " #> a $! > !'> @%> +> )> 1> ߚa  ? $! $! ! J`a *! @a"` @$! $! b,$$v%"("` @$! `$! b,! %"(J`e `b(*@`#b(J  S"(> > ! !@  J@ > !> ߒb  `   " #! ! "! J  ! > > ߰"@  $!  $! +> ! )> b,%> %"(J`  b(*@`#b(J  "($$b,"(d"@ > !`^ 1> > ","(@( U"@> "( $["  > > !  +> 〢 )> 4'> b,"(@  K`"KK@@2K> !> ߒb"(   " `@" KK"KK@" K b,"(@ "(`$! +@%"(Y b,"(  #> ߚ"> ! *  #!$(!* $ "($! * 0%"(> > "( @ۇ % ^ > $   *$ 8 $*"(`$$@l%"($"("@"( $ƒ"  㿘@IJ> > > >   "" "b$"(",@C @ "(*"(b,"@㿘@  0 @    ?A@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@l@@d@@@t@|@L@ @@@@T@@@@@@@@@@@@@@\@ĝ㿘!> " x " > > """0 > > > Ⰱ""0>  >  > 0Ⰰ@?J@`"0>  >  㿘> a "a@ 㿘> > "!"a㿘0? ?߀ ] ?Ѐ ` 0 > !8 O o T  t X   x>  !8> "#0 0w$0 /  9 7 0 ?Ѐ ? ?  ?Ѐ ` @?4ޢ?0?Ѐ  ? ?  _> !hx ?  ?  _ \C > 〦 \ "8S ?2,> !,> " %> #> B? ?  ?Ѐ  _ \ :2, \2 ,, ?2,ː, Đa0,H `??*`>N" €> <   .4 0 . , * ( & $ "       <   >  > @u!?㿘> > ( a @ > !,@3@ڝ  @@$@ف @z ` @>  $(㿘> Ja a#>  %> L@e L @R c"$a$ q a$ ?a$?$a$$a$ $a$LЀ  L@D L  㿘> !0` > !$ ??߀ ] !> @$> ! > 4`"! @ a @ > a$$!( "a$$a a ($!( @ > $>  > "$" "a(0 !> #> !,a @!, $a  > a  "a @ >  㿘> !4>  "@ > @ʫ!㿘> !8   > "> " >  "> "> " > "( 6" @㿘!> d#P  > @ʆ"00> $#P@ʁ"X> > !x@)#> @v"$#P㿈> W> V c 1#> @9 @Ob@ @ 쀢> " > 􀢀  > @8"`"> > @1"> @." Ւ> \`h`㿘@  " @ ? "  " &@8  >  `& & > &@#D   &"D$ D> c<? "c<> #H`> @"G> @" D   "D J  㿘> #D     #D 7 > c@ #c@#D `   $#D@> D  D   Jp"  > > > > > > > <"#H x#cD"@"L##8㿘N> p`? 3> 5> 7> 9> > ߄ #D&cH x&@&L'#8㿘N p`?3>  ;> > 5> 7> 9> > &cD H x'c4&@&L'#8Jc>    D> > > > ߄  x"#@"cL"8㿘>  P> \a> "> "@T0> ""`'> $@$T@    2> $T@;#(㿘> !< @   ``+``2`` > <+`` #`"`""@ #P@?㿘> !<  , @ " @ 2  > #x@0 > !<,  "  "  # " 㿐@7 > d#X@* *`` :*  **`'􀢠#X㿘@\ 2N    @P`?㿘@ 'D @D  㿘N  %> ! #L 〢 :@6 > !<,`@%>   @W `$P`@  㿘@L`@fL  2L@ 2L` F> > #Ȓ@80#@4㿐N  %> ! #L@ 〢 :'', > !<$ @)> '>S`" `@#ؐh@3`? 㿐> " `  @; > !<    @Ð  ` `  㿐> ?>  !< '"cP   @@:` %#P`` &㿐 !> &@#P@ #P&@&8> "> c ' 8ה-> "@ ) @ &> #ƀ   @   > ƀ#`c@  >  ƀc @   > ƀ#c > @ 㿘> cP@L㿘> cP@U㿘> #T   㿘> #T €㿘> #T   㿘> #T  㿘> #T` `@㿘> #T   㿘> #T㿐 ' > \ '> \ h 4> #@` > @Ɯ > L> > 8@ƕ 8 > > @Ǝ P h@Ɗ p h`> "t> !` "> > @x > @u > @r F h 㿘 *> > > "b  #> @b8  *> W> V c #> @b8 &   *> B!X 㿐̐ @  㿐'D @D  㿘  &@ 㿘  @"@ 㿐v > !X > !Xh ` > !pZ > !͒㿘> b쀦 ">  "bb> !>  "b@Đ! > "  㿘 > > @ŵ!0," @, "   2  >  2  > @ŕ!0 @Œ!0 @$ $$ $ > $""㿘> " " "  8   @ $@0   2> @g!؁㿘!> " > > @\!0@Y"" > " %> #>  8b@  @F#  㿘Ґ㿐4  Ðq㿘㿘> b䀢  > " > B#` #> [  8  bh @  2 $>  㿘> " $ > B#`t "   @: 8 8    @* 2` > ""$ 㿐N h  l  b>  "H> "H   ﺶ?'> %> ߐ> > @ġ"X-   2&> "h&$l$$p]]]H]0]`]^H㿐`h ?`b>W *` €> S!8> M!4> G!,> A!0!> #"'@  ; 8 "> "Ԁ`- $"* !> #"'@    "> "Ԁ` $"  > !@ -㿘>  T`@ J"`"> " А  *`: ?Ѐ4 L@: @ L 2  8LN  -L@  ? L` `> @ǐ"Ȱ a?N`_2 @  z$?> @ø"Ё`> N#耢s'2 NЀ />  /> <  `Z  ???'Ġ  #> < , `2  "< t* a<)>W'Ȓ"Ȑ+ c'Ȑ"̀ J@ :`$J@    8 $J 2  `> a "aДG@`?  ? ? .J *L@    *`:  " `:  2`J 2 ` +*Đ" 'Đ _*Ā c`'> !> %%> #L@   +   8 *`: ?: ?+J 2 ې!ؔ@$!. c > @L"  @*@`  `*``  @*@`  @ `*`*@`  @ `*`*@`  ` @*@*``㿘㿘ܔ@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*@@ * @*@*`  `(`  @(`@ * @*`*`*@*`@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*`*@@ * @*@*`*`*`@ * @*`*`*@*`@ * @*@*`*`*`㿘㿘Дt|$$HH$0000HHPPPPPP`?X> > c '@Q#X?>  ;>  7>  3>  /> $ 2(` '> ( 2,d > , > 0 > 8 > @ > D  > H > \ `> @#`&`4&`8&`4&`0 @@ > &`4@#x#`h @@  @> &`4@##> 88&` &`  &` ?&` ?&a &a8&a &a  &a &a &a .`@&a@ @z@x@ǐ&a0&a8.a<&a@&at&a|.a&a&a'؀  > c@<Ā "؀  > c@1Ā " 'H€ > > "c'-> +> )> #!>  a0#\@cА#\at#@#܀ > c@Ā &a 'H€ # > @ѐ#``""!  - 㿘 &!@S d@Q `H /d * % !? &!>  > *`" *! @O >  @) H 0@D @A h> U p @ 6 > O">\c܀  " `@ , 2` @J{   @Jv   @Jq   @Jk  `> #'' @q  ' 4 H€ 0 İ?c > @A 0㿘\@N &`@F ~ ?  &@@ 6 ( @**@``$, @@* 2(`@ * %`*`$ ``4*" &``  &`(`@ *@`2( =.` ; &@@ 5( @**@``$, @@ 2(`@ * %`*`$ d``4*" &``  &`(`@ *@`2(㿈  >\'''@Ė > @( @ 㿘` ">   ">  > "> >  #P X `@^ h> @  㿘 0 4" T &@ L` @ &`   @{ &` `   㿘 4 P  0` 0` @|’ 㿘> ch ?  2` ch* @ "0 ! " 4*  2!%  ` `$!`  ``2  @@ג!? $!@!㿘     0    0 @@ 㿘> #h ?   2`#h* @ 2!(  "!#  ` `$!`  ``   !@ !? $!@>!㿘> #h ?   2`#h* @ 2!(  "!#  ` `$!`  ``   !@x !? $!@!㿘> h ?  2` h* @ 2!*  "!%  ` `$!`  ``2  @H@7!? $!@Ɛ!㿘> #h ?   2`#h* @ 2!$  "!  ` `$!`  ``@_ !? $!@!㿘> h ?  2`  h* @ "%?! "!? ` `$!` ?`` @x ?!? $!@X!㿘 `$ @~ @}  ? & & a&  . ;@& & & & (& 0. 8. 9. :㿘 4ِ h  =   t x 0" Ő &  "  = "     0"  `` ("`Ȅ8"``""``x"``t`l  "` r `< n `4€`0 f&`X&``&`d.`&`.`.`&a &a(&a, `<  .`< `<` .`<2a> 88&a&a &a &a&a&a8&`&`&` &`&a&aa > ` p> @ &   @~a'a 'a'a'`'`'p`'|`'t'x&`l&`@  "  `4 @`0&a,.`<.`=㿘H /d4 4* % 4 4  !, " 0 =  0€ H 0㿘H /d * %   4&!$`4 0€ H 0㿘M ߀   4 m 2.L`9`` `@n$`" @ `:` H /d * % `$`$`@H 0 ?L`9 > @ ,`9`0 H /d4`0* %`0" >  d+>  `*`" * > #P % d! @ !`% d `0 > H 0㿘>  #h. @ 4H /d * % ` 쀢 " !,  40,@". 0@ 0.  `&  퀢 "`N ܀ 2 4T 2  4``" 4@ 0 4 ,@ 0. `@ 02 <`  < = `. <. = 2 <`2 &!, < = `. <. =&!,& XH 0 㿘> #h . @hL;  , v = s` H /d * % $"@  #> 6`耢`> #P $` !  @7 `$`  )$"@ 倎H 0`*@:$@$$`  0H 0 #H 00H 0 #H 00H 00}` z xH /d * %  (!>  쀢  @  Ҕ `> #P $` !  @ `$`   ݪ ,9H 0 ""@@& `*0@@@ %@ H /d * % $$,9H 0`  㿘H /d4 * % 쀢   `  `@> & ` 4 0@ 0.  퀢  d  d@. & d 4 ,@ 0. H 0㿘  4`!   h> "3@@#/` -``*2 ` ?€ 0$   >Z(  U        ` *@`0`*@`4*@> #p'! Ĕ `  c @8 8@&@`   c > @ 㿘> #h . @L;  `    $ ,  =` `&`@ B >``23`(`. 8 ` <`B#&`>`("$(``2`Ͱ H 0Ű #H 00> @@!,9 `  H /d * % $  !> Ӕ!d> #P $d !  @9 `$d  $  ,9H 0$"@  " @y@y@&`* @5` $@0 : H /d * % $$L:`$ @yx% @ys%  @% "@ ,:,9 퀢  L8 @!`H 0 `  R㿘> #h . @  4@ )!@ " @ "V !@ 0@"  !@ " 8!"!@"!, @"`\  b}@"+ !@"`8!@ "!@ 00!@"b~@ٰ 0!@0"!@ 0΀ "$ X X "$ Xư  H /d * %  " =H 00  퀢  ` @w  =   쀢 `@FH 00&&H /d * %  &   l@d" & t  |$ " &H 00dH /d * %    "@@   :  &   @:" & $ &H 00=<&@Œ7@@2Y -``)@ 0% <&` € 0&`\@ 0  `<  0€ " $!,02 0@ 0&㿘` L @` ` d@ @M&@@Ր X " @  @`` 㿘>  #h. @H /d`* %` `" =02 = "$ @ @  H 02# @L0  Ā@ H 0  @h@H 0 㿘> #h . @ 4\@ 0 "4?X "0? @  *?L ; 2 0 , ;   H /d4 * % 퀢  @4H 0 0X @㿐 4`d !#\`d>f 0!  t x l `(>f 0  t@ l 2 .  㿐N ߀ 2  4  @6 4  ``  #\``>e 0!    `$>e 0 @ 2 .  㿘 <  4  @/   $  $ !@v (L ;@$ ( ` >e $  0@0 "$ L 9 "  x, : @}q$@$!@vאL 8 " 0 4 $ 4 $ 0!(@ &!( 耢 " @    " @   @ ( "@ * &    & &   @@ :  $  $@ +$  耢 ! @ @  #@@@  @  ( `@" * &    `& &   ` 2 = $>e 0 ȟ@ " =P = "!,L 8 2 !,   4!,7 !,  ` - 㿘 < h R 4 @.    $  $  (L ; `$ (`d <>f `(  @ 003 L 8 ` $  4"   @ $ 4 $ &`dL 9 2 `d 0"   @ $ 0$ $ `d  `(>f   0@ Ւ ``   "`2 ``+  "`` 2` "`` 2` "``>ZX(``"`  `   㿘  &`&`.` .`  4 @€ 0 2  :  &`.`  4@ 0 x> #'     &  :  @"ڒ & : @2` `2'g [ ,'`4 '`D`0€ R` H`$`4  @2  ?'ؒ ΀ 03 / `4 '`D`0€ (`  `$`4 "`? 'ؐe "` "` #@# > @!H㿘 &` 4 D€ 0  ` &` &&` 4D 0 ` && h> @ #''Ѐ'`z ''͖ؐؔr` /' 4 '`D 0€ b`  \'ܖ`$`4  @2` ?'ؒЀ HР A 4 '`D 0€ 5`  '܀@ ''" , `$  `4 'ؐvȀ `Ȗ  ''` , ` @tP'@tL'Ѐ  &.*`&@t>*. @t9& @"@. > @!Xx> #'2@` 2@I F ` 'ؐ> 'ܰ  `$`0 2`@ 4'@ 0"` '܀`' `$ @@`'" 4 2 4  @€ 0 c@pc > @!hx> @ c耢' ` 'ؒ  4' D؟€ 0 "` "  ```"@`#` ``@`# > @?!x@> `4 c`8' k ` ` '` '`'a'a'a'a 'a'a'a'a@'' `쀢? `' `8?"` ' ` ?" 'Ĩ  ?"`'`?"'Ȩ ?"`'`?"'̨ ?' I #耥 A #耤  `   ''   `   ''Ԡ `?`2``   ,`= ,`= `=` a,  `,`=]\@`0 2 `=  ?''' '2 `=?'''' `= `0@ #耥  ''' ' ''''$a$a $a$a$a$a$`$`$`$`$a$a``l " `  `? `2`s`Mat c ? `2d>a0 T `?at`А D#?a0{ 3#`3 atj`3 "# 3 a0Y 3 #`p?"`0a `4`s '''/@؟€`0 #`0 ` "' 0,``0 2" 0 `퀢 2 0 `= " 0H /d * % H 0 # 0 ` "'`t,` 0 2"`t `쀢 2`t `= "`tH /d * % eH 0 #`t?`2`t`t   Ւ Ғ  ,`€`0$`$`l,``?" `=   `= "```@`0 r#耥`"C`xH /d * %  )``l" `= `=   `퀢    `=    `쀢 H 0 /#`x? ` 8 ( ` $``|  `?8` $``x?2``|?  ```Đ" 4$`İ # > @!x> # 4`8' 2 u !0&@!&`8 &`!$ &`!$ &` !  $ !t$&`!@`k$!&``H ``3!"&`p 4  '''D؟€ 0 2&`p&`p &` $  ̐" &`(  "@$(! &`,$, .`0 ,0 Ԁ@ .`1 @ ,1,2.`2 <2  .`6 < `,6 .`7 ,7 &`  h$  &`t @p &`x @p &`| = &` > @6! 㿘 \  \2  &@m 0 2㿘 \   @~  2 㿘> #h . @֒ 㿘> #h . @0!@ + 4 ! !@ "}@  0:@"0!@ 02    @k  \" "$ \# `8&@`H`D€ 02`@ € 0  `` @ 0 > h * R`   > "`8P> |"`8D"` @!Ȑ* *   @jא!> $! @jє !#> 倢`$a 2> > @!! "a@l} a  @lw 0"# @pa@p(> *a > * # * '$` > $`$``0@ `  > @["װ ` * * @j ` $`  a    `@$@pQ"$-  @ji  $ @@S { $`h @S n `  2   (* @@k `@k  O`` @x9$ X:$$` ``$` @ `  ``  &!: @&   %``" ` "  @k’ `@k J  "2`*`` * :$`* @`*` *$ `2  @k `@k $>  @k `@k  $` @" (' '' ` @w)(' `  $`$`$@> # > @"8㿘   , @i@o~&           @i $ $ $$   "@``  @ a$     * @iy $  *`  *  @ " @:  *"<$ @m$ $   *`  *   @ " *` *  *  *   ,`: " ` *`  * *$ $ @v㿘? 2  > #2 B * *  > a* @ 5    `* `@r`  "  @6 ,` ` " "  $ $    $ @ΐ㿘?2  > #2 **  *  > a* @ " "      **@$  **@$    @ @$ 㿘 D? 2  @ 2`*` * >  * `2  < 0  <(& 4& @& 00% # `  `@Ӑ  <& @H /d * % @H 00H /d * % @"QH 0㿐> * * @` 8@ `D ``T *`@`@    @h)*  @n*``H` > B#d "`< `<0#\@I)`0`\`t "`t@SF `"$ 0@2 $  \t`"t@S6 $<` @զ  @%,`"  0\`t "`t@S  `@ ,`@i 㿐`\ ` `  @      Q& @rȐ`@l-`` "$ $@ *@`  3  :`@r * 2`@ @l:`2`@ :` *` *  @r * @@k@V- @*`  2$"* & - @   @gF @m  > B#`  2 @g; $ - @" $$`0>q @a&0&X`,@&,&T&D&<&\&p&t@&x&|&H'> e#> )> X@`<  $ Hc $cX"@ @  H X$ '` ; 0@6  @f @lɒ > Bc`  2 @f $ @O   $$ D$ \$ p`% *` *  *  *  : '`$ |<'$<!> B#` H * @@  8*@&8* "*` " $㿘> #" `> bP@v `0("`<`<&`@`< 8`@@+" @ 㿘 x> -  t* ᤑ*  < `> #" ` > bX@P  0(` >  "h0($0 4`" > $4"x> 4" |@# 0`(   @ /> e3> > B#` ,` ` H @**    @  X@ Hc X@&c  @g <@g @@("> @>"  $@- * ᤐ* @s㿘?2  > c2 * > *  * @` >o>ݔ!" @j 㿘?2  > c2 * > *  * @` >o>ݔ!" @jm  p? 2  > #5   - * > a* @k  "@ͯ-   m@"`e e@8 0  h@; 0 e`f@ `g@>0"@ ` ~ { @` v> B  c` ''`'a:` @p 耊`"`'  @ec*   @e]* h* I#  @| " @8 .` ` @L@& +`` '''z " @ .` ` @Lm@& > * * @@j Ȑ@fȒ @fŒ @0> !*` q &!> e X` `&耊  `0> 2cP#\ܔ @C $ X`0$``@`8@Z@ېְ ` а @ ː  `*@  ` " `` "`@  %> `8 `  @L`  @fj `*`` @ "``.@` @fY `.`2``@fP `@fM `,  ?@$``@fC  @f> @ @ِH/ /@m@jL ȑH 0_ ` J`є!V ` A `&`*`` I&` 5D @) ?`$`` @A`İ 2`@2` @?`5# @ `* * >o`a@i`İ` @$` " 0` 2  `$` $`  㿘?2  > #2 6*?* * >  a* `` !>     ?`*  ` ?     ?  @'''''ܐ @JG 8 D   @Nq`@@K ) `@@M P   @N]`@@J 0P @NO &   @NI`@@J  㿘%? 4@2`*` > *  * !@iS@iP"  $ < $ ($ ,$ 0 ]$ 4$ 8> b @hِ  4 > b @hҐ . 4 H4 J$ X$   !W $ 4 $ , $@ @?`6  @  `. 4  * >oa@ @㿘  * >  b@h 㿘  1>  @$ !" @ "    @   $ 㿘  `@&  ?& @А`((hdtl|ll㿘 \ @  *@E cȠ? 0  h ` ? 2: \ 2  3  X* \  * \`* h>  @ #̠?,  \  h @ 렄? \ `*   $ \ h `@>  \ `*@&㿘 \ D ` cȠ? ِ  h ` ? 29& 2  2  X .   \`* h>  @ #̠?,  \  h @ 렄? \ `*   $& h `@> &㿘'>v  Ȣ $@ᰤ8 8 $L,` `  "? `,` d  6 :&%L& * \ *@ `* h*@ t h *@ `@㿘 \ *@Y! \ * `a*@ d"* t @L㿘    `@@   @`  @B㿘 `" @   & %P 2   \  ``*%P &%P@: `@㿘H /d4* %  > @H#00  ` >    @?#X `&  2   $L * *`@"  @H 0㿘   ` `d> @h#H /d * % `  >   #@ }  > @H#К  Ȗ    ``8`8, $ `4`#   ?# #   #  $# # #  Đ $ 2$$H @    > @ H 0㿘 2 > @ ( 2 > @ H  @ " > @ ` ,  $,, 23  `"  $` `>    # !$,   > @u $,$ & &  $L *`*  '"  $,>    @_  $, 2& > @  $L *`* @" @ $ Đ& `@>$& 㿘  ` @ " > @ "$H> @ &$H$ *" *  О  Ȅ$L@ " ?- ,@ `Ȗ 8`8 К  2@    `@0& @s -   z>  @! %P` & p&%P, $L"&    &  `& &%L&%P&%T&%X``0  > !@@Ȓ $, &%L& & &%P&%T&%X   $  & <&%P 9b !3&%P@2  > !p@ &  "  "    @& € "   `" @   >  @d:# @ @N "B 㿐 " h> @! > #̀ @`>    h ̀ @2  X  2 > !     *@" > " @3 00  \ *@#)> א  h "  \`> "(@  \* h*@ t h @ #Ƞ?   h ` Ք? > "P@ U 2  >  "h d* X @ /> " @ > *, $L0>  &  &  &  & @&%L&%P&%T&%X `*  ` $*@   `" @  |0*!@ 0#"@    \ & *@O   c &%L&%P@ d *@ h* t h @* ?& 㿘`  `d*`\*@``*H /f * ' `X *@`` *`\ $`\ `\? @ @   `\ @ 2 `\ *@ `\ ` "``*``*@H 0ӐT *`h*@H 0` `X* *`\*@ڐ `\ * Ԥ`h @'a?ː `h `@?  `\*@ `h `@2`\`d *@`\ *`` *@`h*`t`h @*0`\ *` ```` $*@ 㿘   d * \%L @ %p:$@ ?& %h&%p  h @>  ` #Ƞ? u  h `  ?   2   2 l ` " %P 2   \  ``*O%P  `&%P&  2A \`$ X%P 2   \  ``*6%P  `&%P*& > ` `%p*  &%p%h (: ``27 ``%h ` .`$  \%h %i @$ ` \* h>  @ #̠?   h @ Ơ? 2 \ *@g `` 9>t#*` €]%P  %X \  ``*%P \5%X "9 H \` ` B %  =%  &  8& %j   > "@ %P> #@ %P 2 %P \  ``*%P \ &%P  `4( %P ` &  \  ``*%P &%P \* h>  @ #̠? q  h @ ܠ? 2 \ *@ݤ㿘 d   * \  *%L` %d%\@z$@%P%T &%P&%T%P%T  *  &%P&%T` 2&%X>u $*` € 2 > (#@ :     2  .%\       .%\ > #x@\  .%\ > #@T  %]K&%d `@N> #  h `  ? 2> \ 2   28 \2 %d%P 2 %d \ *@֐ %d&%d >  X *@ \*#ǐ  h ` ?  2 \ *@ `4 h%P o` \ *@`"㿐   d*` /  *`// ///    F @` $ , %P`  &  \  ``*q%P &%P 㿘 ` @`> <# d*@4 r j   `> c* @ > #@ 0[2   @>   4` ` N  h  h @2  ; >  (@u $ "  d & d @) `*  x  |    @ " $ $ %P ` $  \  ``*%P  $%P㿐 d  *@   > & @, H 㿘 2 > @w `2> @q m  h @ @> @  % ,X` @> ` #'> ?  C - d h ` ? h @2   >u ,  €-/+'/#> ! @ %P`  &  \  ``*r%P &%P>  @ `&%L`") l   @ "   &  @ t `" l%P    \  ``*A%P &%P l ` >  @!H%P`2 %P \  ``**%P &%P`^`` > `& !`@j ```  `> ! @Y &  % (`4>  h `c@  h `@" \? > !@;  \ * ` *@ d`* h* t h @*  &%L&%X& & & & &%P&%T㿘!>~>~l@*  ! @. @M !㿘"t 8  >#(&"t"H#@$6"P 4 6"P#@  6"P"P"@*` ;`"H* ; *@ 2` @ "t6"l&"L&"D6"h6"j +@`  w >~> #c|$ $ $>~!$ ?`"4 8  $ @!> @"@@>@ 㿘"` @㿘"p  ""`"`"€㿘H /f * ' @ @0H 0㿘"<!`!#+ " 2"|"|`@㿘> a @  `$ 㿈> # 8!46"<'! 6"R6"T6"V, ">`""0"0,"  H, "  ,"$ , "(,",, "8 """," "k , ! "k 8, "!"m, "4!, "!, "<! A, ,@Β  ,"j 6"n""o, "<! , "=8! "(,",, "x`""<@"<!, 8`@ {@ 48# > @@"㿘 8 $@ @bRbP@2  8$6 8!  €    2     & & $  ?& t  2 ,> @"h "bT@bT* @b@*` b @@厐 <@*bTbX* 4bT`*`bP2  4bT4bTbR`*`2  4bRbV`8a @cbPbT "bR> bP"bV@bR 2bV> @"H*  b<+ a`,bV2* bi b* @, b ,b, b<a , bV`*`bP2  4bV4bV g46㿀!"<! B- " "n { "<! -  "n"j"L" "* @c"n "o""o"k"m" "@ ? !  * + 2 > @""j "n> #\"l"#d#`@Җ("j@*> "l@ *2@q> c @^  `)& 06"n"o"j ""m-"n@2"n"<㿘"p 8  !"<! ,@ " @ 2" ,@ 4 `  ",@ ",@" @ c`"R ^" @  " @`" X $X"T @`$T846\ {$\48"R*`2 <6"R"V 8! @b"P"T ""R> "P""V@"R 2"V> @"H"X* "<+ !`,"V2*"i "* @, " ,", "<! , "V`*`"P2  6"V6"V 5 6` > P $P c@@ 0""P $P"`@0א2"<! ,@ " "","0 @ @ "4 @" @2\" 㿘 H /f * '  a2 a1 Za a"2 8o 0!5fa"c 0 !6Y 0\@ې X 8 6 8 ` 0Y 8@L0IҀ%8F  @ 2B& @0@@  2  8 8 @6 802  `@ `@ (0`$+0"p   @L 8@ 8`4  @Ȱ!H 0㿘. 8@p2 2 L P  & P , `& L @@ǒ㿘 8! "6 8 `.@@6.@0J`*? 6*!h8 @b!    8"6 8 `.@@ 6.@0/0G!?     **3 `6 22@  * @.@ 2  Ɛ 8 =6 8㿐 8H /f * ' >  @ H 0 #+>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $  . @⭐@⪰ 02 $ $   '> " 7.H /f * ' `@Β H 0  4 H /f4 * '  5 H 0  $ $$ 4   .2  *H /f * ' > !@ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (  ,`   ??" $@ $ ,`42  8 $ "   @s&$*`  s㿘"H!? "@+ ?`"H > "@ `p@   &"@ 㿘"p  "`"&"p@ >  @ʐ#  &"p 㿘"p  "`@&"p㿘 8"`"!@!@ǖ?@@c !  * *  (2*0"D@!"F (0?  ?+@``(0"L"*0  *2 @!` ` `  +@  @`2` 㿘Đ p @ <*@   $ ##  @## (pᨀ@ <  *@( ` @ `?   " (`  @ " ``@(*(㿘! *! ` ` @"`@ " ! "  $ ! $ # #!!*@>~>~l@ > #԰ . @ @   . @ >  @( *@` >  @( *@`@ * @> ? ( *` ( *@@ * @> ? ( *@ ( *`@ * @> ? ( *` ( *@@ * @> ? ( *@ ( *` `>    *@` >  @ *@` >  @ *@` >  @( *@` >  @( *@`@ * @> ? ( *` ( *@@ * @> ? ( *@ ( *`@ * @> ? ( *` ( *@@ * @> ? ( *@ ( *` >  @ *@` >  @ *@`@ * @> ? ( *`*` ( *@*`@ * @> ? ( *@*` ( *`*`@ * @> ? ( *`*` ( *@*`@ * @> ? ( *@*` ( *`*` > >  @(  *@` > >  @(  *@`㿘 ! (L @>    @L@`@ ! @@hB! 3  ` "` $`D  " $ @ $ $   > "@ `,    #   @K> !  @s 0 @K۔  㿘  (j @-  b~@ b}@#k@% " e@f@"  #m@"l@  #g0#i@0#h "  @ >    @K@   @p    cl@"I`$ce@"+#k@"T\n cf@4cj@c f  #m@@ #g@+ Y 0#i@.0#h@% N  @s>  `@> > "b @!9 @54 1$`$@,@'@?"@ "  " @ "`@`&d& $\$d$`@Ő  @K 㿘` ( @j  @J@m @@ @D  @J   -㿘 (@K!>    @Jא@N`," `@@Ő @c `,2`@!> ` "` $`D "@"@ `@2`8@`8``` "`d@`d  @   @J (@Rf L& ( 㿘>   > "@J 㿘>   > "@J 㿐> > "b0#\!`  @ > > !    b@@#\> > "P $ @JG     㿐#d@O  L @Pa h h@U >   P@J( $&`,`,&`0&`@`@&`D&`8`8&`<@[В 2  &`P  `&`T @5&`X @Q L0 2` 2 > #""`(&, ?",`0?"`0`, @s`0 㿘@s@m 㿘@V  "    ,@ 㿘T 耤#> `   @IېR?@K@ʐ`  @IΔ  ,C ,*@& ,㿘0 耤 > 4    @I+@ ` `4@ 2 > @א"``" ` "``4@`  @I 㿐`     `  &  0'"  > > > "pb@"  @Il`P "`,  !``T@  `X `?2   `2`  ` `, @ +-`T@ # `耤  `T ( 2  $ T *@P L$  ?$ $   T@  `  @I  ```q` `耤 ` $  @ 0@$ 4 $ @  8@$ < ?$ $aP`耤 `T"#`, $  @@ 0  2 $ 4@z $ ?$ $ $ @"`,@ 8  2 $ <@{ $ ?$ $`,!"  $ ``P 2 $$T  ?$ $    @H`"` `@ِ$ @`耤 ,   @H``` @`耤    @HmT#\@S0 מ ՞>   @HV 㿘`  @Z$" `,!$`,㿘`  @Y$" `,!$`,㿘>  `> > @"`@b` 3 ` ,@. @Ɛ )`6 (`*` 6 * 6 *`   $ & $` "` $ & $`& 0` " $ $ @& $` & 8 $ @q& $㿘@ "$>   >  Z>   `> > `#@c`#8z @V 2 s 7p&` `> > `#(`@c 8 "c ` @   "Y   2 "R `@ "L  "`` 2C ``"&`@ِ&`   `5$ ` 1$  ` > > `#@V`c@]V` ` 8#  8 " ` @      2  V`   ` *@   $2  "  H1` 㿘>  `> > `#`@ch ">  ``  `2` & \ & ` & d` $ @` $ @ p>  > `   > > @#x`c@``   " ''  ` :` `?''ܒ''''' @Nذ`"@&`㿘>  @S~ 2`,. * #`4 4@"# !  ` `!"`4@XO `4 2> "Ԁ @ 㿘L @` "`@Nh L$` ` @0  a` @8'  `  (  L@L#$` #` `c 2 ` `  c&` @N1 L$` 㿐6`  `@] ' @]*'-  `@6  2,` &@] ,`  & - @M L% 㿘 ,   2   㿘>  ` > >  #@ޒc ,*@","  $  ?& $@oӐ  $ "  ` "` $ D  "@` "`$ 0 " 4$ 4 `" @ "> @M L> @"㿘`? &` L?& L``"@`@M} L@``"`& <`@"> !@㿘> "@Ȓ  @P!``4$ $ $ $`0 $ `0"@`4$`0 $`4`,&`@ &`, 7㿘`L @> `P > `8   2 @> !@ > 1  `> > #Вc@-.` L&& & & & & & @KV  & @&  * `@& `L `H`$`L&  $`H& &`<& `<"@$`<㿘6 &`L  &`P`T @"@ `?$@@H 㿘\`L&`L7  "  "`T @"@ `?$@" @*" 㿘``L   .`L +` +` +` +` +` +` @+`㿘`  &`L  @&`P㿘 , @  6 , 2 & @"  "? -?2  $   & $&  D &  D"$ D $ & $ @D 3> !> ֐! ` @l   耦 "  $  㿘>  @" @O!`> `  > > ` `8@V $ @` @"` L`?` 2 "@$  D $  D"@& Db 㿘>  @" @O!`> ` > > ` P@+`` $ @` 4 J$  D $  D"& D@ 㿈> #'P' @P" P !H@<  !H@"P!H@Ԗ"Pb 'P @W" ߶c > @v[ 㿘 . * *  @J  > @Ր 0@O> > "#"`㿘>   `2 [ * *  > c* @ N d 2 d$ @F   `` *  4`2  `   02`   *@$  $"  `*@ `"     $  $    @ @$ 0@㿘`!@Ot`@Oq"  d"$ ($ 0$ ,`@V d$ 4> `Д $ 8@N  4 >  `@N `Đ. (4 H2`  $ <4 J$ Xh$ $   aW4 $ $, @y֐6   p4 * >`cT@ 㿘>   2 **  *  > c* @x " "      **@$  **@$    @ @u$ ` D> `2`*` *  㔑* > ` `  0 (& 4& 0H /d * % @H 00 T <: & @ 0 (& 4& 0H /d * % @H 00 D  ``@2  4 DH /d * % @ǐH 00c D `(H /d * % `& $a$` $aH 00CЦ  D` * `@ H' <'''' T: * 2* ?''`Ȓ`@1:`h$` 0 '``@1 & 4aH " H <  T`aH  H <   T'`Ȓ`@1 & 4aH  H <  T` $``@2 4` 0(& 0& @H /d * % @2H 0a H /d * % `a $?$`$aH 0t D` * `@`Ȧ  XD`L, 4 0,  @`@ H  =`'Ē`@0=@M`ȖȐ @2Ī`Ȓ @2`Ȁ?" @Mf`%Ē *  x@G” ̖"0"< 8"4"8`<? ?` "D"Dȑ< @"H"T ,>̐"","X"\ `"` d"d h"h l"l"p`"t0"4("0 @%"@& @H /d * % @ H 00%"@H /d * %  @w`a`Ѐ@`$a@H 0 = Dh@㿘  0 $@x&  0@ \`t "`t@2㿘 t>  D 2 * @*`@㔓*` > #" `> `@  4 "  < 0h$ 0@$ 4 < @ " @H$ @ @ < "@@a  `0@x` "a0?$a㿘>   2 * > *  * @` >>ݔ#T" @K 㿘>   2 * > *  * @` >>ݔ#T" @Kk   @RE a4>   6\ > ,c*  b* @   m@";e e@ 0B  h@ 0< e`f@ 5`g@0"@1 ``- @ % @  `@LU > @m   > @8!@   @'x'P't'T'|P @,ߔ " @0@/`  `@1  @`&  @0`$`+ 3`  $` @ 2  & @F/ ;    `@-s@l0  @F H$aH@@K@G̒ `$aH`@`Ġ`0  * 2@ * >`>  $`$`@w$`X@4@@ `  @   `*@  `  ` @%z @אaH @KaH@G @w'`0H/ /@@K!PH 0Z `$S`!Q `$J `&`*`` D&`$>? @ʐ :`$`` @` 2`@2`? 2  @?`4 # @ `* * >`cT@`` ~@$`02  `" =$`  p>  @Q$ ̐" @EP  ą* 'Є" Ȗ   ?''''''`@- ̒ @.  Ȓ @/@F > >`8<  " Н㿘>  *` > *  *   @!P* @*`@c*` * 㿘>    Ȑ ?`& > @!0 ̐ @,A @P & & & ́ 2 > * 㔄(> `(2Đ? 㿘 1>  @$ !!H @f "    @   $ 㿘 `@& ?& @h}\4\<\]]p㾐> > #x'~ "x@q> !ԥ2`8 @ H/` />  bp a?  *a a` `,a @ @O  a  ,a @ a,@ a,@ > ( @ <pCB8 ( 8(H 0> > #Оbp#H  `  #+ ` C + < + +H 0 >  *` *> "@ #@n *` > @pT!p>  x㿘mH/ /> "p!> !` +!#!  !+!  + ! + B;H 0 㿘?H/ /> "p!> !` +!#!  !+!  + ! + B;H 0H/ /> "p!> !` +!#!  !+!  + ! + B;H 0Ho o> "p!!> !` +!#! # !+!   + ! + B< H 0Ho o> "p!!> !` +!#! # !+!   + ! + B< H 0 - , +㿘> c 1 !> > >#cL@m!> > #@m c>   @ @" !$!Ж #`> #"@H"> !@H$> "p  *?  $c? 0     㿐> #`ŀ > . !@ . @pJ`  􀢠Q@` `" #@ `& & 4 4 :?  ; ?#`: `: `:`:2`> > `  " :    0 ` > x`B j:x$`$`$@2 > >  H/` / > !`@:<@  > > # pB: pH 00;" " "" # ` `(`B ; ` @ `B  8. !!   8@B 8B :  > !Д`  > " @l#H 0㿐> @lN#> h`B :hH/` /-> )> t/> ' 'H 0 %> >  !   А" 2 c* $ , 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * @3@  @ ʈ  @B =  & &   `   @e& > @ #|> # @. Ho o   >   !@ <% % 2~ &H 0 (> #' > `[!@GH/` / @G 2`,"@% % H 0@GԒ@G0 X/ @ ///   @/// /$  $ 1aЀ@F > # .`B@; > @mH!`   ` 8? @2 `f>!H*` €_ > a  V #> Є X> ``C :X> !ܔ!  @b A ! 2`8> `B :?#:. `&:`$?#?cݠ,`,  $  ?# ,  0    ?#@V ` 㿘`` 0 > !Ԁ`>  @c| R`   > > "`8> $> "`8> "`    `2``"`H  <`" `@ H> 耠  `2``"`H  ? @ `2  2`y  t ?# @8*`2  @U 2Z?` ?#*  2`*@ , 2 ???%> >  !  А" @2 c* $ ) 1 #* @g * @ * #@ +  #@ * @@ (@@ @ @ @ * 3@ ?$@ ?ʂ` ?` ? @2   > "#x㿘 @"@% "@ "e8""@I @w  "@  b~@b}@ @Ho o> !Ԡ &H 0o@J 2i H > a`   "`"`H 0Q@J 2K Ho o>  "!ԑH 0;@J 25 > !Ԁ`?. #Ho o>  "#xH 0@Jh  Ho o > #@D"H 0 @Ր    `  ``\ ("  `X8 @ "8 "" `>    c'' @' ?''  * '%  '" ` @'  2>   `X <`?  @ > T'   M =`?'Ѐ`Ⱥ  (`"$ , X@@$ ,  ' $ , :`   @v찒 i> > c` 'ܐ "` X'쀢 " ,@u , :   @X찒 J H ` ,*r ` v p `  !@j7T "? ` `Г2` ``?@T`M ."`ꀢ6 M`! @oM`! k; ,@`!  ` @ T*`  ,$'2/$ 0! , @ T* $ 0 0@' 2  @It Vܬ  ,$ , ,؀ m"%$ 0 , "C:@:@쀢 @;`   @찒 > `H %$ ,  ( ''$ , " @ @̐@ДȀ   ?@$ 0܀` > c` "` Ȁ ,$ (6@#Ē @' @%  0 @`X@ @  Đ@%ޒ` Q>  *@L% Ԁ: 7Đ@%̒  " @r;> *@)%  0   @@N@X "`X@ @ @@쀦 > Ԁ  Ē @' @% "@ @@G >  > @i"㿐  `@K `?@Ø @ '` H @ & '㿘> a>  9 @S\> > "c" 㿘>  '> %> 6` 㨐 *  "  @2 2  `@v 6` 0 2  㿘 >  2 > @㬐 * > ր`  2  @2 22"&& # 4 @6/    2   " "㿘 > % a(    D > "0@  $ @&Ӕ x`@ z  㿘 > %a(    D > "P@ ǐ@ " @$  @= :&  㿐  '  6`x6``@     `. :   􀦠< H 26  @`x!6`x @2 `x @6`x  2 `x 6`x  2 `x 6`x  2 `x 6`x  @2 `x 6`x  * @&`|  * @&` `x&`!m6`x&`| @㿐'􀦠 `  `  *@ :   􀦠'`H ` 2! ```=@ ` @@`p ````d&`p&`t`@`h ``p`t&`h&`l` `p@ `p`t&`h&`l&``&`d @㿘 'l '    &`&@H 8X. * "* "`  @?* @, : & @? d@?? * @,`,`* :`& *  @?"?. * *"@ *`@*" 0*  ``d ,:`*`" *  * "&@&`   * ( ?А㿐 ?/  /  /  / ޒ / ڒ  //}   (  *  * `(x<x8wxHwxHxHxHwxHxHxHxHxHxHxHxxHxHxHxHxHxHxHxHxHxHxHxHxHxHxHx$yXyTy0yhy8yhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhyhy@   (@2 x   *  ( @* | ` *  ` `(@*   *@ 2`"`㿘> @}"@2 㿘  `(@`$F`0`2 `,@6  /,` > " ` ! >!t*` €  $ `$  `@H> > " b  > @}"`, `,@@O   `(&`$2&`0   0`( &`0&` `$" &`$2`  ?&`㿘N > "`  >!*` €  > > " b   ?> @}i"`, `(@2*``,2`@  ` `(&``$""@&`$2`$`$&`$ `  ?&`㿐`(> b`,`$@Hؔ" N !   !`a`  #\ `( `@`$0`( `( 2@   (  *` *`  ( "`"`JC   `( x0"`㿘  (  2 "@@`h  @> h  @`` @ h l" `" d  -@ْ`p.` 2  "@@3`h  @>א h  @'`` @ h l" `" d  @`p`@ h l" p" t` ?&` 㿘@N     `( (   `*  *` `( ( ? 02 ?@ ?  0?@ * @(@@ `  `㿘 `? @`@&`!X㿘 . (. &`` / ``..> >`  .  (.&`$㿘  2-    2% ` 2  > b @D 2   2` > c@D  > c@D  `" =&`㿐 `!`' `!a`@`2`  *` * + `  L "\`!X  ?#  ` )&` `  "`L@L@2 L`L @2 €` 2  ` (`@`: `` ,`) ``! :` B8 2  + ?@쿘  H`` @ @  2  €   2 ` '> ''ܔ4\X6  !` x`!7'' '''ܐ !@J>  ` Ĵ ?'Đ8`$  7> '6'''Ĕ$'& ` "#> &a\c @C     1&a\c @C  2?"'> 'ܐt"?  *    ? * 㿐Le ;) ;Y  А R, * @ ?Ѐ –.`@*`@ ;$    ? +"@ )"@  ! . ; 0`;   ??? 㿐`\    =. `.d  ;` .F6lPllll >  > U`x> @גap  > > db#> @ϒ` > @z/#09> > #Ȓc@ 1`'@   ?"@@8 0> \" "\@  #b\ "@b\"`@ D@ؒ@b    2 p  `<`@{ @  a @n @&(&&$&&,@ c< "@ΐZ > O `& @ĐP ``@ @@+! @B0: @ `<@@2  @0  @  `y Y Z`@@;$ `n Y `@@;$ aL p@# D0@t㿈   '`< ''   'm @4 h@ >   _ `@  @ T耢   ?@ I0c ?@  2'   K(?@] >  Hc @A  2   " 4 :0 - ''&l 'X> c@@  " > c@@  " > c@@  "   2  @T'c @J'? * b> ?   9@4!d@:!d$`P ` `+  P* `@ @ *@ $`a(D "  +  *   *` $aL ` `+  গ* `@ @ *@ $aP$`1$a`?$`0`%0@&a&`d` `< &`h&`<&`@$`$`$`  " l`2%l ?aL`* ` @` P8H $aXl l ?&l`0 "`0@'l  $@` $aT $aTaT #`!a(Ԕ "  *  *` * $aL ` * `@ `* @*@ $a`$aP0 &0$ @ꑐ    @ @ꃐ   耢   @b?`@5ݒ 9&a㿘@($`D   ,($`<$`T$`0@Au8$`@@@ِ J> `Hc @?є  B > c$, 5? * b ,( (@9X  8 @9T  " "   !W<  @&&&.6&&&&.&@d-6 `0 $`0@  㿘6` @` a   ?# @ @s @5X 9`<*@$`<$a㿘!!(!T `?@I -㿘! D @ &`&` &`&` &`&`&` `T Z `ߔ Z!La۔ p&`8  㿐 `` & x` &@ & F㿘 @ 㿈! &" > # @  & :@3$ @8 >  4 @, "`$$$  @ "!2F'6@ @g F>  @`!  @[ F>  8@v0ے , ?@  @K@2>  `@v0 H @ @@: " @ >   x@v@  F$  @$ 6@$\@     @0 H   * *   *` $T ` *` ` `* * $X @ $\"<T ' "' ` *@ :   'x쀢 " @̔ "x@x< @ > % 2`  `."<>!*` €> ##"`8> #" 8@ > `$ "`" 8@@$ 'X:  @Ɣ TL@`@ "`@ &  2@ "`\"`㿘!@`  `0`4&&     t0\htt `@, `2- ` 2) `$2% `,2! `?2 `2 <`"  < > (      㿘  x /| @k `   `$ `$ `x /4 `4 `|$ `$ ``$ $`d$ (`h$ ,`l$ 0`p$ 4`t$ 8`$ D`X :`< `X .  < 2*   @1s$      $?'''''''''''@c耢 А$ < @3   $ <$ @`$ `X :< H <$ 㾈    /  6 @煐 0 %` @@  `  `  "@ 8 X  @:b    `; { ;  > B (#` > B#`h`( 6 ?;`#\#`@Q/ $(  x   `` ` ` X*@@  ?#\#`@?@Θ&`@$8 `H@F͐`@  X : @   `0 "`0@    2h`㿘 0"z@"      @G    㿘``*@ `  ? 6`#0@* &#@#D`#H 4"@&#@?#H`?&#D&#H @Fs#0 2>#8 㿘"" N" =`?  " !! 2!@< ""!  # ! 2%.!   # ". "   ?  6"#(!># "  #(>#y" 㿈#P` `   @/'  ,!, ,",!, $#0 $#D 2 /`@/ $#D$#H $#@<#(#,   @1 0 `X#(  @  "#(@ #(     H ` 8#(  @ @ 8 Cm<#(` А  ̪ `!@,"  ߒ$"T* $"#(  B<#(!T > ""`<,"#(5`ؐ"@>Ӕ! "`"L! 2 "$," "  L! 2!T ,"!T!`  !` #\`? `,"!T`2#(#(" #(=g #,8b#(  !T  ,"ΐ & ` @0Β #H'@"@"@ "#8@V#8> #@@0#㿐   `!T " b ?`?2@*@  @  4 ` H   ( @' F   $`#$@ @.Ɣ `    c@0o @ 0 @  #  @D@0Y 0  " $  "" "㿘  @ @ 㿘  @ @ 㿘   @(^ 4㿘 ఔ  4 @(S`㿘` \<? > @py  T P@2* T   T@ " T 0$ 4($ 0H /d * % @?H 00,?2 T H@4  <$ @ T?2 H /d * % @ H 0  > '` $ D 8*` € 㿘> @qΐ  㿘 `@'ې 4`>((`!T`     %` $` "`     㿘` `- @?c *2 *"! "8! !0@ @ @@ @S`㿘`&a`&a ` &a` `@&a`&a$``2a` a`H  `@ g > @o!8@a``@*`@``>* "@` &`*`" ` $ a$ a $ @a $ $ $ ``@*`@ڐ``* "@` &`*`" ` $ a$ a $ @a` $ $ $ ``@*`@``>* "` &`*"@ ` @ "`` a "`"`"`"` "`@㿘`&a`&a `c  2 * &a` `@&a`&a$``@*`@``>* "@` &`*`" ` $ a$ a $ @Ha  $ $ $ ``@*`@c``* "@` &`*`" ` $ a$ a $ @)a`  $ $ $ a> B#d`a  , $@```@ >@6``>*`" ``&`*"   " " " " " " @+㿘`&a&a  &a @&a&a$``@*`@ ``>* "@` &`*`"   $ a$ a $ @a  $ $ $ a> B#` a  , $@````@ >@א``>*`" ``&`*"   " " " " " " `a *  , &a@> 쀠> " ?> c8"c?ppp4l㿘@n 2!@ $!< @SF2  @2  2  2    2  ,   ӄF2,  @2%  > ` *@8 *  2  2    2   ,  * 㿘'T?\ > B&#`  *   " $" 9> B&   @&> Bc`  +@ #@#@@2   '@`'@  `'@#` `8  @ F"@  @ @* @ݐ >* "@  & *`̠ " $ $ `$ @$ @$ $ @"A @* @ >* "@  & *` " $$ $ `$ @$ @$ $  @* @ >* "@  & *`̠ " $ $ `$ @c$ @$ $ #`   8  T @* @n >* "  & *"@ @ &"`"`"` "`@"`"`T"x  #\#`#d#h#l @% 2`  > 'T# D ''P''t'p''@ﳐp'X'T   <  @@! X X <` @@Ԓ! 2  4 2x   o ۰  ,  @*h'XԐX 2䀦  > B#`t-X@ `8 `` "  ``@` @@yg @,@T'!D @Q"> B#`  p t@8 @ @  `А 'h  " @  @ 'h @#dh#`#\h@y; 2@ h#`#d#\h@y. "^ @h@   *@"@T,@"@'!D `@& @AX'` 6'\ 2`. TTT 'T'd  "@'d#\d `\  `@ d   @ "@P'!$" d` 'd`@Ġ @ @X` @+F dT@">  > @U!p> #`  ` 3''/k    2 a`H " ,`@  > @kv! ,  @)Pay ܐ?&a&a /, >   2,#ɐa^ >  >  &a4 . 0`?'> ؐ @  & > # `"@`: "@` @ `  2,. 0, TO,?'''܀`C>#*` €a `#\$܀  a?&a(&aa  " &a &a" &a",a ?&a&a a  " &a &a" &a ,,O   @($  @( x$&a@&aD$ *$ ,$ $$ &a8&a@&a$ @*1@a@@*' @`  > @T!Pa@aD`'C a8  @* @* @`00@ & '  '' > B#` ''   ''''   ''''a<'''w1 @@)Ӓ @)В    㿘,,   @(a+ 6 ,* *  2"   *  @' a   `@2 ` @3` `0* `@) @)~ 㿐` 4 a(?`? )a` %> b@6͔  2+ `  @ 8  @ L  2` , @ J@ 2`*@@ *L      J@ "` "` L %  J@    2`J@ "a*@`J@ "` "`J@ " a `J@ *@a` , ` ``@`!@ @  ",`a( "> @iT" @ a0 a(  &a(2` > %!""`(2 , ?",`0?"`0`, "`@J`0` "` ?"a(  &a(@'  ? @&@6f$  ? @&$@6X ?$@& $a(  > @$u   > @h"P a0x @j͒$$&` @ǒ 2"`a(  &a(`@@ @(y a(&a,a &a(h@2a" d0 a-" " 4a(   &a( ?&a(a0@ M ``@@  ` 4@(O`  @(E ?  @(> ?@/㿘  > @h" , > > > "Ȓbؖ @h{ `, " &  ?@&c* , " vЕ*  @ @( ?& 㿘  :    " @   `  & @' ? && 㿘` @ "  +> ` ` 2 @h@c0  $ € ```"``㿐`> B+ #d`@ 2& ` 2"  "`  @V  2` A#@`  #`` #\@r`  @㿀`0> B#```* &`#\```   * #` ?@rs? 2'  #`#\ `#d`  ` #h`@ #l 2` 2` ` `@  8  @| @ 㿐`> Bc``A`#*&```   * #``#\ ?@r0?  㿘<>&a&a > Bcd4 * &a ``@*```>* "` &`*"@ a@ a a" " "`a"`"`"` "`"```*`ǐ`` * "` &`*"@ a @ "`a a" "`"`"`"` "` 㿀> "`> > ֺc@Qg" @]> @h#x> @h 8@dr@U@@W@]@:@N@=V@*@@> HH`$"` "H$ > c$$> @  $88"`<@"$<> @ ##@" " > "c$D$@>   # > "b`  $,$> ,1, @u: >bp@N>b@N> #$@0P" +> "@-> @1> @32 >  <$$@5,@  >  c$'> 9> )> 7> 5>  ? $: :`` > !#Ȗ  @@<` @4$!> B#`   :+    P <`<`p<`X<`h  @*  ><``8 @  $`> [ c@!ax>  Xax $ $ $,@* @Hנ4@{@b@Xg@@=@@X@a4    $ @  2 @H /f* '@o& @1@p H 0 ;,```'@ @E> #!8@;. >  \ @ "\> @f! H< "<"\  €耢 "> @f `"@J` @@"`   % "` "X`#`&"'"X"`">#`b$$#\   @p ">J> @e x> #X @^ ">> @e֐ >  ̖਒ @R ">> @eʐ >   @F ">> @e >  ؒ @: ">K> @e >   @. ">> @e!>   @" > @e!@c@Pې@)!@ > @b" PP> !X @ '''''@n  `> > @g%!h0@g"!0@(`> "#'> B#` >"@ '#`#\Ԗ ?@o? "> @eV!>  `"`؀5> P -/` `  s/ِڦ  * "$@'Аr%'@1ڐ $@'В r?''АВr ̠?r  ?r Ȕ'''@ > !@f 2 -> @f!> @d"㿘> @` 㿘> @` 㿘@㿘@P@.> I@  '''''ܐ@ + :@ Y <    @@  + >  d`1>  ` "@> @F] h`d " ` @@ Ԓ & `$`d@ @$`d 2  $`d@  8> `d> # '2 ` $ @0$#?:r @/ @7@7`'ؑH /i* * > `Ԓ`"'`" 'Вb@ ??H 0 @h7ДĒb?' '?/a ?>  t>  @&" 7``` @&{ 7`0 `,@= 7',  '$ ` "? l?' ? /@ m  #`#\#d#h#l  ( @ $ @0p$c > @M"0㿘@/a . c   6  `  # (.` 6 `.` @.`6 㿘> `h  `h>> !@@%  > ##> '%> ```!> `< V `X H > "atZT@.ʒ d\@*``> > "dbH$`` d`"$h`< 2 `X H > "at<T@. d\@  d> $``$ db`@c > @ >  > "t'> @h (@C `` > @M^"x ?@o $ d ?@i $``㿘 > e> e" `@J"`d>  t`> >  p ""p@%p> "`㿘>  &!>  @`  ` " `@J` 2`@3 `  `  > @I` > @3| >  t`> @/> >  ` 쀢 "> eh> `x "h" "h > L`>  H"@ "L >  Дb?" ?/!" `# > ` "`?/!"``"@J > #> W *` r 0rc 㿘H >    "  # H 0   А"@? &- (c (c& > , "@*`" * * > ?@-   %@$ɒ4 s/> ?@-   #㿘  &- (c`(c& > . "@*`" * * > ?@-w   %@$4 r> @-d   #㿘 , (>   `& ,`!" >  t`H /m * . >  > `p> e> e"`@JO"`dH 0㿘 , &>  ߒ& ,`" > `t  H /m * . t > e> e"``@J$"dH 0㿘 @$> e>   ,` > e @g> e`d ? S"`d L!`B < > `|` 2"`> `| -"`|`d ? ;"`d > > #` >  ؒ`B < > `|`  "`  >  В`B < Д| "> `|` "`> e ` "d d> `  $ d> e`\  "`\@D 㿀> >  > > > ' 'p'`t`'' @; <8dh` 㿐!> #!> > !b#\ 8  @X > > #\ b!@  @X > "" :**6*   6 *  ? * "? @*`2,  㿐`@ 2 0   $ 0 @  0 ,?`$ 0@Bq 0  @@㿐`@  ` 9 ` 5> !@ @. 2 0&)  $ 0@ @  0 ,?`$ 0@B, 0 @>ː@"> @`m"@rx@ @ q 2`0_  $`0`` P>#*` € ``  C ` (@`0> ! 9 @lܰ  23`0@`0`,?`$`0@Aڐ`0ʐܐ@*& @ &`  @ *@ @ ? *@`* :` ?* :  ` &`!  34`` ̒@`4` `'ؐ"~؟ 2`0` `@'`"}ذ "~` ?4`'` ؟`0T` 2``( <& `wذ &T` 2 ```("< "@`"D   &`@$ 2!$  &``  `v` PT`  ``(l~  2`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W "%   h`0 d`0` ",`$, ` ,`$,   @@CT` = `(`l(  26`0W W䀒@耢 6 薠 ` ?` @ b ` @ B ?W      @ݘ @ 2 `0`k  `0`,?`$`0@@`0㿘` #@  `0`,?`&`0@@`0F . `"" `0 $`0"    ?*` `&` `0`,?`&`0@@`0`> +   +@@"   2   3 * +@@"  4$ ` ' H@ @ 㿘.`"  @ >`&  *@ ?2   2*`   * *#  `  * *"  @> @^|"e& 㿘 .` `2`09  $`0"  *@ @>`$  *@ ?2   2*`  * *#  `  * *"  @> @^E"2 H-$  H@@ 5@㿘@ B  8`3@ 2 0!  $ 0 ` 0 ,?`$ 0@? 0  @'g 2'`j `㿘  @ 2 0"  $ 0T "`  -`   "& @ ( - 0 ,?`$ 0@? 0㿘 />   @8@ @&: <`   <`  "@,  ?2 ?2,  `2``  ?, ?2,   , ?m8??O `-    : "@,  ?2 ?2,   , ?mɐ8?-  .`@@6$<`+  ` +@@"  2 3 * +@@" @4$ @$$ &   㿘` "( @ p 1 2* - ' @* kp- "@@ Ԑkf@ ̒% @ ' :`: ` :`: @7 ',` @ؐ,` ' @Ґ <<,k;@@ $ < ,k.@ $@ :  :  $ $@i '@f '$$$$$( @ 㿐   2v{> > |a0  @;`&  *@?2   2*`  * *#   ` * *" @> @\">  n& > @\u"= "|>  @Tr!@ . 8 $ , @`" > @ $@" "@ $ bb $b" "b$   `* "@$  $ @ "@&@& 0 $ 0 㿘>  @T6 @!@ >    @k$` $` @e> `( $ @Ҙ >  Z `X` ``?4`&4`$$@$`$`$`$`$`H$` $` &0& 㿘 >  @S jN X  " @2 " @,  `6 & X &&   `c*`@,`4`@: `c,` * @4`,` '@ ,` & &`:  :   '  &  &  @, & ,  '@ & & ,`ji < < , i , i  H?  @ "  R 2  `@ ?& H& L& T& P  @#`"  `  ђ "`  `@ 㿘 &?* `F4&``" `0 "`0$ @9 &   @ ' :  :  $ @Ւ '@Ғ ' " @ "L@L "T@ T "> @ >  @TВ㿀 ` " ,`, " ,V 2 , (   ??77 @̘ @ , 0 0@<& 0^  ? &  0?& 0T 6 0> @Z#& ,` #> !>   0#  @:  0`  /*  @2  (   ??77 @    € `"  "` "@@$,  `>  0 "b|>  0@Z#(> $b|@TL!㿀` @ 2R 6 3 -(  ?7  ? 7?А*@2     7 27   2   @/     @' 0? 0 "\ 㿘\   7 2S  " y #@2r .`"@ >` +`* ` #    +  "  @ ?2   3`* `+@"  @4O& N . .`" >` (*`"@   * +@   "  @ ?2   0* +@@"  @4&  >&  *@ ?2   2*`  +@*"   +@ * "  > @YƐ"2 &  㿘  `` `<` $`㿐!> #!> > "c@#\   @P > > #h @#\cH  @P >  "`L㿘`4 €`4R` (> ""`8 "`"  4(  `2``"` 4 `("   㿘@  > '    `  ,!  @" "    & 4 6 ?Ȓ*  0 & & 6 !& $!  ( 4  `2``"`㿀< ,@@    &    (  `  6 & (# 2  ,   ? .@  $ '77'''@Ɣ   &  @ "  㿐>  L` ( . 2` 2 > "a"> "@P @r && " (& H &$ H& , ?",`0?"`0`,  @:N`0 㿈`@ r T` "`00l $`0`  es  2Z`0&`` D`( ' ' * `e^* D $   o4 @B ` 14 $ ` eH `  ``?&` &` *` `* " @ &` &`   &``` @&`0`,?`$`0@9Ӑ`0㿘V`    `  ` 8 > "" *` 2  "1`P@ 20  $0 `$ @`H:*`L@ "7` 2V`T @"-` "*` 2V`T @2`"`@2  `T* @ "` 2 2V`T @2`   X 23`> #h@O  2$  $ 4 $ 80,?`$0@9N0`$ ,` $ 0@&`&` $ ` $ `$ ` $ `@$ $@  .$ ,` $ 0`$ $Ho o 8   €   (  $ (@H 0` " ` 8@@7 "` ( 2`Ho o (  $ (H 0`  ( Ho o (  ?$ (@H 0P ('X + A#@n'` ' ?C` @=ܐ  H )*>  А  ? @ ' '?/a  ?9H 0` '' `   " ـH/` /``"6`  #>  $`P!@6k H 0 Ӏ? # " '`'`"@$`` @ ` "` $`   "@H 0@0 (` $ (`?n$`  2  8` € 2   ( ?$ (`[$`& & & &  $&   ( ?$ (`$`H 0 8@ @uHo o " $  ($ ?$ ($ `?$`` $ `"@$`H 0,, b Ho o  `2t@`"` $`"H 0` ,bѕ*X%"@   㿘 ( H /f`* '`     @jܒ   $ H 0㿘 (@c `   :6`>`0&`@ 㿘`  H' ( L*@ @->  @ 4`0 "`0 8@ 4i@O2h$`2  H& L P #?!  T*@ @3>  @  8@@Och$`2  P * T> "@N& ( 㿘   ?& @6   ?& @js @ 㿘  8` € "   (  & (@  2 8㿘 @@ @S@ 2 8㿘 .`L@㿘 8@ `P 2   @  @)`P$`T `P2  %`T`H  ! (!  @, `H`Lc%*`H$* @@*``L "$`H@b $`H$`L `L* @@&&@& (㿘 8` LP2  T* @@"@5> 5> 2" ( " 8@> 8` h 4`0 "`0 4oh@N8㿘 H/` / (` > > > #Xch@T\#&  & "" ( & (`"H 0  㿘 H/` / (` > > > #Xch@T1# ` "` "  "@ ( & (?"H 0 x`(D$($$@  &a`<    @@Ja 24`X <  "a` 32`@@% @ 24a` I 2y @@  2r4 @w#\#`@ `#d` #h#l@ 2R>  ` "   &&` > #, € a4 8`"  2a( a(  8c  ,  >a$@8 a @@  a   $   ` @4@ 04@ @ܺ㽀!> ,  $,@''h# ?'''l@:'#h''''' '''Ȕ>  `' '' H> Ub @T/ 2> @S7  "   J@,`J@   @@ ?  @ ?ؐ ?'``  2` _  ?` ?%@'_   2`` ?_  ?"Ѱ 0``?%@'_Ŕ   #> "b$  ? "b$* " b ` *   " А ? ' 'А @ly>> B `$ 2 $$ 2 $@2@ $$Ȁ`2> @R 04 ''>`$"  =c_d  @ ܐ @8 '`?,>c 4>@ @ۉ, $, $ ?H@3$,@`2,`2 ,` 2,`",, *@$, , ",@ ,!  $, $@ @"@ (" $"  '씒 'R ( `   q'쀢 2B``  耢 耢> @Qϐ H@y@䀢 ߒ@䀢 ̀ `H "`H 2 > %2` !""`(, ?",`0?"`0`, "`@3R`0``$, >$,`" ", 'H /i * * @9$$$$ࠖ *@" " @ "`"`H 0@Q7@  @ ' ," € 2} (@ Z,(@! @ϒ ?` `H@" @€ @€  @`Q$ @M,蠐؀  ?' @6@ @P@ ?,*@3$,Sْ@ڡ Iϒ @>耢 "@w @t  @@P@h ?@ ,*@$, 㿈`` '']  2U !4,  * * @  @'&@']  -]@쀢 6  @ ?' ']~  ? &`]t   ]쀢  ?  ']]   㿈`4'> B`0`< +"  @?I@?&`<%> 2P`` Hc`< * '#`#\ @Zך "`0> @Q h( ^` * P@T@  @]<&!(@?`<` `<  a* #`!(#\ @Z >  @Q  㿘@@*` 㿘 4 'H>`>  `@O  , "> >  @G#  , w&!@`& , w H@1& ,?&! @7& ~@v3!$ `@2"!$` "&`` `|2``x  @ @` ` " &`@ ` "&`@q&`&`!$@ * 䀢`& @  ,@  . 1 8`" < <"`< < 8"@ ` "`   "> TT & T "` "T&  T`> @15c䀦`H!%> `L@i`,( 7&`,@ 2`L` H6!< ]!@!@`@  !@@`H& h-  ,@ H ,@"  ,> #@; T 2 ,@0 ,@@  ((@  @ H@0 H ,@@@0@ > @"`  &  H`@@֐㿘> PP & 8 !P 8"`<"P& <@0 㿘#> %> aPaP   @.aP 8`" < <"`< < 8"@@K ,     H@r, 1@0 HaP@aP㿐@ 2`!$` &@`?" T    , @" ` 4  !$ @ 2 L`  ( " L L 1B2L 1 ( 2~ LL 1 E  4&``  !<'[ 2` `"  X!@[ H 2{ X " `@ $ X@q ( B ,@  @@0'`  ` $ `@ 8 & `4!< !@@ H @r0N ``2 4`` 4$ ,&``  !<*  '[=2-  * 4$ ,&`` ?#'[(   L 2` , 2` 2&> !  @- "J T H > 䀢@2L "(LP PPL `T "L`TL P"`T`T"P"H㿘!@> @G# @ `"  "`   "@ L`" P P"`P P L"@ @? `?  "` @Q@>  @G" "> @w>  \@Gu> "b(?"b(㿐#`#\    @7 㿐#`#\    @+ 㿐@` @ @ "  $@ ` `@   `@2@` 2#`#\   @ 㿐>  > "   b(\ ` 2>   > @M\! #$b(@y  :   p  > 2 t cP?@hb( #> 2cP@M  > ?@[b( $b( @E5 \ , 1$ ( X $ @$!![~ (>b p@4>b @4 $ , $  , " , ,! , @ $ ,>  @E "$  [Z   " @ " $ @6  $ $ $  ` "$ @V $ ` "`!$ `  ,  , $ , , $ , @ $ @ @ @"`D& @ @$ D@$ H , $ , T $ L T L"`P& T T$ P$ T @"  `$  䀢 $ @ `$ `@ْ @Ȑ$ $  D€   &  , @Hؐ   >@ap  <>@ak 6 `$!,>t!耤#\#\@Hc > `X`X "`X   @(" > X "   @" X "   @ "> X  "    @"9>  T%> 3> ;> #> +> !7P " T @ $@} T P T$ 4aHaH $ aH "` &aH$  4aD a@* @ $ 8@  8"`<aD 4a@ @ *`"  4 * $ < ,@H /m * . ``  " "4!>, 1@wH 0 > B#`&  " "  " 4 " 4 , " 43>  a @+v  ,`  4 %%㿘@ 2 @! 2 > !T" 4"  $ @2 24 㿈#`> 'T'X#\"` "  @ ,"& ,! @MUT2& 㿘  !>  > `4! a@L H. 㿘  @ (  2> @KC!P@ $ $ $> "b,`""`㿘> "", , $,$` @ @  , 2㿘 䀢 ` @S 䀢 & @㿘 ,@Ɛ @6L6 `4a&  YT `> c '&    @˒ 6 $@$`  `*" ''@@ q  *@&  > @4!P#>  c@'&   ''7''@ *@& c > @4!`#>  c@'&  @A''@ʐ *@& c > @4!`#>  c@'&  g@''@ *@& c > @4}!`> #'`O  & > Bc`  8 :  @! `'@'`'`'@r %"@&`&'  "@+ 8 @4W א@   *@&  > @4!ȁ#>  c@'&  .`>`'0'4'8'<@X9 0 ''@ *@& c > @3!؁X#>  c@'&   ''''@ *@& c > @3ϐ!P` ` @  *&   $ @ @'''''ܐ!@ 2|  @"<`  @@  *@& l `> !H`X`䀢2`@ &`L ` ``2`B2` =  !@ ߐ  "5  `/` @i@1`@``@  `  @M@"  @@K  *@& 㿘@ ( 2``&` `2`  &`?* &`&`ђ ` @` f  㿘 ǘ T`  L " Hh 䀤 , @ ,Ȑ  '?''''''̀` '`(`, ''''`@B @  @/ `>   a@H> !H " 䀢2 & g   2  ` 2 2  2 2 `&`,   HxK III8LM㿘@  'p?& & 6 & & &P  2 㿘 ?4  @@ p`  > @H ">  > "@@H  *@& `  &   !@!@> @H"p`>ѐ# *` € +  @  #2 M   `&    *` @':` & ꀎ f  & 0a  &  >   > @GÐ"  *`:` & 6  ?* & & 0 @  ?& 0< >   > @G" ?&   @2(   4$   2   &    `&    *` @'E:` &   M *@&    & &   " > @G]"   @)  @ڠ > @GE#  6 0Ҁ   @ˠ   " 032 M   `&    *` @&:` & ꀎ   & 02 M   @ `&    *` @&Ǔ:` & 倎  *@&    & &   "q > @F"   @> >  # @FԔH ?6  ` * & ?& 0   >  ?& 0@F#` J@(h0F > @F# @9   5 1 @    &    *` :`@&Y 5 24 M @     & &  6 0> #@Fp   @" 0@2  2  2   *@& @(  㿘 >  @G#   @>   V @G  `> @G 0_____> el l 㿘?2   0&% > "b4  #> `"4"4`&"4!`h @%ݘ 2"4 `"4> "b< $"4 㿘  @ِ H> "<?" $`"<" D" " "> e`l` " ""`㿘`"  "`> e" p "@@s > "b<> e?"b<"t 2> elp> #'6> "в  RV &% > e l/  ,@  2 "<  & > e l 2 # &# > @/ p㿘> "b8 - > e t` `D? t`,~` t" t0"  t> 2cP4@E2  t" 0 t"$b8" $b8> 2cP @E#  t" $b8㿘?2   > "b4   !> e t  "4  "4S t"4"4 @&&"4 㿐> "Ԁ`'0# @c  0# @[ c @1> " #@> "#@ H'c@V B'0# @"0# @ 5'10 #@#@2+ > e" t`" #@  "`t1> 2$ &#P@D" t0 c""@ & `"t"4#P"<@Dݔ t"`8"`0 & t0 #@"`8"`4"`0& > " "b81> ""8? 8   > e t`` " (`ؐ Q@ 't``    &"8t ""8? 8   > e t`8`4" (`0 Q]@ 't`8`4   &"8t8 "8> e t l"8   2 7> e> e t @  "@ @ ts t  "(   ' &"8Atbt0t84@  <, | t> "D<@Et` "`F&"8>1> e >& t`(   6  > "q"b8 t0(1> e (& t`(   !' t> B$&,` &,@& &`@  t &`, &`,`&`,Po '㿘@p㿘@T 㿘> e l "  , ,`@  2  "  2 , 㿘 ,`8 >`< "` 5 a>   >֒ad     `a.`@ 2`a>  >   .``Q `Q  $` ` > .`` `Q 㿘 ,` 4`2   @f @Ռ 㿘 ,` `~ "`   "8`  ` `> O"  > N#>֒a  # `@  2`b@ .`l 9> O"@ 6f .`$> N#, `QG `7 `> U p  > O">֒a  " `@ , 2``p@ .`9 > U p@ .`1 , $> O", `Q ,` ,Q $` ` ` .` .`"> N* c `P 0 @*`"@> O"*`@`P ,㿘 ,`A I`G "` @ `> #  > # `  `@ .``2`#쀦@ > # > #쀦@ >  #.``P `P  $` ` > .`c `P 㿘,` >Ӑ#*` €      x> !.`@`> @B!8h` ` `5 3 `@0 . ba) ' d$ "  @@0@  @  @@@   @  - "@> *`"(@H /f4'* ''@?> "#bL.`0  4   @! @ *@  $ @ 2s@> B$`c`* @c``@.@ > B`> "@b@< L, @@ 2> > @A!PH 0   > & `: ` *@ B <`2 > Bc`* @ ?#$2> @A]!x$`&2` ` B <`> BR#`@"@7o$@   @b" *"@2`"@" "`` "$`@ $@ *`2` > ""L:` > > "> #`#d"aؕ:a@B–n> > !@  J'> ""@`  !'`` `5> v &``  @ `  >  `" 2`` &`@@ZO @` >   `  @> #`> > !aؚa#\ @Bp$@?" 6 7o""*" 7o" 2#\*> `> B`&`> &: * R@@> @@"@> @@"XH 0 " 2` *B? <`$``B <`$@ $$H 0 㿘>  .`> ! @> " > B> ""L.` > "p@@Pc``& > `: * R+ > " * (  *@ H /f * ' c` A> h `b` `@`3 1 / - da( $& $ ," ( @@40@ 4 0@ < 8@4@@ D @@ L HT *`  c`> ""L.` > "@?* )c`> "@@?+ `( "$`44``  6 @!v @?B$@< H 00r7o"@ `> '>  2`"@AP@?耢`    7o""@`@ *"@6   4 * @ "3   $  3 2   $( > @?v# (@8  02    ,@(  0`B < 0 ``"B<  $` 6@@! @?`$@$ " & $ H 0> "D> W`&`> Bh8:`4&"D㿈%> 2P> B#`!> "`H"DO'> e`x#\  @=O> ""b@> > "D" P" *`@?! > '> b(#`$`(  *@  @a:  bDO!* @*`@H !$? 6$`` \``` `"3 ``  -0`"  -> "H )>  x"H @i  '>   @$,@P@@|@ N  @` x* ̖ x(( "  @ 4> > G#E#@4> > @#x># $!4> > 6#4 4> > / X- 4 04> >  !4> > !8!p @4> >  ! !4> > ""PL 8''  8 l > *   @`> #`p T >     Q> ""L .   @ @ ``  @$p> > "#XbL  !> . wp$@ #`@?Ɣp @  @`p@*? > # _pJ@ "*@ p  p@> B`(``7*(   . ,  @) ' @"!"" !$($    @(0㿘> ֬`?   @H /d * % `0 # !> `0@&`0 #h @% `0``0 &`0H 0&`D&`4&`,&`p `@-   "` &`0`*2 @ &`T &`<&`H`<6@> @='#p$> @=!#  $, @9k  `H@8 `0&`4(&`00@@H /d * % `0"  #> c @ `0b `0 &`0H 0@"`H@8ɔ?$`0h"`<`4 " `<`@@@> @<Ɛ#$ > @<#ؒ "  $ $`;`` B# ?` '`@   p` &d@H /d * % `0?# @&`0@"0 `0 @`0*@&`0@7H 0㿘>  @4u#@1 t!P#!& 㿘 \ @ͯ 0 @"> > @ "!H> "aT> "!P> !>  "aL >  ) : @D > 􀢠"a@:>  ) @֖l > "`:>  )X@ʔ > "cp!> #!> > #\ \` !H  @3 > > #\# `( H  @3 > > "<`8#\ P  @2 > > !X`@#\   @2 > > #t`H 0   @2#\> > #\"`X   @2 㿘>  X> #p @ *`  ! 2   +" 6> @;ǐ ``""`"@ X )  >  @; x )  "" $""" > "   42 H 2 4 > D> @@( "   4  8 2 4 > l> @( "     2  㿘 "!$> @;Y !$  @`> @;P O@  4> @;H  > e !X@39 >  @32#t $$ $ $ !$   I|  ,> ` ?& ,  $` > @;!!$ $` @ "@$`$`> l>  @* `$@" l @* @"@$`$`"% @Y !$@U  @` D"`D D @"!$` 2&!$@# &!$` & @` @"`D`$`& D 㿘 @` D"`D D @"!$` 2&!$@ &!$ 㿘  `"`x""`x`"  "` "@ ? ">  @4`#t> !X@4\㿘 H!$@` ` 2 T` &`? &`@% T !$@" L` 2 L 1?  ` "`? "`@  L 2!$㿘  L 1 2 @  @  @   @ 0 2L 1㿈 1` *`> h:@<  4*`> # t:`  4>  ,> !aƀ!p!> !"PƀN!>  "p ƀ !,>  ƀ" h@e d h@ d `>  d ƀ >  ؐ"#\   ȟƀ ́ 4" H4 " H4 "!$ "㿘@` 4@"!$\ 2!$  !$`   !$ `&㿘@` 4@"!$@ " !$!$`    !$ `   4& ` "`"  " , "" ` "`"  "㿘@`  R` &R @:`   Fp.  2& 㿘!$ 4 @ "  " 4   4 &㿘` @A  4"a$ "5  2a$. !$`  2( `,@"a$! a$ ` 2`4`4 " ` !$   㿘@ ` ` `  E ` E   E `"㿘@`?` ? @  ?"n  @?h       @& 2S @ @   @ @ 2=? @? @ ? @ @ ?&?   ? &  `@@  &" ", @2& , !$,㿘@ ` ` `  ET ` EL   EE `"㿘@`?` ? @  ?"[  @?U       @| 2@ @ @   @ @f 2*? @? @ ? @ @Q ??2& @o&" 2& , !$,㿈`@ ''` @2' `@  2 '? ?'?'o㿈`@ ''`@2' `@  2 '? ?'?'㿘`@`   @ 2 / @" @  @ @Ԓ  @ @ʒ 2 @"$ w?t $ $ @ $" `,!$`,㿘`@`2  @"  @@  @ð $" `,!$`,㿘`@`   @ 2 & @" @  @ @r  @ @h 2$ $ @ $" `,!$`,㿘`@`2  @"  @@E  @j $" `,!$`,㿘`@2 2@  @R&``C,  22` `, !$`,R` `(@ :    *   ` >2> @ 㿘>  @."<@> P &㿘@? "@> @0*"<㿘  D P &㿘ՠD P &㿘`  &`!$` ` C?@㿘   !$  @Bג` ?"  ,2  &  㿘@  )  "`M "'`I    2:N!9 )` !$ . )  * )N!& @ 2N! ) >  `&`> !H  )` `2 N!&  2  ) )?&  㿘@    "`R "-`N  , A`@D; ` !$0 1`  -``@. @ `"` >  `&`> !H ` ``2  `@`  2 `` 㿘 @ ` `` 4 &?Na6 .a  .a@ 㿈`B/  @@㿘`(     .`@    @  2   @(  s " u` ``  `"`@q & `> #` `` > #    > !>   :`? 4 >2  (>@4  ` @`>`2)@  " @42   ( >" "  >" "  > B#d8     @ @H  << 㿘@  *  `A  㿘H o4+@n   ȑH 0 @D@B 2 > %%&&&& t4`>  , @,`b2*@ *@ b 2`* @ *`B2*@ 8*@ Д @@&Д @@6`.  .`@c3`+ +` b 2**@C3`+ +`&  @ Д @@%А @˖@)%5`- @-`b2*@ *@ b 2`* @ *`B2*@ *@ɖ Д @Ö@&А @@&㿘@ `   M `  H`@ H@Д""?`"?/""`" ` " ?/"" `&"  `@"` 㿐#> ea0 !> > #!#\>  c   @*t  $a0 @+u AƔ  $ $ 㿘`? "`> @- ,,,,,,,,,,,, C A2 ,!$$  ; ,4>* "* @"% @ 0   " @  @"  @   㿐> #a> > #\ cH!4  @)ʘ 㿘>  @*ɐ  $A!4 $!0 $"`$ $0 0㿘 $!0`@& $㿘 $a0? "a0> & $@,Z 㿈@   $` ` `2`Z ` G,`@ `'@ $ $  a*@ 2$ a 2a  $ a "a   $ a `  @$ 2  , " ,  $  ,@"   $   2   $  `* $ ?B 2`  ?3 "@  `$(H*`"  ("?`" `,#`,`4"`, 2`,2`,`,(#`,8"8"@  "  " "`> _d2,, ", > #*` 2a`쀢` #`a#aa   a #aa  #a H> #  *``*!"!``*`㿘͐! ! $> # ! Aې * 8 &! *` " ! &! & *$@! `2!  $a $a$a$a ,*@& ,`P`"$`P " H   "` "` ? "`("?"H    "㿘 $?!!`$!$!@ 3> &!!(cP @ؘ  㿈 $! 2`!  $! ``!= *@ $ =ޔ   !  ! ?$!#@  ! $!$!$!$!  㿘`` / @ 1 2`$  2` ` @7 `    @㿘 $ > !HL4 $,"2R `@24/ " !$ 2 (  !4 $@,"2@)  ` 1? @ђ@24  㿘 I)  B  >   "  "   2 @@ @ 倦0    "  "   @|㿘  q @ 㿘    , @] @   @ $` xt@t't.`!嵘 , 2* ! "/$(!2+$( .`< "< 't` t!@! &!@! `* &! > #  `" $ !&!$ $(@㿘 ( ,> @/o#X@!:@ > # .`   ,(* !! !   N!  .! !$ `   *@& 쐊   , * *& & , 쀤` & 쀣 rN 1 nH/` /N 1  %> L  , UhP `"6 쀣`D`2C!`F 6!<* H& ,`  @07 ,4` +    H@& ,`` *& "! l  . 1`" l *& 쀢 @0  > V  "b! 2 2.!@%H 0㿘!  ,*@ +  ?  ? * !*@ $  ,("! , ((29 $4! #` @ = F  4`> #p@/!+ ,(2!!$ `2 H2! H4!<`,   @(H /m* .@ H 0k!2i!  2e! ,(2a!> @/#\! $ 㿘 ,*   H. 1@& ,>  `$> @-#` ?* *@$`. $@ (` @`  x't  @t a̘  @\0G> a> @-#H/` /  ?$a@a $a@ a * $a > # `"$a$a$H 0 `< "<$@"$('t` `  t㿘 4>  @-Òc 4> #@. 㿘 ,!>@  6!>> #& ,.`` $@ "a$ "`J㾀> # ',a c,!> #!4`߰ > B c`  ` *   @: @ Ͱ  D c`$`` > $` @. '\'X'|''X#@f! hc@4 <  ?@*@2 @@  ? @]@(>,4>c;'!H,@dH '@$`'$'(''` *' Ė+@' `+ + @{'԰ H -Ȁ 'Ƞ #\;`#h#l  И А @ْ .`> Б* #`Ȕ"` *  Ԙ #\#d#h#l @m4  #`#\#d#h#l   @Ѭ @ @ё "c > @n#㿘֒  N㿘@ &&  & ` >#d*` €& &  >  2 " 4a" "a  4  `2``"`@*@   "  @ 㿘  > @+   `>  `> @+ U Q` `?&?&8  "'@ "@   2@@88 "@0# 2@@: @&@`@"$`$@@"B &>` 2㿐` 2`> @+ (``4@> @+ @  2` &`&@  "  /8l   0*  `?$ $```B >`&`㿘 > @+Y ` 4< , $, < -,     @?*``@&&㿘    2&  `&  && " $  &" $ & $㿘 2 2@> @+ x``"`& `@"@ꢒ 㿘`  @  2 0` "`&  " € `ꀒ  2㿘  跔  2&  & > #!H`!H && "" "H㿘> #!H!H@  @ ` @@@2@`2> @*  "HH@ "` H@"@9 㿘H/` / > #!H  €  2 0> #!H!H    € 2 H 0(@4pXpdL0`ĄĠļŔHxƐˠ(<\PdˠˠHxǔǰ0DXl,DlɜɐɨȤ\xʰƬʔ<X|,@Xx̤̰TxL\ 8㿘> > #!$ ၘ > > "ؔ!$ y > >  !$ q X`   'Đ {` v @*6Ȱ oȒ?` #>"ē*` €>` # >#>8"p>b"> #$> #>G#>W H -` 6g  ?`  %>  7 3`@%E   ' 0$`#\``ğ``` @%7> #    ` `6. 㿈`\?`3>#*` € ?`@>"*` €> > Ð_w> > @ʰ> !>  > !> 5"|> 2"> /#d-> '" "Ԑ'@  "Ԁ 6 $"Ԁ@6$"`4  $" > "@! { x> v""> !Д@v! k h> f" 8!>  <'@ݘY$ <3T>  @G @"@ @88@ޒ3> "a     > $֘!> $Ϙ!> %Ș!> _"p> #!4e ` [ V > ! a@ư  G> ! a@"    #\> | > > X @# @cӚ> !> #!`> ""(@x @&q!> ""$@"$"$2 "$ 2 "$> Bc`* W"$T  @M> .!> .!> .!> #" @. @M% @Q @ @  @ؚ -㿘 \`?s ?` n> *` €> 5;> U5АL F> W> B ch* => B`> W  " 2* > B-#` @ 7> #!P> @' @  !>  > #*`T# @)+ >  @3  @= -㿘  @     `&@3  3 㿘'P` @     `&@P3m 㿘  @     `&@3R  3C 㿐''` @     `&@3. 㿐@#\㿐 #\@㿘\@ǐ `  @@  `,  `% ` "&@@   ?*?@2@@*&@2  2Ӕ/㿘@   @     &@2㿘  @ ` `&@2 2㿘` @   ` &@2㿘@  > "| ` *`" *  (&@`!> "&@"2g  "&&@   `72T 8   8&&@ > #'  ` `2n   > f > !HJ "G``-> *` €`4 "@a$   `, "1`a$ ` "+` l @` ` `   `,"2``@41!H aH1" cئ(``2N`1 > !T  $@ &  #8& c > @! 㿘&@!$` `  P&` &` &`  &` &` &` &` 3N 1  1 8  &a(&a0&a4&a8aP@a &b,   &  , @ @w&a( aP&a0 Ĕ &a4 &a82  &b, ?&  H "&b0 4&b0!$ &b4!$ 6b8 , ?` `?`l&b<`x " #&b@`|&bD&b<`  @ &b\!$ `2 &b\ `bH> ! @礔 `.bO`6bT&bP6bX6bVb`@皔 .b  @畐b.b    P>bX`'T `(  `` -   `1? ݰ `,b@ְ @Ұ ` !> B  "#` =?c?T  ''''''''ܒ` @!M ` `W  `N &?#`*  ,``*` '`w&@:u  0  u ?T''''''''` @! b "U#` '  ?#`'T" ''''''` @  F L  @`@@L 2`@ +0d ,@@&'',0R  ` &' `@   '08 @=` ؒ 㿘> "ؒ   > ` e >   '> # )> # (@̠ P Ⱂ !T "> ⪒ >   *"  * %!T$P%!T ޔ ` * .$P> !0 P$ (> ! @$ŔP@!T 0@"@ 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4 ٢`8 P*?"% >  > #!T 0# 8;  @;  H;  P#  T# $ X# ( \# , `# 0 d# 4  8ؖ m  㿘`"Ұ    > Ȱ  > İ !\   \> !4 $ @!(  83P& @@&  H @@ >    :@) 6@> !X!X`&@`&``&`` &``&` $&`a4a4 &@ &`  &` &` &`  &` &` &`&`> ! ! `&@`&``&`` &`&`  @I B@ ">   , 6 > 2 > * c8"*    0,  , `$ ,  $@屒 !(,   , "@*`` 0:  , "*  @嚒 $@@: "&.Ɛh  "㿘> > ` "@:`" :  6 65   -0)> & - , @    \>  @<  ?   㿘` > #aX> # !\2Ø P㿐  `3 > #Ő,`> ' # 4#  ?> #*`     0W`8 `'{ `&`8 LLXLL㿘#> ea4>`H@ޔ!> e!L>@ؒ`@a4@.!L㿘>  > H /m4* . "  "H 0 > ` > V> "b @M" @㿘> D>  T`t*>  p > > > > !8aH@  !H _ 1 ?` $   $ > #!`1 h 2 `G$ hH /m * . d h  d d* *  @* @$ h `$ d1i@ْ($ `@B !1>   !L 1 2,! ,  22@" ,!@Le !@LG,!0,!H 0  2 1@>> @ D>  @.㿘> D T*` *`@  `& `&  & ( 1@닒 "& ` ? & & `@㿘>   `@ @a W H/` /> `T > U> !`> U"H 0 H 0  > L 1 >   > @!> > #`H$ ,!$ l$   " ""$ p@`"  ,  ` $ ,(!@ !   l  @ , 1 2     , 1@ @"@ !> * @H 0 , d$ , { $ ,  @ @`@D # ̔ > #`@ p`* 2  쀢`"   ,(!@ Ґ   @ @`@2 $ դ  $?a *  ?  @ @`@  Տ  㿘H/` / l`N 1 @ ,@~ ,$& ,H 0㿘>  ` > !@ ߒ> @1!ؑH/` /> `T > U> !`> U"H 0 H 00D > L 1 >   > @!:> #`H,!$ l$ $   "  "#   , 1$@ "@ `@  @  @  @2 !  !> * @H 0Hl8> H  2 ` ""`"lH 㿘H/` /> > c H@ =   >  1? > @! l2($ l"`@$`L 1 2 ( , , , 1` $ @J:> > V"""a > @"``Ȕ0 2 H 0㿘?㿘>  H /m * . !@J ,! `@ @."`@H 0㿘> ր  > @#!H /m * . !@I,! `D @ "`DH 0㿐>  > #b > b(@I @ ?> X  X"@ `Đ" ` А"@ А"??/!`$`$`:( 2  8#`   P `L  @4 2 `  @(``B <`> B ?$```*"@X> ք    㿘H/` /N 1`>#*` €> @"8 ,( !<  * @&  , `. 1@IAH 0 ( , , & > "`0 > ! @  > > V"b" J! ( `  8  *!> @@ > > V "! 㿘 ` $ @8& `! 1!.!㿐N   n.> J"H` "HN@" L@`L@ 2`L@m> > @"P> @"x> @"> @"0n!Hwa0/"0,> > > > > "c (8@~#@ >  > > > > > > #\#Pc㐘#@lc> > > > > #c Ȗ@_#]%> H)> N1 JH>  > c   *@L4L@ n">  w a",6"&l2# @8+  ? 4l$ N1 "#\#\#\#` @,  H>  P@l2N1> !T 2N1㿐 >   > "Ԁ`> ```  &0 ` > ` "@ @ 0NH /i * * `` " ' "'Вb@ ?#` # > ##b?`## #`?/a  ###`> "X"X`#"X #`?/a  #"X#`H 0@& 㿈@   0*@.H /i * * >    ''H 0 *`" * `*''( 㿈! 2`(  @``#@''A 0  㿐@  2 >  '@"'``(~ p@(p  #@''Ԡ@Y ~ ` H /i * * >    ''H 0   $ > e> !d!  ?"  #" ` LH /i * * >    ''ܑH 0 "@'ܐ" 'Вb@ ?"" 'Ѐ'Вb@ ??Ѐ ''Ԑ*`" * `*'''  㿐@   @0@'ݔ   ``>  'Ӕ 㿈; 2'@ '  ` '  @ "`V  ` > `"`" 㿐  W@ '  O> #*"@ *`" *  * !d >  *@ *` @ㄒ @+S & H /i * * >  L> " L"`HH 0 ` !В"@@Ɛ'"@@X'`'J   㿈@ W H /i4@* *@ 3   ' ' ''쀣 1>    `&'0'' "@ " ' 'Вb@ ' ' * ''''H 0`& 㿈@ 8x ` &Ԕ  2n`  &`  a ]@ 2W @ P H /i4@* *@ -  @>  >     b? ''?/a ? $ @`& & & & @~@ * """"H 0 㿘   >  & G& ?/"?a  H /i * *      & @&  @ & &    @ 0@ $ @H 00H 00Á}x8   Є?  >  &"  6  "@ @" "    "  "  " " "  `" Є@@" "   H(> #h#lH h #`l" #dІ@;``@d` h   l"" #H(> #h#lH h #` l" #dІ@;`` ` h l##  "@ @   @4"@#> P P > P# >  X " " " 㿘  > @, > @'!Ho o >    ?&  & "@"   "` "& > `P`&& `""` H 0 H` `@ `@"`"``"` H> `> P(  > `P`  `  "`# "`2F`P8(   `P`  `  "`# "`8.`P8 (   `P`  `  "`# "`8`P0((   `P`  `  "`# "`P`P@ 㿘Ho o > PP@ >  P> > ( P`P-> %@#@P "` " "@ e !:` `*   ' 2`:` '*  `" # 4: *  ' 42: '* # "@ !4:` `*   ' 42`:` '*  " "@ !4:` `*   ' 42`:` '* "   ` #   H p@ Ho o PP@wP H 0 㿐$>  P&%>  P P `2'> !8' > <`" @  @<:2 㿘>  > @0!X> @-!hHo o> ǐ P>  P#?`H 0 㿘> > \ =b> #>!@L 1 㿘!> #!h > #$!h"!l㿘> #!h> #al!> #€!p> '%!p2 @>  \:`㿘!> #!h  > J \> #!h l㿐> #!h`? -   075> #p'q . !> #> # \> #alah€ &p!> #]!t 5> 05> \!t !> #!p`> #ahl> &!p2 @\:`㿘Q @Dm@㿘> !@>  > | | >  >  t> #x"`" t  㿘   @> #a  `> @b!V` `> > @[!V`@V!2  @ 2 `> @!В  > `"@;   " &   "&  & &   㿀''''耦` `  ` @ >  t' ,'"$  * 2  (*`: * @*``  2  V  2V   2> #!`耢 " >  > @ِ" @Ր"8㿘` `  ` @ >  t4*`$ %` * 2  ( `*`: * @*``  2  @ݒ T ` 2T` 2㿀> Rb'' ''''b> !xV* * @ 2V 㿘D @'"  !> #!ƀ * @S 㿘  > @D"  @ 㿘  `  ` ` @d `* "@V   V `  6 6 > `|&```&``""`@3`> > "@` > "`@` >  t"&  "  2 $V `@2 $V "6 V 2 $  6  $  뀢2@}㿘@ /`> @"   2> @ "@ƐV`  && ("& V` V` > @ &  *`    @ &   *` 2  V` & >  c @  (& $> @Ґ# ,  , @, .`@$.`$.` ѝ   &@ "> > #h#p> @#@*`@j@ !A $ * ` > #x@ & ,㿘  ?* 2   > @#  @  € - `> o #@l  ` `> `$2`@a`2`$> !x`"! 2$R  R @"2 R 2 $ R @2$ 怢 `"  "`> "   "@@ `@* "@>  @͒ @` 6`@@ 2 `   *`"` @ҡ $`$@ 㿘`  ``(  -   $`(€ 2$`(㿘`  ``(  -  ?$`(€  2$`(㿘 $ 2> > @Ȑ 0  > 2@`h2  Е  2"> @ " "  " "" 㿘>     $@` $`$ " € ( `2 㿘>  |` `$`   2`$㿘>  | #> ``$```0 \  p @` - 㿘`  `@ @.`@ 2 (  " @ ," ,㿘 ,?  & , ``@Ѹ 㿘@Ő (&> @ @X &>   & ""  $"`$G" $`@@&$"="`$$@ @ $ @ 02`T T&*$$2$$"`$$2$"`$$""`$ $@ @  2`T T&$$2$$"`$"$ (   @*`2 㿘 D? @2  ` `4  a> @`>"># 0,` :`> !> ! > ! !(` > !0 !8@ `% ` <`(@`,  `8@ܜ> @`8@0`,@܏`,@)> !X>  > > " 㿘 >  `>   "   (@Z  2 ( 㿘 ! ˜ @ , $ , 㿘 ,   (  ߐ!&  "ڔ  `& 2 > @!h@ԫ! @Ԩ"H /i * * >   & P & TH 0 &> & "@"> >   ""㿘 \  Y `"  "`> "  "> >  ?" "> @!0"0H(> "X"\H 㿈 0??& 0>  (@%!H /i * * >    ''H 0  X"@' \"'Вb@ ?? ` d & ` & d?/a  & `& d`& X & \ H 8@ >`CB> H> 8 @ 얂B> @@ 㿘>     㿘>     H(  :`@:`8:`HH(> "`P"`TH "``"`dH > )> d"# '@  "!? @4  `? 4`  . * > @n!4` `*` * " > O* b'>    "> ""@Xe   `e@ "> ""0@  - ` > @"`@ ">  " > @ 2 @ > !P  " > @">` > "㿘`, "  J!     |Q`$  , tt  "  $"`$㿘> eah > e"p "ahp` > @2`@&"`@pp & p "`"p& 㿐!> e!l  > >  b#\   @  $!l㿘> e!p " @2 2  2 㿘> e!p @  㿘@ \`> @א" > #@y> @ː#P`+ > @Đ#p  `> @# @o& ( 0& $`&    " " ' `" &   u 2&  & && & &  &  &   & I㿘 2 > @v#؀ " `"`"@@   ` "`  "  㿘      @ 9"'` '`  '@ "  & :'`  + `2@'  @ "" ' `""`"@@ @0 '` '` '@" ''`㿘 > @ # > ! @ > !@  P:  > ! p@> !@ ې @ * (> ! @z > !!@u> !@ ǐ!8@ 2 > !@j!h4 `* `&> !`     &  ! p " @C # ``(` ; 㿘\'H `> !@ !d 2 > !@ y!H *   > ! "@ > !H"H@ > !@ _"H& @ > !"@> !@ P"`> !@ K# @: > !#0@> !@ >#x@ H> !@#  "?         > !#@Ș> "@  (   *    " S? L 75`%?@  "  `  ?@ @    ` @8 ? `@ _`#`{" x :  "  H? ? :8`'@  "  `  ?@     `? @`? @ `$ `-" * ` `    &  !> ! ) "*H@  #d "㿘 > "@ ? ` @  @@3> " @ ږ> "@ + :  @%> " @ ̖> "@  2  @q 2 j K @ ; C@2  2 `""`"@@ >` 2!@  2@  ,@   $` $` "  $@" "$`   @  @Đ> "!@ l> "@ !0"  "`@[  " ?& _ 㿘  * 2 !> !`"`'   & ` ! ! Z 20  뀎` `"  "` !"@H /f  .` * ' .`>  @f `H 0  & 㿘 `>` &`  &` &@ " &  '&`H /f * ' >  @H 0  &` &@ " &  &`    & 0H /f * ' >  @’H 0㿘 2> "@ !P> " > " !p @ a   !> " !@   2 㿘`%`a> "         @΅ a& & > > "a"> ጀ   ጐ > > ᘁ 㿘> ! H/` /  @$%> '> " H 0E #`$! U "  H 002 @‎H 0> a ?"ah  `$  @&`$ ``     " 8㿘H/` /`> !``  > H 0  @VaH 0  R > > #> !"8" ᠀  `2``"`H  <`` " ``@ 㿘> !`> @!#> a a   ٔ a > zaa ?$a   }@"0 ~@w@<?0>@; v@(?06H>    H`6""> @"> ᘄ ᘄ > a"` "` "`> " 㿘` 2 @ Ā2 @> "@ b"  8@:> "@ ["@&  @ 8" & @@``"`& `@ "@ &@" &&"&``@@ d 2 4``"``"```"@H/ /> e!t@ےH 0 4 ? `& 4 &  `"& ` "@& 㿐\ 2 > #!     > B#`$  $ $ $   M$  ?`$ $ " ` ( @@) @  > ""`@ג& & &  & & > ? & \& H& 4& (& ,& 0& d& `& & & P& @& D& & & & & & & " & L> "@"  & : @ %> e & d & #> #  T&  #> # T  "?@z&@u& $ '@Ӓ  & 8> "> "> ""b@q!T@Ð'Ot& & & & & & & & & & & & h` 2& > "c( (   W#\> e> ""\c0#\ L  M &a& "@"& T & X "@$ 㿘 T`" P X"`X X"` X T"@  !> e@6   D`" > "@)#8  ``"  "`> #"! ""X"$"X㿘 ܀ "& > " \@#`& ܁㿘` > #" `> "c@3 >  `2 `D`"`D> "`\@#`D`H@> "`\@#2!``܀ `"`€`D`H@ `" "S``` J`` E> "`c@ @` 2R `@" `\> "@ c#> #@ @  `d `H/ /> e!tH 0   @` 2`D`2```  z$``$```\  D`h`D@}` $` 2`@> #`\@i 0 2 `\> # P@  > #@^ 7"" > #`\  @S` "`$   "@`@`D $`@$`D `2  `Ā 2?> #@9 $`   `"$ `8"> #`\@* 耢` "`$`  "@$` $ ` "@$` ` "$`  "$```@ `( $`@㿘 P D` @ \> #@!> #@!0 d "  `2 *  l` ``  ``2` 7> # \@ِ!@b&@  &` " # #  &` #   @ D` ?& & @& D&  `  ?& ` ` Đ & `0` `2C 8  4  0 &  P `" - 0K` "`&  "@# #  "@& H /i * * >   #  # $H 0   ""&   "& ?@` "`&  " # " & &  # & 㿘C㿘 8@@ч@у :@   d  @H/ /> e!t H 0 ` `@ ,@  , `& & ,ʲ , 0@ `& 0 㿘 P` ? $> # \@!h d 2$ ` 3 *  l` & P` 3 *  l"` P` 3 * " l P` 3 *  l&  & " & &  &&& &&& &$  Ĕ   & Ę@ & &   8 @ & @7"> "3> "> #"# Ⱂb@$w  #  "& #   "&  4   & 4& 㿘 @ (@7 @<   d  @H/ /> e!tW H 0 ` 2 `@L  L  @  ( & 㿘` & ( 8@x 8@t 8& ,& , @ (@㿘`  8@` 8@\ 8& 0& 0㿘 D@  & & & H& `&   8@B 8@> 8& 0& 0㿀 ܀ € '' %> 퀤 @6 H / * *  ''H 0  4 4 ,@.Ф"@'> #  2 " ' $" `'@?ᬀ@&  @ 8 (" .  4 ,@耢` 2 ` "`' "@  d 2 `"  "`  "@H > e !tH 0耤 2 㿘 H /f> e* '> eX  > #!"XX "XL H 0㿘H &* @  H 0㿘@ *   :  l"  p"  c" `@*  ` \> # !  $ƀ d P> #ƀ"  (> # ,"0 0ƀ 4 8> # @"h Dƀ H > # "ƀ  > # " ƀ Ā 3   > #ƀ# " '> #   ƀ $ `7"#> #@c8ƀ``2@ 2   2 > #ƀ#P > #ƀ#h  `> #ƀ#x d``> #ƀ#`.  *+> #)> #  ƀc ,# 0 4ƀ 8  "'> #%> $ ƀ  .`@`ƀ`$.` 2  2 㿐 `T +> $ P ` @   d `> $ @`\``/` 3 7"> $)> $ `"``@` ` \@#\> $@4    ``@֒#\`> $`\ @    զ@`2 P "  " " " " $" (" " " " ," 0" 4" 8"`" ` "`㿘 @J` "`$  "㿘 2' , "  0 2$ 2 0 $ 0 @ < ( 6 ~1  , 8 $ ,$ 8  > "> "> $"b@&U ?> "> "> $"b0@&V* "  2 " > "> "> $"bH@&Y "$ 㿘  2< 8     23&  2 H /f * ' > e"\r H 0  @703@ő L 4`& 4$ $  "@  & &  8 & 8 ` `> "> "> $"bh@8&e*`$  @ " "@ > "> "> $"b@)&h  "& 㿘 $"  (€ ޒ㿘  m  <%> "'> " 8?& 8   > $@&U?> $0@&V* $   `2" > $H@&Y  2 $ "&  $"  (€ ƀ  2 8`") 4?& 4` "`&  " "& H /f * ' > e"\vH 0 2 㿘>< 㿘>P 㿐   '  `_ `[ 2Y 2V  `2Q "N  2J 2G  H /f * ' > #!L  ' H 0   2!     0 0@ \   & \-㿘 P@€ 2-` ܀"&  €@€ 0H /f * ' @C H p@ 2@ 㿘 P €H /f4 * '    H 00  "  `  ?& `⊐ T 2 `  ?$ H 0㿘  T`X"`X& XT"@"T T"X "&   &T   &  㿘> "b@> C6`@ 㿘> "b@@㿘6`> #" ``> $a@,C > 2cP> C8@y㿘> #" `$> 2> $a@,1 > 2cP@u{ { u{ { { { { { uu{ uu{ vLvTvTvTvTvTvTvTvTvTq{ { { { { { { { { v{ { { { { { { { { { w{ { { { { x{ { y{ { { { { { { { { qvv{ { { vv{ { v{ w8wxvtLxH{ x{ { y{ t㿘> $!@ 㿘> $b0@S 㿘> 2##> a@?H'H 'L'P'T'X ! `!> e#@"@۔#@$a> $@"H@> $@"P> #b @`.6@.Z㿘> $"X@x> #b    > $ "x> $"x6ٞ6@` 㿘'L'P'T'XH/` /@   @LH 0> !`L  @ x> #'  <@J > $ @UO؀`  >L @;  L   > @2 c > $"㿘'H'L'P'T'XH/ /   @SHH 0> !`H  @C ^ 㿘> !`> N""܀`  `> N"܀ ````@:s  ` `> Nb܀""b܀`- + ) ( > !`# > !* `  " `"@ &"   "" `> N"܀` ` `> #"@`5^㿘>  'H'L'P'T'X`,  a$  `   @H ,"  !$ `" @"@!$ 㿘  @? "@> P#t㿘'L'P'T'X       @5    @L㿘'L'P'T'X  @qL㿘> !'H`'L'P'T'X    @^H㿘!> #" 'H'L'P'T'X$"  @MH> !`2$"b$"㿘!> #" $" @8 > !`2$"M$"㿐?'P'T'X`'' (@P`*㿐?`'' (@ `*0> # '''`'' `: `   2.` >  . M`%`2* l ''? M`Zh>"*` €`2  ? ?   ? ?L@  > $  > $ m O2A> $ aO؀ `L `   2.` >  L.5L 2L EL@? * :   6 < ,`   2.` >  L@. L@   2.` ޢ` L@.`L@ 逧` L@ 4`L@ `I >`  = 2;.` > < Ҕ7 `> a8 !   ?    @?* : ?: 8` - -@ `> $"'  x ?     @?* : ?:   2  `` -`" M  ? ' '  +M`*  ?&ܢ?MЀ   , * ?РMЀ &ʢ?ɒĨ  , * ?РMЀ ' @M l2   ?/     ?    @?* : ?:  ` -` > !8   x u o  ?> f:  @ ?_" ?Z2    ? 2   @  ? ? ^  ?> $b '  S x ?`> $"  @ɔ "''@ȡ'    ? 2   @  ? ? # > $"> $" ' ?  2   @  ? ?   2  `' ?`"R逢 ".  5,A> $ 4, 40 - 806 03- @J `0- @\  8' 8'0-,4   4 - "'@  '$ '` /' @ & +` ` 2`  '# ? `  2.` ֐ .  ?< `   +` .3ؔ/ + 0`   2.` >   . ` 2.`  `.`2!# ? 0`  2.` t . 0 ?"@ ? 0`  2.` U . 0l ?'M `  2.` 6 ?.N??' "@ ? `   2.`  . , ? `2&> # > $n#㿘` @@`% 2 ]  H /m * . `"` " @"`"H 0 㿘   @ &@   @… * 2`      $  , & ,> V "b㿐 , +) ` @ #&@   @a * 2`@   ` Ԕ   7є  <P`<`0 @P`pxxxxxxxxxxxxxxxxxxxxxxxxxxx4 8xxxxxxxxx$x4㿘> x + > #> .((S7> # #P4P& .`(@2> #"b .`(x " $> # "!"㿘!> #"$  > #"( 2 "$> % @> % 0$"$"$,`:` `q$"$`Q > #,> #4> #@"0> `( "0㿘#> > %@ (a@œa1> #"0> #b4 !> "@Ňa(a@Ła"0@&"0> #> #04 >  ( > #"","0㿘` > #" " > %4 > %  > %> %W P0> %S H0P X㿘. > . @> *`!x@ > %@ `V `*`> ! €> %V 3 H0 > %/ h0> %+ p0> %' x㿘> #b.  >  > #b*> % 0y*b:  > c0"& *`> "*`>  #4 > %  0]": $. > % 0T@> *`!x@> % > %ߐ V? > %א!V?"T #> %ϐaV | V?T   4> %> %!> %! > c* R  > #X  '> %V(*  ;V? > %!0㿘N -    N 02% N x  X2   `     ɠ    *:   2Ѐ  ? &@ 㿘     `O* Є 8O /`8 (. (> а`` ?O O "  "  " O?#66 㿘N?   +> #J@    `,`b :  4- *> : cX,`: @2 `@ĝ "`* b :`@ - : ? &@?㿐%>  )> %'> %!@X@H (@LJ@ "` "` "`J@   > % &@!P   ג㿘> #" 4> #. j< %> %#> %h@ax, :``y`Y`n`N, :  y YȐ cՐ. > ax*  `   %>    "`$`" `$@ *R@? @ `R@?, r  > %8!0 ےR@? > #X T* \ @T?`> %!R  , @ %  > % >> %!ܐ0T" > %!0K> #0 4D> %. ɑ< %> %#> %h@ax, :``y`Y`n`N, :  y Y'' c4!> & #0*`> %@! & *`$ > &?b* @> %!>6 Ё㿘> #" 7 . > * ax R` "   "  > %4 > % 2` 2` > %!> % . 3:  > %z! > %ϐ dܐ> %o"0> #" > > %"e0#0  > %& ?> b* @> %"8U0R Ё㿘> #" 7 . > * ax R` "   "  > % " > %2` 2` -!> %) . ڑ:  > %!! > %v e> %"`0> #" > > %"p 0#0  > %& ?> b* @> %"0 Ё㿘> %"#> #b8J@ j b8,@@@)> %`  %> %ݐ`` b8, @ ?* : `2?*`> !0 €> %ǐ"08> %Ð# 04> %#H00> %#x0,> %#0(> %#0$> %#0 > & 0> & 80> & `0> & 0> & 0 > & 0> &!0> &!H!xb8,J@b8㿘> # ""$%> ##> , : S c0 ? ?$$㿘> # ""$ #> ##X,   > &Z!hb ? > ?$$㿘> #"> #   Q"b$> > #ax* V @ > . #:` ,T/ `2@_!@@$ W. :``e `s`d > &!p > &!p c < :   T?ˢ` "$?'b$㿐L@?  -> #L@    2`L@,L@` "`` "`` "` :  4-`*> : cX,: @2 @y "*  :`@ -`: ?2L@> &!0     > %M s0!P㿘/ ?  c > #""$> !x!x`Y%> .:   @`2L $ @6 2D $.:    T `` 25 $T 21 $T  2+ $ *?  d e c > &!p f> &!p $ $  $,`:  $3?  $ `0 @6A? .> !> #: b",`@ݐ -`+0?  d"" e c "> & f"> &q0"0U 0* ӑ: 0!? `0@ˑ,`?  c> #?"b$㿐NN    2 NN "  "  " N > &Ð!0*  > %.`.: :l0!P㿐.`?'> > >`!|' )> &!@ (LL "  "  " L : 2"L> #"􀢀 > % -`* * @@8  `a> &q!` ' ? q  ј f ` Q> %Z!P` `h@_ $> #"> #b   > &B"0=.:  > > &9" 04!x `  @1`2 $@ " $ 2 > &> &"P0"p aà?$* *x`> &` "' '`'` '`'`'`'`''77ڒ i=̀?@ aM.J: ,G: Ed" !̑+` * > ax $  ?ܚ?## ?䀠 ?# ?# # ??# ?# ?# # ?>  (Ԓ@Иx*`# ؔ@ "܀"" """"" >   R   2 > "܀`> ̖"ؚ  R  @  2 "x %"` ? @o`2$@# 2 $V  2$V4$ 2x@   ? @K`2$@ 2 $V  2$V4$ 2x !@(`2$@ܔ 2$V  2$V 66 $ 2`* : 㿐N  /> #N "  " N - N    2  8J@ ? @2  @ "  J`NN "  "  "  M@ T > &"O *`8 ?* : `2A*`> ! €N > &"7  > %> #-""(N > &#% 9 > %W+W N ݒ > % ` `> &> #""> &a# N iÒ   > %Wm c@P 0N %8 V dӰ  ʰ ޖ > %WG dN > &#@  . e u   > %W eN > &#( W W  d> %W fHWu  0qN U> %N 0j$ qR?0eN \ 0^Ґ[ N ! 9> %N#>  -%> &$`  *`:   2 NN "  " N   `"  t``  ``` {!P > #! `?"!> &#> &#> &j# > &e# 㿘M#> &> &\#> aXc@ ( O > &K#    N - 2  *  > N(#2  * ( > O("> Up2`6?> Ul6?> U|*? @ `2 ?@ (@* ?> O2` > U!? @ `2 ?@  (@* @l 6?> U|*"? *?㿐@ ? " `  `0 "`0`#\`@  hВ ?'''''쀧 '4    @`2''  耢 ?  #2   `  &  \ Șy \"0,?`&0}0㿐@ ْ " `  `0 "`0`#\`@  8/    $    _  ''''' N'   '  `=     @`2   Nؔ  耢 ?  # 耤$     \"ْ 0,?`&00㿐@ C " `  `0 "`0`#\`@  h '''''''쀧 ':    @`2''  耢 ?  #  2 o  `  &  \ Șv \"0,?`&0z0㿐@ ֒ " `  `0 "`0`#\`@  8/    $  ~  f   '''''| T'   '  `C     @`2   Jؔ  耢 ?  #  ֒ 耤$    ֒ \"ϒ 0,?`&0ݐ0>  #@'3    2`b b> B` @ ?* ` @  * #`,2` Ű  0 $ 0   Δ p `Ҕ 2 0 @   `$@ b|"9@"{"[T m b}b~2f @ 'l    ?4    b~le@ 'l  @  ?4    b}lQ'lT    ( "<  "@ `A"D   'l 2!$5  'l   `vl) 2  ( `<!$@ `w@ $@  2  0`: 0 ,?`$ 0 0`Ғ  > &K#p`@ 85 ,,@,`  @ђ,-   ''''''@#xxx''?''`  2`,` ה 2`,` Δ 2|`,` 2ВĔ  2r`,Ҵ l H /i * * >  А  ?А @ 'Ѐ '?/a  ?БH 0%>  %> `,<@%`,@k 29`, 25`,` Ю $,`,Ho o`,@ < H 0`,%`,> > '"8!7 H 0 "`,`,? ?%`,  #" 2``" `E 2``< 2` `3 2耢В 㿘'D  'T 6 *   6<> #" -4* %@,+ 2 02  $ 0 ` D  4`*  `-  & 0 ,?`$ 0̩ 0Q " ?@&Ց- &Α4@T " 㿘@ 4 "&@E " &@ l> "8@2&@` 6`㿘 4  > b<  "b<> 6 f"8$ #&H/` /l> "8@2 ,J1  0ΐ 0 @ ?",H 0㿐  'I ,`2 < 2 0 2`1 $ 0 > #"> #"̨  T`@ `  "  `` @4`  0 ,?`$ 0 0 &,&p`` >  a 8 , `   @  @ `2`@  <#@q* "**% *"@ *`@ *`?ߐЀ g H /i * * >  А  ?А @ 'Ѐ '?/a  ?БH 0/>  /> ,<`@$,; 24,"ж $,,Ho o,@ < H 0,$,> > '"8!e H 0 ",,? ?$,  #" @y 2@ 㿈!>  o"D@n j"D@i G 2 > #2` ""`"(& 2.2 2` " "`(&$`@$ @, ?",`0?"`0`, `0, ?",`0?"`0`,  ِ`0   @`@㿘> 2cP@ & > '  > f @ "@㿘&  4& & && & D& @@=& H 8  4& 0& (& ,& $@ #& <㿘( D! #> '"$ D!`0 ȥ   D!" D !$ D z H O$ H  $ $ " $$ $ @ V  ?$ DdO D ~b$ D |$ DY & # D> ' $ D8! d 2D H D!#> '"$ D!`0 T 2  D!a$ D 2* H" D" D  " @ 8 @ 8   a "  D ~b$ D |$ D  2 H@Ӛ $ H?  $ H D  ?$ D !T@8   D  ?$ D " ! D @ ?$ Dj  D   <#@ 5   㿘 ( @   D "T  ##> b@ 4   8  2  ` > fa@> 2" "a@P @缔 b@@$ `$ $ $$ $b@  2( H D!#> '"$ D!`0 ǣ 2  D!$ D  D ~b$ D |$ Dr H $ H  "@@ $ `u s %> '"$ D!0 l   D!$ D 2 H "@@(  D ~b$ D |$ D7}@ "@ @4  p 2, D@    " > 'f @$^ 2 D   $ $@"$ > 'R p  $> 'I  D ~b$ D |$ D 2@ H5 $ D  3 # D @ ?$ Dg  D   <#@ 2  " D  D> ' $ D! ۘ 2 H D 2    D H  H?  $ H D  ?$ DȦ   D  ?$ Dș    " 2@ ,  D @ ?$ D   D   <#@ Ԓ    }@  ( ~@ @ 0@ @ 0D D    << "㿘 (`  @``"# D3  /  +  D '0"$  D 2   " !  D @& D 2  "  D  x  D @$ D 㿘`(@ `6`  &`@    @ C B?@'>`0>`8 $&` (*`" *  * &` ,&`  0*" *  * &`$ 4&`( 8*" *  * &`,``&` ``&`㿘 (@ $ (㿘 f D @ ?& D=  D   <#@   " HÒ  H !> 'ǜ D`& D   Ŭ  H` @ "   D @ ?$ D  D   <#@ ڒ  " D  D`o$ D$ @ ` (> f> b@?"b@> fa@> 2" "a@P @q > "DY`4(R` @ > #"`8"` " > # "`8 "`"   4(R `@ `2 "``2`  `2``"` 4(@" D2  `" `D  2     4(@`" `D" @  2 "    ` "   㿐> #a> > '#\"D` L   ֨ڰڰ$|وؐHڰڰڰڰڰڰڰڰڰڰڰڰڰڰڰڰڰڰڰڰ84|@@P@@P@@ը@@PPPPPPPPPPPPPPPPPPPP@@@@X@  9` 2 ,X  , P #@`#1>5 *` € 44@'"@ (=  `! , 4 2&> "Ԁ$&! (  H L 1 2&0&@`#  >5 *` € , ( H$ ,4$ X`  '` :Є@   ?'''''''' @؀`&` 4  ĘВ :̖ '''?'''쀠' 0 0' ' @Ŗ̰" `'  0`     $  , 2`@W``" @8 = ?)$ `     $  , 2 @<  H?$ `4 X "  ,O > #Đ ,*@$ ,$ XL 1 2` `14!<\ `Y LU ?R$  &`  , H($ ,`4@$ X &`  @ `    P?@ ?'''''' @$ @ 2` Ѐ   !?@ ?'''''' @]> 'l 㿘 (   @<Ț 㿘 (   @:} 㿘c  (J "7cE2I  "~ ""}2=  ##26  ! >3 E    x" ` x = 3 3 3 x1  L # < # @`$# D <  "  2  " i r   @   ` @   @㿘 (H /``* !`  ``"H H0Z" |0W L \@   V 2  8 BH 0F  "@  " 4      `  8  H 0#    6   @ H 0  l x 6 xH 0 㿘 (@" `06` `  @ 㿘 (  @8X$ (㿘.   `@ 02 ``@p`  ``@p@    2@ 2` 2` 2` 2` 2`  "` "@ "` "` "`  2` 2` "`㿘> !X    > *X`2*X "> ' #@$> > '! #,  > '!@ X ?422@ `X`> 2c(<> "c0> 'Ő!P`  >    "`"" ` `  > <> c8`"4> 'ᨐ!`X  "`(2``\㿘  (> > > > 'V > !X` > p#,* (02  ` 0( 06 `&6 `"6   2V V ?"c4> 'g!& c4㿘 &`  L&` `D&` $ &` (&`  ,&`$ 0&`( 4&`, 8&`0 <&`4 @&`8 D&`< H&`@8 ?@c ``> !X  6 * * > " c8*  (`"~ V@  @2x "4 0n\ 0k e `" `  $" $ $ $d@`2` " $> '! > '!›$ (A  =Δ \ 7 (@X` X-  @8' ?$ $ >   a  4 $ ($ Dg!   \  "&㿘`  @`) > aX  . > * c8"*  (`"  2  ` &&M  !. "@ E"A  > aX . > * c8"*  (`2  "2  2$ & ?$ !$ >  $  * $ 4 4 $ $ $ $ $$ ,$ ($ 0$ 4$ <`$ D ?#*`@& 㿘%?@` ``> aX  * * > " c8* `(`  V@` @    @H`( 8 `` "  @  @  > c0@  > c4   h  b4` > '!  ` 4` ư `( ʖ b"0> '߿"@$> '߹" 4> '߳"@2b> '߭"`4`? 44 4`)1> '!> '0> ߜ"P((ߖ"> 'ߑ"X  &> > '߉"#,*  `0(#03 4 i  S   ِ`?! @;4`' /> -> '+> 'X  +`: 4W耦@Rb%@@; %> #,.` +`: ?"`> ':#?a`( 4`( ` 2`$`  #`?! @4`ΐ0"$``> "`  `$ `$` $`$4$`, $`4'㿘 ?@c` ``}`> !X  ɰ * * > " c8* `(`V@` @ ! ` A @" `")$` 1$`> '#0` * > '   @4 @  "`   "$`ޡP $`2 $`> 'ޚ#p 2  0> '! U ` `(  ?V@c` S  > ` `$" $` $`$ 4$`0$`< @8 \    09 #ǐ03 *7> 5> '/> '!X%@  *: 4F@A@0 > #,.`  ݐ'@ Ll< T l   \    ؝㿐!> #!> > '#\ 4c @   > > '#\ c #L d !> !4  ֑* !4> "0@*`!4  ˑ* !4> "H@*`> "#D㿘> #> @ a< ( ׌L#@?"%#@!> "@#Lɒ  #>  #LcD    2  cD& &6 $cD㿘@2R> #D2&@2 R "m  2&@f R @O  2E`R2A` 222R K *`:  %2> cD 2> "cD1> #`> 1> #``@ 2@`2"@> 'V#Ȑ#L  #@?&#@@ *  #  #  @  *`:   * `2 22"  㿘> #D I%> #T   @(  *`" S  *`: @ 4 *  "  ?"  *`: `@ݘ *` 2D$D$@> ֟#L@?$@ 2T 㿘 &`  06` `(&` $ &` (&`  ,!&`$P ?@c ``` > !@ 6 >  0,    V@  @2    >;#Г+  €R > #$#<  " $ ,##<> B 40"@8 n  h @ ?$ Ė$ >   a  4 $ (! L  L @! `&  @6 ,` * @`! `&  @6 ,` * @`ܔ! `&  @6 ,` * w@ɔ! s  m  ` @c.` @   ` 0Y! U`&S  @6O ,` * @E`  A`?  @;ǔ  5,` * 2!| &貔     ` @ .`  @袔  ` ?0Z   "&㿘  @` `"$ > !4 $ > ##<"@ >   { 4,,   U@.$` 1> a4 @  > `0 `@ 0.`@ 4 4  ! _` &  &U &F> P  ""U > !4 @ >  0 " 4 `@ .`@ 2`4@2$`/ > $@ !$`.`$`?H$` 4` >  * 2 4`4`$` >  0$`(.`"> #c<"c<>  0.` ?#@*`@&  ` ` >  4Ԟ㿐 ?`c@'L  @ '> !4 @ 6" >  0.` ` W@` @  t    - ,   `睒 0֐B  >  #9    7  `@*` `* U ` # * `2  2 `2 @ ` 2   2 @2 `@ Ϛ`@G`$* @`*`   " 2 (U 2  4  4> `0> '!$  '> `0` ?W@c` "U t  2 ?4 ?4 K @X5 "?`T  : V 2 ,`* '> ' "T   @ "? @`* @`*` @  " 2 n 0!`@   @`*` `*  4$@ V > `0fL "㿘> #D#D I+>  2 BT  6)> # @63%> ,`  0(V `V > (و `&`> (ف 8 + @ *  @@ 2 @ *` 2 0(@T `@԰ cL$#@?%#@㿐` ` 4 `6 ?`>;#*` €3> a4' a4@?#@ *`   %> a40y*#> a4 "@* @ٓ*`  * a4cHe*a4"@* @Ǔ*`0 cH $0$cHf&a4> !4 'G Z  V> R$ > !4 '3 F  B* >$ > !4 ' 2 . *$ > !4 '   @`4$   >  !H> !L> !P> !T - $ l @ @  x   8> ( 6?> (("2 (?? > ( > (*: `     㿘#> Bc` 4`  @, > !,`> `> !4  "@?#!" 㿘`?#@ > !(@ 6( '> (,` > B #d  @@B* ?&` $>  *`$ ,  4 $ "  (> "!"@ 㿘  `! @`?" `  ?"@@2 "    㿈  ` !> !   *      $  ?$`` " @G 2`c @!!c X  `?   ``?2 C > B#`  ` .  ``#`  @?@2( '@䈒'4@, #`#\  @ > $@@ $` 4$$ 4$$(&`  @ 2`T `8Q >A"*` €! 2D`+ 8 = ; 24` 8 2-?& ̖& >   a  6 & 0 2 & V $"`6 @?# @> > "!(*`"  㿘> a(. @ ``"` @ ` && ? #*`@'  㿘> !  `  +>  a  > B c`)> ,: !  $@ @?%a #> %! `Λa, >  Εa,?a,F # a : !" %a d%!> !    @ >  8+> 7> a(` `@ ,``2`  @ a(> (a X  ` #! > a(*  8+> 7> ?#! 8+> 7> a(,`"@ @9$ 8 ,`$$  ?a$?$ 4 $   * 3 4 $ ` @ $  4*`$ 4 $$ $ ,$ (@ $ 4$ 0'@ 㿘`@` !@ `"  6 #㿘 `2@'&` ,   А&` ?@ `> ?!(c? * @"@$ 2$@ 㿘  @  ?`@  U & 㿐> #a#\> > ( `x !,#>  <̟ a    *  > "(@X*`   v*  > "$@M*`> B#`ba > > > $a "a" "㿘 &` &` &` $6` (&`  ,&`$ 0&`( 4K&`,㿐` `4 `6 ?`>A"*` €!> !  > B`! !  *   : 4#  > !  ' { @w`u $ r > ! `'o f`@b]?#@\ *`  %> `(Z*#> ` "@* @*`  ؑ* `a$F*`"@* @*`( a$ $($a$+&`> !  '(  @` $ > !  '    6$   - % % %\ %p % % % $8 $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $\ $P $@ $X $H L| L L L L L L Y Y Y0 YD Yh㿘H /e * & `p &`l &`p`@+ &`t`p =&`pH 0 㿘> Nb܀""bܐ@  & x | ` 6 @? "@>  |#t& p& | 㿘`l *`O/@`(" `H /e4* &@ @ ߐH 0a > "(`DB:"(` &`D> "`$B:"`&`$> "0?`B :"07` @ . 22W @  `x` @2*`p" `!@. ! "!@&!  ( 퀌@`@"`p@`p  2?h2`*&`p!d=` 2  `` @ ^ @`p@ s`p &`p ` ! @`*@&`@  @ Z``( "`@ `&``5 2  ` 2 `@ @ 6   2 `x  `@ђ @ `x b `p* 2 " `p2 `n> O* * " b* `&`p@ € 0{"e`pw  2h`  2W`p2  `2`@2 `(2` @@'*?`p( ( 7&`p ) ! '" `  ^" ~  | { } \2?(&`p? ( 2  " ` " `p@a`@ `p2/  +`V``@` `"`p@I`@ ` `p@ {` @ v``"6`@`6``p>*@&`p 2B  >d< b`@ k@  ?"`p@ _@?  > (   @@ M@?   ` @@`p 2  d" @ ؐ`p 2` d` `xS @2v`p@ {r`p``( # V``H 6d`p @w_`p@ [`p`@b S  @ @ ߒK`p   2`ހd  6`@ƒ`(@  `p`ޒ`*`:  6``6``p@*@&`p /@5V`ܐ@  2`p `"`pV`ܐ" 8  $ `p @?  `p! 2`   ` `p* &`&`p@ސ㿘` 2 > "  `d``B ;"  &`d`H@ ۰? <  9 `5 `ܔ   "$ H /e * & > (`H@]!> b &`d > B;b &`dH 0`܀6`?  2?  ` > "  `d``B ;"   &`d @`H " 6` 6`܀ ` 2 ` ?  4? 1@`@.@?`>E!*` €  ' ! ^ ( ) \? @> b  \`dB:b  &`d@C`H =`@ > V`܀ "2?> "  `d``B ;"  &`d@&`H  > (  `?`V`>E!*` €4 6`` " 6`  6`ܰ?0 `@#`}@? ] r@<#> ``^@F!> # \`{@Y`z+@@+#> ``@%`e@ `u@#>  ` @ B` @`@< h  g@ #> 3 `@/`@ -#> !> # L   `D!#p@ ۘ C!$|  ,` hx ` ! ! " h@"7`n@R`@> `@"` @`^@`a@@" h `o@t"@fs@-w@ @> $ "}@ 4 "~  @ ] r@-Β@Ӑ@iƒv@ b@ge@  g@  `@`@ 0H /e4* &  p p ?$pH 0 H /e * & @&H 0 H /e * & p$$pH 0j ` ` @a  4> N"܀  " > ( p ( (> (O > (! @ '''''@RE A@u` @@vx!@wܒ @X -*$"> Nb܀"%"b$ @j " 0݂ , &666 6!$|  , 2 x{  x " #H /e * &  $H 0߰ H /e * & p ;$pH 0ɰ HH /e4* &#@  @   H 00 @2@A  : Ѐ€ " pH 00p2   2 $ ߐ"$p@$$$($(` |     @  @"<  ! @4`$@t-@?( '''' ''('$,$(0$ 4$$8$,@$<$ $$0$4$8$<$@* $$($ ( 7&  @  $| H 0   l  h H /e * & h> ##*`  €. €  h*` €H 00,hH 0а H /e * & pa   * ~$$p@H 0  `  ` > #!$|   , > # h#*`  € H /e4p* &p n> O* * " b* `$p@€ H 0g !$ @a  |`"!$@ W `" !$@? "@> |#t!$`  "!$` $|!$$x!$ "`  , 9' ,!$| 1  , -2 )  & #$x@  @   4 44xD4  @S  㿘2  *@ *`> O"@ *` H /e`* &` `"V 0@   @ p    0 H  H 0   H 0 㿘6  * * > O" b* `@€V`? ?2  > ##`&`8> ##`&`8&`> O* * " b* `@€ <H /e4* &   "2 "H 0 㿘 >> O* * " b* `@€ <H /e * & @_$ H 0 `p@2    4    㿘 >> O* * " b* `@€ <H /e4* &   "2 "H 0 㿘 >> O* * " b* `@€ < H& R 䀢    㿘> #" `> (a@  @" @ !  (    " 㿘 H /e * & ## @ H 2 p p + p`2  # ̀ `& p> #【 H!@"  H  p` `2   ̀`H 0㿘 @ 㿘H /e`* &`  (`" @x ( `" p@r  p>*@& p6 @6 @^`> O n* p *  ~" & p*  H` H@Pw H 0㿘> ##H  㿘  ($   p ?& p!$  ( p @2 ( !"  ( % $"  "  @W H 2  p`@@3& p @@ Ԁ €   p @& p㿘 > (!ȑH /e * &  p @ & pH 0㿘 ̀`@ 㿘`D 06 㿘 p"` @` & pސ5 22  n> O* * " b* `& p@€ !  p ` & p  @2  | "   "   `@|& p 㿘`" p p & p ` & p  @2  | "   " ے   x> #" `> (a@    p*@  &  & p   ' ' '''''& & & @ u  p *@& p㿘̐ 㿘> ֦ 'L   ऑH /e4* &@ H 0$| +,'x#   `  `  > > #`Dp!@M `ऑH /e * & a;>  ڋ @  &1p0z  )s`   { >Oc` _ ]` `W` "p0Q( N(p  @  L  H 0  H 0 #> ##x> ##h!@Θ H 0`" ` 2 #   # p  #m`% H 0%> 5> #E 2  d$2 x : `:Dp!@ 2 2 'i !       d  @ 1 6 H /e4* &  @H 0`ΐ] 㿘> #" ` > (a@s  p @% $" "  @  H 2  p & p @@ Ԁ €  p ?& p㿘V H /e`* &` >  `  HȀ@$@"'> (`>  `쀢"  pH 0 > ` & p  H   H@H 0 (> #` 'V   H /e4 p* & p*   @%  H 0  > #H 0 #h !@ H 0ဥH 0>  $ | 2/`, "+` x& @" 2!` 2` 2`  v   > > #`Dp!@Q g `_  @2&` Hc d` 8  怤B) '> /> ( @Ȗ ?6 @ 6< H `8 H40  H@ 6 ޠ$  ܚ@  d< C 6 ܒ@< & d @$  H4 ``2 4 `A&` H?H /e4 H* & H  H 00" pH 0` &` #> # & p【 H!@ H 02`0 # > (9!㿐` h  *@`z&`V`ހ &`ސ> > (   `?e>E",* €@| v`` @"r`ސ@s m`ޑ*`:  @{0eH /e * & `p` @ V`ܐ``&`&`p6`@ H @@  ` `p* *&`&`pH 0V``ܠ$  6`ܠ ?,%`ސ ? `> ("E`ހ` `p 2 &`p \@b``@]`ސ?6`ށ㿘`Ր Ґ ϐ `㿐 @? H /e * &  (@ ђ   @'@  @  @@   p*@& pH 0 6 6 ށ㿘`p@2`` *@&`` (  ( @      ^   ^a  @ ?Y㿘4  p   x   p @2``@2@?㿘 @> 2`@: !4! & 6 6  (  h* h 4(  4@ 3* @*`@*`6 㿈& > D T d* *  * $4` @  d@> (b(# | 2 x> ( b8`2`> (bX  > (bxw6 ަ@t 2 @ L1   24> ("> ("4> (bܖ #Д@"? '?/!`''! @#> (Вb '?/!`''@#> (ƻbh d* * " *  * $@4` L1  1 (  @@> ( > (bƙ6 ށ Z  1   `1@ "H 4 ```+8 1`4  ?@ ") $ `"`4` ,`, 2`4 `44  㿘H /e4`p* &`p ( (  H 0? 2 H 0 㿘 E "V , : @ ?> 8 8 >  㿘&> 8& "@"> >O "`Ĕ 㿘> b? "b> (H"`"  "`> ""< "㿘  >!@!$ @< $ @8 ( H$@4 㿘@T @R (@P H >㿘> " *  * > b8>  "b@l""("H" 222p"|"x ""  " h*$( 㿘`"8 ?`3>E"H*` €> b0b4> b  b$> bb> b(b,u > "!> *` "@+ "@J 0 -?㿘 $ . ,   |> "bH@U> ""D㿘> ?D 2  @ ` > * bH*   F$ p p  $" ` 0B"$ p8 # a %$ $ $ $ $ $  ̀ " p p $ p p`2 hb`$ p%> # !h  p `"$ p h> #c* @€@  㿘?2  . > "H@*` > # h#*`  €@ 㿘?2  > bH. * > `  ` "h a$ | @ 7`, 3 x"0 (%)> '> #a2c a2_  ` W    D!pM Ka$ |   `,  x2a ( 2 (6 #> #x (!. "`0* $ (` "  (@ (  (  2 (@ ( ( 0  > # hc* `@@` 㿘?2  > . H* @ ̀   h> #c* ` @  㿘 l? 2`  * @> H*` p!  `  * "@& 㿘 l? 2`  > * @H*``    ?" .`* ` ``@ 㿘 l? 2`  > * @H*``  O  P `lޒ ` C   lҒ 㿘?> 2 bD  . ) > bH* @  @$@ ̠ ̀   h>W> #"c$ ̒`*@    w$ ,!$, 㿘?2  . > "H@*` > # h#*`    € p$ ̒ $ p(?2  > . > bH* '  *m> #x P! X ] p `  ` ` L ` @  ,`@8 i,` = `"  H `! "  Hʒ 2,`! ĀÀ`  J``   d H  @ɒ T  H   p  ?$ p Hm  > (E#0 #(?> 2  c > . H* '@@   `p w   "l``( m`")`(  d@ 8 #"  8 qc`p T @֔`(` `(#ܖ`(@( ܐU  d@ 8   Hc`p + > ##``( # ``!2 `h_``p `h* ?  ` ͔ `p   `&`  #> #`! N "s`p`&`c > (#8㿘?2  > . bH*  p (` ``* 0[> 0XH / * &  p  H   H 0 < H 0  p ` ` *  `! # C` ` "  (   ( #Ѐ ! &`  * RbH(   > $"8 > $"8" bH(㿘?2  @> *`H *   `@$` "`  " ` `@,  `((" `   `@,  ` 7$` 6  `*` * " > O* >X`x 2 `h i@"S w@"*  _@"Xq `h @M f@"3h `h ` @ ` @@ p@"[ `h `@U`@*S `h2`H> _ d@`x2İ  &       ?     ?$    ?$   `H@`H `h  `  `x   `@Ɛ `h> #c* `@@  6`  !@  `N, !/ X  `("/`  "+` ` @ ` @:  `@`}@`u@" `@" ` `@ `@* ` `@,  `"  2  "  `@    $ ,  0  `@ ߐ $ , ג 㿘 >{Δ & @`:   >{ & @ &  & & && &  㿘  " @  }a >  " &  ,:`@v` }S >& & ?H4($   "` `8("@82 "  " "" " H  㿘H /e# * &  @ "  " 4 ˲& " @@ &@&  &  4 & & H 0$@ H4@(@8`2 `` ` `/`, a` $   `8(": ``0   ``HH(@"&"`  #  4   ""@ ""`4"" H 㿘H /e * & @`@`2` ` 2&`> (A#H$  " `H 08?&`&` ` *`` `"@!  :*"  *  +  :*"  * *+ @`  ``@ &@&` `&` H 0 ` `8( @"@**2+@` `8@ + "@ 8  ""  ( @ ( (+@   @ * +@ @ *   +@ +@ &+@㿘`U H /e * & @>`5` 2/&> (#`$  ."& " " 4,  "  @@ &&@& & `@& H 0  > f DD` D  `@"  @" "  "@  8("8" > f D  "@ "    8 ("8!"@ ?H4(&  2 "  "   ` `8 ("@82" " H  xH /e4* &  H 00?@ . `)&`' & '`'&  ` '&  `'&  `'&  `'& &`&@&`&`&` &`&`H 00H 00-(?㿘`h ) J> "L 4 > "L   4  2 4  &&  & @~l `t &`&`t  㿐> ֔ 0  'b@M 㿘 > (c  p*    T` `  , .㿘`> (c * R ! ` `   2  # #   *@ `# # S@ `   @(8(82??2 @("`J@("`J@"` @("`J@("`J@"` @(82 ` (82 2 @@`?22(8 08 (2J@("`J@"`?(2J@("J` 2 " ?(8* 2 J"J("J"J (2 " @ (#`J@*(#`J@:#`J@?(# `J@ (# J`# 3   3  3 ` `( ` (88 * 2 ` `( ` (88 * 2 ` `( ` (88 0* 2 ` ` ( `(88 * 2 ` ` ( `(88 * 2 ` `*  `(8: 0( 2 ` @((882 J`  `*㿘@  "@ "8"@ 0  "@ "*"@   @v 0w?# @q&> ( c* R ` `2c  $ @$?  $?# @ > (*# $ "@ "O`@  " @`@  "  @ -`@ 0   @ `@  &? 㿘,  $ ` `@_>?@_@a, 0 㿘``,  a$ ` `@_ ?@_ڐ@a 0 㿘``,  a$ ` `@_?@_̐@` 0 㿘`, a$ ` `  a@ q @  a$ `  `, ?#`,@_?㿘 , " !$ `  @_? 㿘!> "> $!> -`" > 3"`"@($""> ,` "`$"`%> '> f)> f` "```:` "`` 4* ``2` >  $> " H " > "a> ">c`!`>bcH !` > " "2 :  R  4*R   >  "* "   2   : R  R 2  4R2  42 4" 4 *R  㿘`> * ""& *`2 *8    P2404*P *㿘> "```:`  ` 4* ``2`㿘> "`> ``:` ( "`` 4* (``2`>  2`@ ˓:`㿘> "`> ``:` $ "`` 4* $``2`> `@yF 㿈> 2cP'>  H'#\ * @ > "b%> > )#\b!   > $ #\#> > )b  a( !>c"L a"L > $ ̖ <a>  g> !ca㿘> b> C6`@ 㿘> b@㿘H /f4> * '> "` ``:` , "`` 4* ,``2`H 0> b` "`㿘H /f * ' >    "@H 0  6 H /f * ' > b.``@  2@ H 0  & && 6 㿘H /f * ' >    "H 0 #6 H /f * ' > b.``@  2@ H 0  $ & 6 && & & 㿘H /f * ' >    "H 0 ' 6 H /f * ' > b.``@  2@ H 0  & && 6    @xÔ 0 㿘H /f * ' T > b*`@ ?2@  @ &   "# 8@  <"`< < 8"`8>  $!  ( $ 0 , t 4 $ 0 ?4 >  H 0㿘 K> "H /f * ' V * 4 @ ڒ   "# 8@  <"`< < 8"`8>  $ΐ!  ( $ 0 , t 4 & 0 ?6 >  H 0 㿘H /f * ' >    "H 0 #`6 H /f * ' T`> b*`@  2@ H 0  & && 6  2`o  `#V @6 ` $& `& `& ` & `$` ?4`& `&  " ?@& & 㿘@  㿘@ 㿐` > )" s   2 $ 2 > )b"@:> "b 'H /f * ' >    "BH 0 "$ 4 H /f * ' V *`  5 H 0  $ $$ 4  $ #V @4  $  $  $  $ @$  $$  "$ $   "8$    1 $  $$ $ ($ ( ,$ , 0$ 0 4$ 4 8$ 8 <$ !  "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   $   8  `"  $ 0  " ?$$ $  " 8 $   ƒ@   @ 2&   > )d"  > )W"X  > b|  "b| > b| "b|㿘`> )">6> )> )"8&@ ` 2 0"Ȁ@ :#> ) 2 %b" n& 㿘 J  @*@  &@T`-  3`8 " $@@` @4@@ 2@T`   " $@@$ ` "` @)&ݲ    && 㿘 2`  2& ! ` @@ *` & `  @ & 2  P `&$ 8" "@ " " `4 4"  0"    "    "  , 2""" *" 2" 㿘` ``a  `@` `` &@V H /f * ' >  ! H 0 #`6 H /f * ' T`> b*`@  2@ H 0  & && 6  N& ``#V @6 ` $& `& `& ` & `$` ?4`&    ?&'> )`℀*` 8   $`  &@@& ` " $` `$`&`ڀ`` &e> bx  "bx㿘`Q` h`( h@` h`   &@H /f * ' >  o H 0 #`6 H /f * ' T`> b*`@  2@ H 0  & && 6  eH /f * ' > !3 & $H 0 $ (  & 6 & 0& (& ,& <& 8  >& ``#V @ 6 `& `& `& ` & `$` ?4` `` 8  `O  &@@& ` " $` `$`]`〤`` &R> bx  "bx`&  (""@`2 "` 㿘 ` "@   @8  246``8 `$" ?ܐ?" 60 @" `"`$``""`n h H /f * ' >    "ZH 0  6 H /f * ' > b` 2`H 0  & && 6  2 & ) % ` " `$` " $  @@ 2@"@@ @@ 2@"@$㿘$   8  `s"H /f * ' >    "H 0 R6 H /f * ' T> b*`@  2@ H 0  $ & 6 && & & ,#V @6 & & &  & @&   $"@& & $  a  `&  &$~ G ܀ vH /f * ' >    "gH 0 ܐ  6 H /f * ' T > b*`@  2@ H 0  & && 6    " ?@&   "%   6 H /f * '    @6  8& <& 8$ 8 8"   H 0 #+>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $   v 0$ $ `$ > " 8%H /f * ' ` H 0  4 H /f4* ' 4H 0  $ $$ 4   $ %@8(1 H /f * ' > !_ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  (8 $   2$ > ! @ 8$   $ $   $ x$&@`l㿘 '!> )   ` 8`#`` $ @q- 0 $ @q&   @q   2 㿘`> )# > )> )#0ߒ(&@ ` 2 Ր#H@ :$ #> ) 2 ɐch" @ ߴ&  㿘 > )#%`  &@`  (   "      "  8` `   "@ `#@  & $& &    @ Ԁ`0` 8`"   $ 0  @ "  ?&`````    & 3``8 `$" ?ܐ?" `0`""` "`  M  "& H /f * ' >   H 0 Q 4 H /f * ' U > b*`@  2@ H 0  $ $$ 4  .- H /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    2$ C   Ӑ  "&   2  $  $&2&㿘`I ` D H /f * ' >    "EH 0 g `6 H /f * ' T`> b*`@  2@ H 0  $ & 6 && & & A ܤ H /f * ' >    "H 0 $ `6 H /f * ' T`> b*`@  2@ H 0  & && 6  쀦 21 H /f * ' > !  "& $H 0 $ (  & 6 & 0& (& ,& <& 8     `#V @6 `& `& `& ` & @r&  $&  E& 㿘` `i^ o " 2 2  㿘k  o "@"   2@ "  2"㿘㿘`   `2   2  㿘      w 0 㿘˒ ``     2 "@& "@$@`  "  @㿐> > )"c#\ Ȕ   㿘>  A "d +  2V^ +Y )H /` * ! > " @nz $  $ $  $ $4`` 4 ` $ `   $ `` $ `@$ $  @   `@u4 H 00`> _ d@  4 H 0&@ 㿘H o *@ a   ` @ H p@㿘H /` * ! ` `   @ " ` H 00 `` 4`> $a@> $a> $!@&4`4H 0 㿘> #" `> )c@Ր       @   @  |@N> "㿘H /` * !     @ ϒ @X  2 @ Œ @N   5  # 2 @͐ 2   "   !!" %> *!>     V  6!~ "     `   @ `"  " > )#6 zH 0㿘> #" `> )c@E  `   @ 㿘H /`4 * !   > )j#ؐ ?(6   ` 2  5 `  @ H 0㿘  , -H /`4 * !      `2 8@4 "   8 `  @ H 0㿘H o *@ a   ` @ H p@㿘H o4 *@ a `   9`  %  `  @ H 0㿐` >   'L` 'H'P L L   P`:  U@ ``` '` 2`  `' `4 "`4 ` *`*@ Ԑ`|0& H 0`5`8H 0`H 0`H 0` 5`H /` * ! ` Θ`8 Ӏ 2``  `$2` 9 2` 9H 0`H` '``| "@``" 4 ` `'d      (   (H 0s` = D<` *@ (L`$ !`@@! #` ? 5` ?5``@ #`|H 0 MPN`H 0P$@L >   "3> P :H /f * ' `˒ "H 0 6H /f4* ' 5H 0 $ &6&&&&  &4&H /f * ' ` "H 0 6H /f4* ' 5H 0 &&&6 쀤4gGDgBH /f * ' > !V "&$H 0$ ( &6&0&(&,&<&8 (P > !% @4  &h4( $@4@ $@P  L  " ?@&L{ L` & %P `O"`` `` P` 2``P ` 5`H /` * ! ` `   P@HH 0  ` ?5` 'P  P`L<` ? 5` ?5`[`P  _ Z㿈 ''H''X'`'&@ 2'X   ? !2+ ( `  @  @  zd֐` 22& $" x      @  x   @r L  6 x H /` * !  `p  L@ k  \@ @e  Pa  ] ` X 2  8 L " 8> )#  I 6 8  =  x "7  "1 2V  2   `" 9  󀊡 # x ? 6 x ?6 xx x@ LH 0 "y x  > *> *> * `X" ` xV `> * p'H    H"@c  L T" & L& T H0"@& TH "& `K&H /f * ' V> b*`@ ?2@   "#8@ <"`<<8"`8> $!($0,d4&0 ?6> & ` H 0 `V  > "`    'k  L T" & L& T  0"@& T` " ' `2'€'& `H&H /f * ' V* @4@  "#8@ <"`<<8"`8> $!($0,d^4&0 ?6> & ` nH 0 ` ' V  `!2V& `" & h> *> *> * `"V '!2"2   `  > *> *> * `d"& `& d& h   * 2  ( > *e ?6  H "8 "82#耢`2H 0x>'H /`4* !耢  $@"& " 2  L T" & L& T 0"@& T%& `L%H /f * ' V> * ?2 `  "#8@ <"`<<8"`8> $!($0,cn4&0 ?6> & ` ~H 0 ` ` > *> *> * `#C&& h& `& d& h@  % "@&&  L"& L H `2 @"  & H  @Q6 @OK@# 0  ,@ L " ` x ? 6 x ?6 x xH 0 2     `" 8  V `   ͐ `  2$@ L2 & `& d& h "& h` "   `  @ 쀢@2耢`   x ? 6 x ?6 x xH 0 x耢 2X`" x@"@ x ? 6 x ?6 x xH 0㿘`  ``@`2      @ h L ,  @ 4 ,@0 4 ,H /f * ' @ , ? 4 , ?4 ,E , ' ' ' ' ' ' ' ' $' (' ,''@f4 0  4 ,$ $H 0   `@@ȁ㿘?#@'P  "դ * `  @PаȤ *"1`">` 87` *"3`@.` **` *   1`` *4 *Q`" ` 2 ``L#@4 6 `" ` (~ `` e6 *b6 "q ` (m ``$ "  0N &L L |@h DR 7@8<&  P@86& \"E ` 8`? '> @d > c"@@d. !|  @d ,  2 ``06 6 z`  ` ` @P `㿘?#  " * `x@ v   G&` 4 "CV @">V "9V 0X"6V 0U"3V  ".V 0M ")V 0H  ", \    "& P4$  "  07 "`&  "V0- &`  ` "@V `(" V ` #"@ 8"@6 8`"2V zV >   &` `@ce$@i> `$ ` *& 㿘 <  @p D l`4R`(2(  > $> $"`8 L> $"`8 |H&4$($"` $,0,H  4(H4p(p  "p`2``"`px2xH `4( L"`   "  8` 2` 8 "`"`,  " \`0   4(H4(  "`2``"`2H 4(`|` ``"4" `   2`8"`82,`   , 0  `&  4(R`2" R`2@  2 㿘   ;  6 @ْ @ @? L    6< 0 6@/ L   @% |㿘  6 `8x6 @ |@ L   㿘  6 h0b6 @ |@ L   㿘@ > #" `> *`@S T 4T 2*T 0 @ @R %>  8 @c?6  6  6  `6  &  66 6 <& < &  &  &  &  @& @ D& D @ P@' `   @  @9 `@ L    6 6 㿘` > *2 &` 0  6 0 2  6 2&``&`(`(&`,"`"``   2 0 20  "2 22 ("  , , ,  , ( " "  㿘 `6 @D |㿘 ` 6 @; L   㿘 ,!  @6 , > *R .~ 㿘 ,  ,#> *  @4 ,! ` ~ " ,    ,  4 ,㿘` `, ? 6`, ?6`,R "  D <n^ @`$If 㿘 |@" @ L  \ 2  & \ 2 (&   8&  @* 7㿘`!> $!   2* @ * @h:)! .`  .`&  & &  㿘@& & 㿘` "&  "@!0 @n㿘  @"  > *> *> * `@ "@[ & 㿘`&`   a&& ` " `0@&   "& " & @ &@`` 6` 2 @/㿘`8   " R  2  2R @ !&&  "0& "`"& # "` 2 2@ 㿘 @ > *!`       ` # 4 4v @ 8r H /f * ' >  q H 0` 4`H /f * ' > b`" 2`"H 0 `$`$@$`4``2@8 $` ` "$$@   a&&   " 0@&  2    a&&   "  0@&   "& " & &  㿘> * !p     ` `# # 4 $#+   a&&  "0@&     a&&  " 0@&   "& " & &  㿘 `z `` ` " @ 2R R V`@  2D@& @B >":   8 `" $0  @"  0$  ?&0VV`@  `` `  @ & ` @ &"& && `   a&& ` `0@&  ?6& > *6!㿘 , "  > *> *> * `#"@4  2 "  > *> *> * `#' "  > *> *> * `#( "  > *> *> * `#)  > *> *> * `#*㿘    > T" " &&   &@  0"@& H /f * ' T * 5 x   "# 8@  <"`< < 8"`8>  $l!  ( $ 0 , [E 4 $ 0 ?4 >  VH 0` 2  > *" ( "$ $ "@& "f&  ^ > " " &&    0"@& H /f * ' T * @6@    "# 8@  <"`< < 8"`8>  $!  ( $ 0 , Z 4 $ 0 ?4 >  H 0`" &  " "& & $   2 & &  "& 㿘 `[> `"& )> `  " && ` `0"@& H /f * ' T`* 4` ` "#@`8@ `<"`<`<`8"`8> `$!``(`$`0`,`Z]`4`$`0 ?4`@o H 0 2`   & & 㿘` ? (> *" HC  C   ; (- H /f * ' > ! & $H 0 $ (  & 6 & 0& (& ,& <& 8  2 ؐ  ` ? & `$ $$ 㿈 = - 2` 2 > ## "``@V` ;?"0"`(, ?",`0?"`0`, {א`0&㿐 @@ ``@W  2 `( 0" 0`, {`0㿐 @@ `(`0?"`0`, {`0㿈`  `̔   @d@ H /` * !  ( `2   2!` #0` 8   6! yt T 2   8    > * 54 8 8 u4 8  v > *"H` <ǔ찒  $` 2 4 2$` $`( `("`,`("``"`$`, 6zǒ 0J쒄 p& D5  2` 2> ## "` "( Ԓ `` 8' 7 `1    :>0, ?",`0?"`0`, zԐ`0ܐH 00,?`$0zĐ0㿐 @@' r`(  !!2``0?"`0`, d %z`0` %`@3  2C  2=   !! 0" 0`, z`0㒰 $0?H /` * ! #> *    8   6!` x "   84 8H 0  ?4 `0?"`0`, zR`0 ?V?" x@`` @`` u;Ôఒ h '2  2` > ## ""(;ఒ 2K2 2` " "`('<谒 3` 2 ` 2찒 )` =  ", ?",`0?"`0`, y`0, ?",`0?"`0`,  yؐ`0 9= '9|='耢 "쀢 p`` ``'` @'''''И''@6؁8` ۔  (䀢$% ( *  U 䀢*Ò  `@'@ 'W^ h'@H԰ ע    '  '? '''' `  ' `@Ֆ   "Z'  @" @   @2D``$8  ̀`$"  ?ܐ"   ?"  `?"`  "  T '̀` ` ?` "`?  " ""   @`2ܒ ,  UؔuԚ`( >̰ 耢 ?  #   g `$'   L V  0" 0`, x`0Ѐ p` Ȕ  "`0'`` `'` '`@''''Ԙ'@B؁8`   4䀢$1 ( *  T ` *@ '* @'@  `'~ V h ''@԰     ? ?''''   ` ' `@     @`2ܒ ,  T*ؔ؀  Ԙ (̖   耢 ?  #   $  KÚ U  |$'`".̀2' '' @" `2@` ZȀ&   @K԰  FЀ @?#@27& " 1&?" ` "`Ѐ 2!  :  & `` ?$ @` 2 &@& 0" 0`, wG`0̀ "KЀ E㿐 @@ `(`0?"`0`, w"`0㿐 @@ ]`(I ` >  ``)H /f * ' > !D $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   7 2`  7 `  `$ `( `` ѐ 0" 0`, v`0㿈 @@'찒 B` " '`  '`(`y` 2` `쀢 " 8'  `ǔ  0" 0`, vw`0쀢 /㿈@谒 ''@  6562㿐 @@, 9`  $  (޺  `  @ ` 8'``q `j  0" 0`, `v`0`㿐 @@ G`(  $ 2``0?"`0`, 9 9u`05 93  # g  `  @ ` 8'`` `  0" 0`, uǐ`0ϐ㿐 @@ I `(C  @ 0" 0`, 9 -u`05 -   2   7`  @ ` 2 - ` `͐ ` Ɣ  0" 0`, uv`0~㿘8F C  ^-H /f * ' > ! "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2  7 $ p 0$ * 㿘2 2R`    &&`0  "`0     , X L   D T h d   , D p㿘>   `  ^ -`   ` `H -```2B `<.`>" €`7 8@B3@y0 @)` & $ @@V`    2  > $& Gb @ V  2> *> *"p`   T`, |`"  &` T$`, L`(`#  &` L$$`( ʐ"x @ ր V < v> *` ɤ 8@ À `  9`  > $"`L `     7 @   "`   > *x" `Lb   `L*` `T , " " & ` `T# ,` (`L " " & ` `L# (`  [ F"@ 5U  &@V  ?` "?`L@&@?&``2`0> cl$` "cl`0 &(`4&&&,& &$`:&` "+&  & ``e$ ` "&   "&  & `  T `   & ` I  & > *" ܦܡ㿐 "V P  8V "> $ "> $ > *> $"> $"8 Ð"" 8 O  " 7@Us 8& $@| * "@*`@*`$ 4$ 0㿘  " " @S &  "  @  @C 6  2 " F > #p` Q @jQ > # ' ` @ O `@T,  ''\'X'|'@GX 2>h l@9|l@0@@+ 0@ '$8 !7l@8 lh@8| h$ &  ܓ & @9   > *{1"P` D`  a '''''K?  (0I* @ D< > &@@8 5`"1 =TV@@, )  `$` 7 2` =  `沔 9 $  $  ` $ $ $@@㿘V@V@  )`" V  > *""  "  "㿘 '& R`` 2  $   2 > *v"Ѐ2$ & ` ?2`$ 㿘R`   k㿘4 8   *$  Oߒ 㿐`>  ? 4,N  V@'$@@`?2@K2 & h ,  2E@ `? , @1g ?<,   (΀   @*`" ,> @?' `p" "p0 %`&` Os 㿐    ` ?#@2  @ 4,     ?` "` 8`"   $ 0  @ "  ?&`74` H /f * ' > ! "& $H 0 $ (  & 6 & 0& (& ,& <& 8  X 7 @ $ ` & ?@-1>  .i?"' #@ "    ``  "` @#p "`&#p  `!> z ` `?"` `#p?"$#p㿘> ch  > ">   %h  "ct?#  4  2 > $!b 4?#%> # t 4  $t `2 @" T `4  (" `2 ` >`cx@Y  2 t b> b|  &L* b  ` @2   2  $@` 0 $ 0 `$  2 @R` 2 ?`( "??` @3n ?`N &%h㿘 >c@ 㿘 1 *?#R 2! (` 2` 2@?2  `$@  2R  ` R`  > t  t2`2`㿘 >  0 & 0 p& ?"p3 㿘   > #| >     㜘    2 㜀2 8> *# 8`> c?"c 0@2 > B#` >  @ :@  0" `"> `" "`> `" "` ` "`#   "㿐> > *# c#\ t  > #| -> U1> U'> B/> ""*"> Ĕ bG > "` @P ""@V쀤@U"!P#!5> +>  0 t@QI> !(,` ?$ D$ H$ @$ p``P$ 8 8$ 0` >   `:@    > # %`> #> `"# $  "` ""$ > `` $`" "`$ `@ t"   2:: > "`> "x @O `@ :@ %%"` `କ: 4%଒``` ଑: @4%ଁ㿘 @+  0"2' 0 & 0@6(> ` , ",'@㿘 @ 0"2`0 &0@6 > ` , ",``'" @@ѐ 2@@ @ 0"0  "0@5 > ` , ",@ ޲`@e㿐\#`'P'T#\PT 㿘 0 2 \ \ " \ X "  \ < @" \@PL ``< 2`X` ` `"`p`t "`t "`p 0? 0a $ 0H /d* % @.  \>  `0 "0 \`t "`tH 0 0@ $ 0@5q` @@u㿘 0 > O 0 & 0H /d * % @H 0>  `0 "0> O" F *> N"@ #*`  @0  0 & 0 0b& 0@7㿘 0`& 0@50㿘> #" `> *c @  0  0`& 0@㿘> #" `> *c0@  0  0 & 0@㿘H /d * %  0  0 7& 0 0"@" 8 0 & 0 8 $ p 0@; p > #`@ 0 " \ 0 ?& 0 \ " 8@]@א 8 > B> #> `"##` >  >  `:@    > #`#  -& 0  0@> #|> B#` >   :@  0 ` ">  > @ " >  > @ "  0 "&  &  "` ""&  & "@" 0!> >#c #& 0> lސ $#>  `  > > `# lx H 0 0 @ 0*@& 0l㿘 @VK> `Đ>  `*  "  P2  \2 0  2 P 㿐 '@V&> `Ĩ >  `*   @V Đ ਑*  >> * P25 \21H /d * %  0  0  & 0@jr H p@ ˰ 0Z 0@,H 0 2 P >  @  @ &@" $@& & P& TH /d  0`0& 0VH 0Հ * % @uH 0 `"`0 "`0x@!㿐 @ 0 "0>  "@"`"" @㿐> B#d@ ,@ @@( 8> *#H"& <:A 8%>  @z 0 "0 "@"`$"  8 8$@ 8  H H @ @亐" 8@& 88""8`8`< 4"`<`8 > *ܐ#x   8 ǒ  8(<& #  'H 0$& <`0 "`0H 0 H 8H@q" 8""`8& 8"<`0 "`0& <㿘& -> +> )> '> H /d * % cx@> k.  ଀@#> >  > cp> # >  > *`"  i- H 0`O 0> # >  "#> * #i H 0耢`, 0 $ 0 0`" \> *4# @uH 0 p " > *"#Ȓ?$ 0$ D$ P$ T$ X$ 4$ @$ <$ d$ `$ l$ h`"  "` "@&㿈>  > -> "c'> 3> 1> cx@ > > *   h ?H /d#* %#  > B> #`c)> ɐ 0 $ 0H 0 0@H /dp * %0h 0 2 p> *# : 0@5> #    ( 0 $ 0H /d * %  8``  : @% $$  $ "$ 0 ?$ 0)#z>  @ {cx"@'"'Вb@ ?耢 gH /d * % # yWcx㿘H /d * %  0"  #> +` h  0b H 0 0$ 0  ;$ 00  0(  4 " 㿘> #" `> +` @Ӑ  0"> + ( 0 p"& 0`> #`@ 0@  0@*  \& 0@ 0 @  0  X& 0€4 0 0 0 *@& 0i㿘>  &@> $" `*@!&  > a` "`?* &T *  ? ?> `>  a*   2 T@2L 2@K ! 2 2 > a`? "`@"(>  `2)  @`& > > a` "` `  "`   "@$ > a`$ `""` a` "``T@> a`  "` @: @# @/ݔ@& @ *   %  @-є "@w0*@& @       @/@&  `T&  > @S> a`  "` a` "`@     J?@-  C*@>&> a "a `  "`   "@$ > a`$ `""`&@'  `>  "`  "   "@` "` "$ ܀ $ ܐ "`  "`"ܐ$ ?㿘 $> $> + X" `d#> > !aԀ@ > >  ~ ̠@JO @a%>  $a!ܔ!܀ M ` "` "  "@ ` ` 2"  "@$ `$ `T $ $  T !$ , *:$ ` $ `""`  T.  > `> a* @@ $@" "@$ 㿐> !"!"`!> > a>  ZД > #$!a> > +#\ ̚`x @  } > ؒ ؔ"`T> > !(*ؐ  2 :؄""`T> ܀`5 `",`X""`&`"```  # ` ` ` @2 `@ "`܆܀"`a܄` ` ""` 2`㿀`> +  ј ` "0` )`   @   0> ` $0`,  "`,  > $"$`" &`@`  &`&` ?`   ; @M 8@ @.  ?$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\Y[  ; @M$T8g@b ] @- T?O$`4 `` : @*&` @ `*` 8 &` &`` 4'  #`#d#\ @Q  `0$`0$`T@`  >  `, ", `0"> + @-ؐ``0" `0?# @$`0Ӑ`@-Ð`"` `<@F`P@&`<㿐X L\` d> + y  ; @L<8@ y {  0& T& 00m#\@h 0"a. + B& &&&&  L< &`@& L1   P `8`@@ `H@ > +%!`0 &`0P   @`0&`T u&`0`0 &`0 @*`"`&   "ʒ 2  0 & 0& L& XC +Đɐ㿘`   `0"\&`T\`0> @aD&`T&`X&`0㿘> #" ` > +a @~  0(2 4 L& L  H??@$  H@u 8$ <`$ 8 0$ 4($ 0 8"& 8  $  86 H> +!8$ @O" @J$ & <& XC + 0 0 0 *@& 0e 㿐 P  \&`&`&`&` ` "`X` 2 `X <` ;`  T "``X@L@N `?`L' < ; `=`@K#@ `(@2& <2" <`@`` *`` @, ` L *B + <` @S < Ơ (B +?&` < ; @Kh=@"  T@+  T? &` T&`&` !&` &`&`֐&`&`&`    @  &`&`&` T&` 㿘 X L > +!`?   2 ` 0͐  `0 00  `0 2`<?͐`8@s?Đ?/  + @L `<$`8>$$$ `LD$`0$`X`H @$`0@$`Lg  j  0 2 wb   $ `8`T:  T@ > +`P! T> + Pܐ!> +.! 0?a $ 0 0`$ 0H /d * % 5 \`t "`tH 0 p > #`" H@ H@˔`<- `8@$`<$`8 8@"$ 8 "@   ``  `0 $`0$`L$`XAu +Ր?'!㿘`` "@`,` ? +`  & @&  .` <?`@  .`" `& 㿘>  ` > +"@  @(1! > +"& @X  a\ 0(!(& @ @  " @`  < <@2  " @   @(2  @ >& @@  㿘 㿘  $@   㿘    9  㿘   8 P > % 8 `@" "  2    - -㿘 2 !> !  >* !@DƓ*`"  > +> +#> + > %!耢 "  bb * $  2㿘> %*` > > +ِ"a     a* " a 㿘> % `8@ " `8   `8@   Ƞ  > %8 >   2> ' "a   "a㿘@F> @А!> %> % 0`4" 0 "`4  @?`( j j j k lp l mT mt m m n㿘W` Z  "@T @ B&M `` @2`?? DE?4> 289   (  7`/  > 8`< < $ $ 4 $ $ $ $$ (\ 4   0@@0@? (0? ( 㿐V  $   (_  @? ( ###> % @    @2`l?x ( `l``@ > %  @   @ @2`?*  @2 &  6 @ 6 & & , ( ,& 0 ("@$ (` _w    ,` 0"`0"( 0 ,"@& ?4 (@6 2'  @C  `*`>" €`" "& V   R` @=   (>2 V R 2> (w  @  @ " `B  & :@Ւ@^ V   R 2$@  `$`,`"0"`00"`(0,"@" ", (,"0 ("& ( $2,`  " ` '&  "@> (v  & "   B?:@'e`" "&  `B :@ 㿐  2'0L> ?@?`B>"*` € ( ">[04     @ߐ @G $"  ( ">A   B?: ' `B  : @K  㿘@( "  6`6` >@ 2   ?2    @ b `B >` @?  4&`&`6` 㿐'  V   `  @ 2T 㿘'` ` `@> "  `@6  ? ? 4 @2 $        2     4   8  & '    @     z 4  ?  4 2c  ] 4 @@  ? @ 4 2E   ? 4   @ 422  @  ? &  4> + @ @ 4   8 2> +?> +  > +}r#8 4 㿘 `@2   ` @2 ``B > /&` `@  `@  (` B?> &`  (;' 8` (`: (D  : :  :  0: : 0: " ," $ $" (`B> &` & 㿘 $`0"`0& (0,"@"  ^y  $2,p,$ `@$0` "> +``2$> +}#p?"`> +|# $> +|#`$ :Д $` $`Ö$`  "  "`` !$ `J`/2 @ܐ `<6  `<1 0@ϐ  K  $ :f `'` $  ?'''''''@$а   (S`< N`$ # ?( ``; $`*@@$`J`/@ @ X `$`@-$ @`@ @@d`;˒  $` 2  @$  `$  >`; @@]$㿐$` $ ``  `"` `@$` b*$``$@"`'J@ /2$`'J /"`""@$$`<  J 2` 2$ $`  J$`'$` ! `  /`* @ `  /*`2#@`$`"`$`f ?$" $J`/2``'J` /" "$$` $`*@$` J`2`` `*@$``  $`  * $`` 2``J` .2 `J@ .2`` *@$``@"%$ ' @@`@! > !耤 2@$$@{` "$`!"X$$`*@$`@" "@`   > +{!#?@ ?X< '`@@0@T@G`@!$?` ` X <` $@)  `*@$`` ""@$` "@$$` J`2#`  $`  @: 2< @#V  @B 2f`@g$< ` ݐ<  @  @@"$$` \$``? ` @2 @$`@8`@? `2`X <`2 `"  X`<"`  `@ @$2`@`   @"    `  @@"ڒ @@$@$㿘@*   "&`@ ŔJ@ 2> +z #@"> ,z @  "@@ ?> +z #QO  X <`J@I @:E  < @"> ,y (? &  X <`! " X <`" @ @ 2@  @"]     @@"R @o@&@㿐> #a#\> > ,"x Ȕ `h p > > f> ""d"a"p> "h""h"`> #\"#\"`> "#h> b\"b\" > @ V"bX㿘``" `  ` @1I `  㿘  1> 㿘1, 㿘> > % `4``@A 2`$`2  77!@=!> , p  0   $ $ @ $ <$ $ `> `$` <*  $ <` @<  /,   Y  &  㿘> d" "> %  4 " !> , "  $  xz  $ 2  > \\@" `d 2 @`h 2@ @ 2`d 㿐 > O > f  ax * & d`& h`4axax?# @ `>  \* @\ ''ax `'4ax & dJ   *`J8*  ???: H2 " X": " <" @" 8" 4" 0" ," (" $" D" " " " " 2 㿘> > f>  > a| #d*`  #a| |H /d * % d > #\`#\> "h`"h| "H 0>  pW"x@< d$  d$d'   @ @ 2 \ 2 DH 0> ,x0 &]  "  \> , @> ,x+ ` `"``$ ` \"@ L $ LH 0 < @i > , @t> ,x  ؑH /d4 t* % t  > ,w H 0$ @$ $ <> ,    /$ $ $ 8@ & $ D$$   X ` d" h h h h d ` " X`" d` d h`"`" h㿘@  㿘@ 㿐?> &@#   &@$ <@  '@ې&@ 㿘<> ֒`  a @ג @>` ?> * cĢ @    ` @ < <@2 D @? 瀦      < "  5/ $@ " " " $@"" @$@ @h@& @ @ΐ@ג > ,    .& 8& 8& O$<㿘@@ @! "& @> ,  Vܘ J  D 3` L ". DH /d4 P* % P    \`2  ` `>  ""l \`" ` `"``> "#` ` \"@ L ?& LH 0  D` & D@q "  D? & D@ I 㿘 D 2 > ,v! & D㿘> ր  > ,v! D 2 ?> ,!@> ,v! & D @5 0P H > ,!@> ,v!H /d4 D* % D  > ,v!@ L "  P> ,!X@> ,vy!x `& L> "h> #\ < 2& \ & \ \"`` \""& ` \& `"@"H 0 @ 㿘> ր  > ,vF" D 2 ?> ,"@> ,v;"( X& D H > ,"8@> ,v."PH /d4 D* % D  > ,v!@ L "  P> ,!X@}> ,v!x `& L> "h> #\ < 2& \ & \ \"`` \""& ` \& `"@"H 0 `@ @LLPD2P\"`` `>  ``\ "\> h\"` P"P㿘 `` `X `d@ 㿘>  @"2 `  @ 2* "  D H "#  < 2  D @ސ "` <?  @ > #& 8    &`㿈>a'''쀠 `  㿘 D  & D @!"!> ,uS"p& @`@Ӕ@` ? @>  ` ?@U@ @Ŕ@  > ,u'"O D? J& D P > ,u"H /d4 D* % D  > ,u !@ L "  P> ,!X@i> ,t!x `& L> "h> #\ < 2& \ & \ \"`` \""& ` \& `"@"H 0 > #t & 8  @ @?c > "& & @ & @Vs㿘 D  @  㿘>  @㿘 @! "> ,& @  Ti 0<  X   <? 8Z D U@  "  `2 "`2 @> ,tr" @(4  @   @ < <@2` `  @ < <@2`" > ,tD"2 @@ 7 @ @ 7& @ 3Ւ &  D `;& < L 7H /d4 P* % P  > ,t"> #\@#\ \` `"``" ` \"\\ & \\ \"`` \"`"\\& `H 0 ;` ?> ą(    @<@2 " 㿐@ ?* c`@ * @ؔ @ `@`㿘 @(2 " D   @@ ` ` `< <@2  D  2 P> #' > ,#@u:`<> %!0* `H> ,`D#Hu/`P`@`/> ,c@@ @`@ > ,c@? @`@ > ,c@? @`@!> ,c@? @`@"> ,c@? @`L > ,c@?ٔ @`@(> ,c@?є @O > ,#t` > ,> ,t##t#@# > ,]L#㿐`6 > % 4F    $=  2$6 \#\`,-    `% -> % 0Ll > %  4   2$ M? ( -㿐 > #d ` *` *  * S&@$&@OL > @"\"\@ A 7>  X' 1@` )'+> ,`X > %!T`tKcЀ`d    Ȱ 0'@ "\@Ő$&@   .  @* %  < <2  `  < <2`"  㿘\`  <"z $`0`4 P $`4 < "l$ <`i d  @ 1/@5ؒ`X\ U `\@$d_,`d" \`~ B d@$ g,  . 4 `  > " `"@2`` "``$€@ 2  7  @"  $`0`4 P $`4 1[ 1㿘 `  1N 1㿘 %> x   (1= & 㿘@" < <& <! J " <!& < 㿘   '> \  +> -    2 @^  r` \2  > -r 8> -r h֬ 㿘H o@> -r x> a >   @"`@   > -> -r~ 0r{ 㿘>  > "` @  ' @c -> 3> U b* "@*`0@*` ? 5   0  "  0 &0H /d * % ⅐ 0 $ 0H 0䊐  > -r.  0?  > - r̐``㿘`  2 -> "Ԁ` > %I!,㿐  -\#\ِ 㿘> #" ` > -`@  t   t L`& L`O " t㿘> #" `> -`@ڐ   t??& t> -p  L`  & LQ t㿘`IH /d * % > -  p`.H 0@  H /d4t* %t  p > -oʐ!H 0@0H 0H /d * % `l` `P  ````P &```p` 0```P &``9 %> - P &,0 0  &0 O? "lH 00+V0 &00``0 &0㊐π l  p > -oG!H 0 㿘H /d4 p* % p ' > - 0   0 o$0 0 $ 0H 0 \`0l0Ѡ`` > -H 00 H  p` H 0> -!XU0H 0㿘> #" `> -ap@ `\ > -nՐ!x&`\ <? ?  &`D&`D l &` l`"`  l& l&` 㿘> #" `> -a@q  \ 2 > -n!!P#!@  `"  "`   "@&  L`"& \ p 2& \ # L x`" | |"`| | x"@& \ P`2 L> -n! # P` D  \`" ` `"``> ""l ` \"@# \> c\` \# ``""`㿘> #" ` \> -a@   0"@`t`%&`tc ` "`   "!P!& 㿘> #" ` \> -a@  !P#!@  `"  "`   "@&  0 2 L L`0 l p 2-@ $ L x` |"`| x |!"  p <   > %!\> %!\2`@ :`  `> %a\@0Y > %!\@@ & @ "` $@& 㿘  > -o!> % 4  4 @6   $  $  > % 0@4"0& $" (`" @ 㿘> % 4 4 $  @5  2 $ 2     $$@4     4 $ 2 > %" 0  <  㿘H /d4 D* % D  > ,mq!@ L "  P> ,!Xђ> ,mf!x `& L> "h> #\ < 2& \ & \ \"`` \""& ` \& `"@"H 0 㿘#> %!> faX  Aז!!> f`"$aX> %X@> %h> fᐐ H4L(L x"|| ||x L"L> fᔑ* "xx |ᔆ "|H 㿘>  > /> %"cp+> 9> f7> %)> %5> 3> -h! X* `@ %h%hH /d@ * %9  @h  /H 0  @ @HH /d4* %  p  > % < "> %> -l"0!\j 2ǐH 0@- !` ?%!``hD (bP LF h㿘H/` /> cp l>  D@Nΐ H 0> %a\> %2 !` :   > %!d`#!`"!d 㿐> #l  0$  "`H> f> f a "`<"> %!X > fᄓ3 2   : :`#a  "> %!X2 :`#a"  $ 㿘  "X> %!\ؐ >  Xq  `< ?`$`< @    " `< @$`< s 㿘 D 2X  @r 0" x`|"`||x"L "L "H 㿘 > -mq"X "> -%m> -mh"h p> %!> c ' 5 }` ZxA tؒ D ''''' g`@耊 :@ 2XАX  <  <@ @$ < l` 4֒ /``!3 &`  Ж  @`@@ (`  4 "`" `! y &`@  " < e @  w !> % 4@`` 2`$``Mհ @.W  4``@31 2`$`2:° -  3  (Ő!@.!> -   "   I @>$ $ `  <* @ $ <`@. $ `$ l` " < < `@$ < <>ߐ# $ <`  ~ @  $ <` `@ 2 <@U$ x <@@"'$I <@ $ < <@*@ $ <$ < <     5 "$ $ ER 26 ` $`> b\$$ b\  #"\""\" @5 @ <`2֐   D `  " )Β x > -TE"㿐 D 6   € "> > -j"!H`%> ` 2  F$  2 `<$ ``2`耢.$5P@ D'''''̐ /@ X `l@  38 "`<0`<@ @     +  `@㿘 < ?& <㯐  " < &  < 2   @ " @    >  < `> 1>  `X!@T"\"\@ "` \@"@  `-'> '> !H $ `" ` TT@2`  &`` "  TT@2  y&`   2 $`  "  "> -i)"`X (  㿘> "\ @+%>  X "`<` 2` ?$`< @@`  @ "``< @$`<`|\@ڐ P@ @'''''͐   X `` `@`㽠> #@ @'('''$'',믐 2%q X  D  2 <>*@$ D2  Hv!'l'h`u! > -R"؁> #D'@ (@ @D`( X 2 `0?"`0D`, 1 J(`0-  D D`0?"`0D`,  J`0 2 <>*@$ D1  Hv!'l'h`u@! > -R^"> #``'@3{!> "\"\@@D ?#H/>  X `1@*(`D`` @`< @$1h vP!'l'ht! a@x\@Ő` ( ''ic' c > -Q"㿐`@@ i K (`0?"`0`, "Ik`0`@Q <`  `@@֒ @ $ `     ` €    @6 $ƐP@ D '''''@2 ` &`P 0ƒ 2@ D'''''@  "  $  $ 㿘(   <   `@@Z @ p0@ Т`4 _0  ` @ $ `` @* 0'`8'8$`\ '\'<$'d 08  ;8@ \   ?`\0   ?4 В0 &?"h g0H $`\4 2`4> %2 4!"4 0("`(  ?7 ? 77   0 @O4 @ ;0`@ I4 24`@ @4` 2`X  <` `<  @  4  ?@ ̖   @0א4 ]0 @0&4, ?",4`0?"`04`,  H`0 (> #'/ *@ D'''''1 А@)  X d' h' X$w `s  > -P<#> #' 'L/u c``  @`bΰ T BP c@r  P 2  FL` ذ "L'L`< ` -  !@  PdL`<  @ ܐ PL @  PdL@O L @ 1L@ M`X  ?pL@  dPL@  \P`L`H "`HT `2`T 2 T> %!"`T`0L/"(  ?7΀` ? 77̀`  0L@ LT @=  PȐT N0cL`@ T 2L @ P&T, ?",T`0?"`0T`,  F`0 PT %L c}c > -OJ#> #'. )@r   ! 2  Fl` ذ pl@ Il `q ` > -O#(> #'.L 2/(@qϔ  2'ؐ 2   F` $0 2$ X H    <>*@`!'Hq > -N̐#8.  o ` `j @ 't 'P'x'T'|炐P ]` ( `<`$ /`* `  7 '8    2  '' '  2d` @ dtd@ H  d@ d0d`t@ G@ td  @  'P't'x'T'|P 2-` d@ ~t`@А `` `ɰ 0h  '$`  *7d@  d`@ tP@ @'''''ې : <   ` '''''ܰ & "`@ 0@킐  { 0 @ =`@ 7 Ē@ ԰h  !$@$pC 2:`  'P't'x'T'|慐P -` d@ t`@= `͐ `6 Ր`$ `8 !7@ dd`t@ # P@ `'''''F . @2`@ @ 슐   D @ IJĒ@ "  @ sāP@  '''''  '`@ @ qĀÐ0TR @j @ |  @ v Ĕ@ 8 @  2T I 2F  (`<  ? ``? " `  ( 02 / ` @ B '  @ B < @  ``@ B  @ C < `2``  `<   >P`?@2 ` D $  ` $ @''''s'ܰ 2$ ``*`` !``2`@`@ @ 뱐$ $ @ D'x'P't'T'|FP `@=`  + 2'`o: `@ 'x'P't'T'|"P `@t`  + 2'`o `P@ D''''' `@ R(@ ''''' ! <  `` `  ?''''''''@ /а'`" &@ @'x'P't'T'|亐P 7` @ A`@]`X`< % `?+ @ ?   `'@ސ0@-@ I  (@ `@`X "` < & `?*֒ @ ?   賐`'@@  `0?"`0`, B`0`?@- @ @'x'P't'T'|P !` @`@`X`<  r` /7@^W0`?@8 @@ 1  (@s`@`X  <  ?` /7@+@ o `0?"`0`, B`0@ @'x'P't'T'|㮐P J` @5`@Q`X`< 8 `?`? <*  2> %!,`<@і ?Ð*@ <##ܐ`7`''@@ƒ鿐@'P't'x'T'|WP J` @ސ`@`X`< 8 `?`? <) 2> %!,`<@z ?Ð*@ <##煐`7`''@@oh0`@@ X`  (@`@X`< 8 `?`? <)^ 2`> %!,`<`@& ?Ð*@ <##1`7`'`'@@@_ `0?"`0`, Aq`0`  @J '''l  D耢??'?2@?'@ @'h'@'d'D'l}@ - P @`@ `X`<  + *" " * *   * *''''@@諐 泠`  @J '''l<  O耢??'?2@?'@@  =   (@`@Ȕ`X  <  + *" " * *   * *''''@@X@ `0?"`0`, @`0@ @'x'P't'T'|ېP +` @b`@~`<` @ @@  %`?@ 0@Z@ 7 2(&  @(`@D`<` @ 2`? @ߐ@#  0" 0`, @5`0㿐@@  , (`@@7  `X "  <@@Ԑ@ `0?"`0`, @`0@# `''''', 2< `,` '''h'l'h  @ؐax`|< `< ` ` `<  " "? $| @ @xĀ  @@p` @S @ @eĔ|@x@:@獐``"@)}{p`  "rW ? @ `'t'x'P'T'|P /` d@tdN0I ` '$`` *7d@ d`@t `P@  '''''V 2`<   " `@      @ @Ɩ Ĕ@a@Ā08`  @@ '` 2`( v''`< "` m' `''''''''`@   ?  @6'' @: `G`耢@> %!Ȁ`ؐ????Ȓ@  )`耢@2`  @ "`  X`< "` ` '  "(i:` i `'"@& 0" 0`, >R`0 $ "`2$@ @'x'P't'T'|vP $ `@  `%ڒ  `D `@ @@$ 㿘t 2R`    `0  "`0&㿈@ ` " ` 2S`  `(`< 2` ?`0 #`0#\ ``m㿈@ : " ` 2S`  `(`< 2`0  #`0``?` #\m[㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\m˚㿈@  " ` 2S`  `(`< 2`0  #`0``?` #\n t   < < 4 4 <8`,`d$b ;  $`(i$`$ L$`(u ` 2`֐`'7@ ``@_`$ {#`@Ȓ`$``@ `䩐 `h$`h }$`$a  D$`(= ]`<  T -bP d` !@f D`d< = @? 8 @S 1d"< 2 @ @`@d  ?@Q @  ` H &H;㿘 X <`" @ <` >!*` €   @ " @>    @" @㿘` H?$ H@up`d hl`@P'\ '''?'쀦 '' '@@$  "  @ 㿘( @`@@ > < *  @ƒ@$ @ C >@@ 㿘 ( `<   2   2  2  `X " < "  @`@Ր@>@ @$B>@@ 㿘 (@8@M "K&@&` <?`>!*` €  ( 0&  *2 @ 2 >`86`6` &` &`&`>`0&`&`&` &`$&`(&`,&`@&`D&`H8`( <?`->!̓*` €"@0@@ 8`$ " 3&"z@ T`@!%!@    @T`@  a@$ ` "$)$ "`㿘  (@V 㿘a`@?#%#> - @! "@@ڔ  @ $ @ ch 9  @@2 @㿘  (lV 㿘 (@㿐> %" 8"''*` €㿈> %"@ 8"@''''*` €㿀> %"l 8"l'''''* @㿀> %" 8"'''''* @㿀> %" 8"'''''* @㿀> %" 8"'''''* @㿀> %# 8#'''''* @㿀> %#H 8#H'''''* @㿀> %#t 8#t'''''* @㿀> %# 8#'''''* @㿀> %# 8#'''''* @㿀> %# 8#'''''* @x> & $ 8 $'''''''* @؁㿀> & P 8 P''''''* @㿈> & | 8 |'''*` €㿈> &  8 '''*` €㿀> &  8 '''''* @㿈> &! 8!''''*` €㿈> &!4 8!4''''*` €x> &!l 8!l'''''''* @؁㿀> &! 8!'''''* @㿈> &! 8!''''*` €㿀> &! 8!''''''* @x> &"  8" '''''''* @؁㿈> &"L 8"L''''*` €㿈> &"x 8"x'''*` €㿈> &" 8"'''*` €㿈> &" 8"'''*` €㿈> &" 8"''''*` €㿈> &#( 8#(''''*` €㿀> &#T 8#T''''''* @㿐> &# 8#''*` €㿈> &# 8#''''*` €㿀> &# 8#''''''* @㿈> '  8 '''*` €㿈> ' 0 8 0''''*` €x> ' \ \' 8*\''''''' @؁x> '  8 '''''''* @؁㿐 \> '''8*` €㿐 \> '''8*` €    㿘@  " > .V"8`@   㿘@}  > .V"H 㿘@s   > &  $8*` €  㿘  \ " @Z  `0("`0H /d * % U H 0  㿘 @ *@&   2 @+ > &  " 8*` €㿘@  "       㿘> .W"`  㿘> .V-"x㿘 @! !> . "& @ " 5  @!" 㿘a6`,( * `  '> .`2@`  X2@!>  ג B  W 0`2` 㿐aNa$ `< "< @ "@a`<?    "` "@`` " "`$ $ $  &I `<? `@  "<> '  `` d  `"`` > ր " "&`<? `  "<> ct" 8(0ެ&a,6`a( *   $ " " $  @  㿐!C  '!  `D 2 > .ᨐ"> .#ᤒ> .U9#  &㿘`  2 D> .V֐#P #> ..  Vϐch $. > .Vɐ#p> .U#x > .V# #> ..  Vch $. > .V#p> .U# 㿘!  " &@7>  `&@  㿘! @> #H'! @!   "H& DL&@P@ &`T&`X&` \&``&`d&`&` d &`  h Z&`$c`T` b Z `D`@  c > .># 㿐!@   &3  &㿐!@      ݳ&㿘!`  `0`4&& 㿘  X $ -        @'xX8!a> / Uސ   ( x  $ "$ @ 8" $ @`$ @` "@O<`  2x@8*` €  @?)  ax"@ ` `>      `"ݏ@<`  ݐ @ @ ` @ `X g㿘   @  " X <`" ? 8  C >     m * `&  8*` € @ @" X <`"   2 @ Ҁ ` ܮ"@#  X 㿘 @? ?2X ?2X$?2 X,?2 X?#@"X <`2$ ?2<?"X<?` >Ő#@*` €  X <`"X a㿘  Xa 2 X  d"`㿘  <   2 XX <`"X Xa㿘  <`8 XX <`"X a㿘 `@ ! 0 `   ?``  `   ,   ?`6  `` u 8 㿘  @ !    `@2*@   `  N㿘 ` "` 6㿘 Xa㿘    <`ݭ 㿘  X!   " "`"`"  &  㿘 `&  8*` €㿘 > / S֐ 0  `㿘  \``B$ \$ \㿘  \``E$ \$ \㿐 <@@2 -@& <  Y^ Z`@"  @ Z> / x`C   㿘6` x  㿐  @   "`< @ "@&@㿘      D `D*`"  * "" &`&` &`&`@&`&`&` d` _  `T_ Z` _ Z `@   ( ( ( ( ( ) ) *< ) ) 1 2 2 20 20 2 2 20 2㿘> U p > #> > f!> f1> /> O">aa  "  , 2  *  〖Ḓ  % $c| ؐ!    㿘>  > f!    F> fa> @|* @@ >  2 `X2    2@ $& 2 > #x ؇ !   "`?$ $ $ $ $ @ $@" $@$ ! Ɣ 㿐  `  `` ` `N .2%"  "~`*`˰ 2`> /`@  2`X   2%%"`< 2#`> /`@j  2``, " a$ ` 2X   ] 2% %"`<  0$> /`@B  > /  > /a@6  > /> /!  a@+  > /! NX $ 2l% `" %U" < ( > /a @      `@$`Xo 2J%`   Dݒ  >`*@:$`А  , *`* :` ?Ѐ  N "` 7  X і 2% "`% %`     `@$` 㿘  `>Ȑ"@*` €ర   "`\> c  8  8   ` >Ȑ"T*` € `@% $` `` !m!m  4`$@4`$`D@f` <`> #!   4`$@$`D4` <` "4`4`<`$@$`D$`$` X" d> $`$` 㨐  $`4<`H$`$$`($`,$`0$`8$`<j$`@    e  ???????????? 0 $ 0 `  0 ,?`$ 01 0Cֵ< @ > %2`   $@4`?# @4`4`$`$` $`$`<`$` $`$$`($`,$`0$`4$`8$`<$`@$`DЖ @ <`H> /O$!(@$<㿐` ` `  ` = @?9 -7 `  .@?* -(  ( X`<   <  -`` 2v  0" 0`, 0`0㾈> # '  `  2  `  `  @p   7` 2L ,`> '* c쀢~ > (`(@y ` ``2 `, "'a$ `2  @:헐 "   '\/ / "k I C`(@&>@6: 51> / ```  '! /\ , /Y `'> /8P!// "/  `  Ӏ`<`<c > /88!@㿘 `< "` `   -`@ "㿘  `  -> c d  㿘  `  -> c s  㿘  `   -> c     㿘  `  -> c   㿘   R$ < 㿘  `"`"  H &  `>Ȅh(`  ` "`  `    㿘> /O3!P 㿘    㿘   ּ 㿘> /Mn!p㿘> #*` €   㿐` 9   2 $`  b   $` $ T  $  " $ 74 ǒ $`$ ` 2` 2     $    2  $. "    $   2  $.  ! K  G+> () !a  ,  } 20  . $   &   ! +> () Y!a  ,  V 2      㿘    @> /L! 2 5 "`!4`  !     `@2 ` ?4` " ` >4`  #2   ` " 㿘  `` > /LV! "  !4        i `۔ `  >4 `  "~@"#       'h  "  "  ` ' h  `   ` 'i  0"  ` 'i   㿘   y  "       㿘    `? $``  " D` ? $` @D  @` J  $㿘> /MO!@ > / MI!Ё㿘 > / !M@ " "  "    "     -㿘> /Kr"R  2 > (h" 8L> (x" 8| <`$" "`$`,2`,  <p  "p`2``"`px2x <L"    2    ?(2 `   <  "`2``"`2<`|` ``"4" ` 2  ?(2`  㿘> ( -> d ("> U p  %> (?# '?b @ `2 @* * @ @ [K$b  `p  ?> /$Le"8㿐 <@@2 -@& <Đ WE Y Z`@^"  @Z Z> /"hX   㿘6`    㿘> / @ΐ"p@R  > @ ` 㿘> B&@#`#`&`#`> W&``>  > ! D#d" "&`&` &`@ &`&` d` X  `TX Z `X Z `D`@   Lp L L L L L L L L㿘> f> 0!h   > #"#"` 㿘>  > f!   W> #  `X2   `2`@ 2   > 4& 2   ې > c d    a$ $ $`$`<  ` 2$` > 0@a` 2$`@ $`@$# $  "" a  㿘 `""`> "#"  U &  㿘> /"Ԩ   @ 2`@@Q 2`㿈 5> D_"&  0%/c 0i> cY0[ 0k 0@4> 0pKH0> 0KA0 @ J?`  @> 0a@ڔ0ut&> ! a@"r   @ @j " e @ 6"@ "" 8 !` &T> "В>  "  8> !C We *.*  T(  T> 0#\J0 > W > B#` > 0" * J˔0> W> B > 0chJ+ 0@a @&& 㿘 / _ J?` "!> !W> !" 8J?` "!> "W> """, 㿐     $@ *@ ? $ U   2  J .2 $@͐H   *  Ԑ 2  ; 9  G2!X ?"1  ~ )  $@I 2`  @- @#``  @$   㿘 `@ 2!m` `   ܔ 㾀>    `# '@ ~$$ X" d $$ @3a<$$*`" *  * $4$8 /`" $$:   44$ 'N! 2< <# > 01!  @ - 㾈> #  '< 2 -` '"!   c > 01ǐ!㾐> #  '< 2" -   @   @8 2  ".  @. > 01!ȁ㾀> # '  <`E  8?    @   7> /bБ,` & G2  ?" M䀢 " `  'U/ / ,    ``$ <`<# > 018!؁㿘   侮 㿘>  D `>τP(`  ` "`  `    㿘 > 0`!   H  㿘  4  㿘  *  㿘> 0FƐ" S l u@`<@ a`ge - D&(&&$&&,ɑ Z  }!4 @ ǔ!4$aX$`< `< $`<ͤ> #> >Ŗ\  >Ę $!$!$!$! $!$  !,$!0$!( $ `@"@$ S Y Z@$ @  ` YR @@ ~$  ϕ!( 㿘!6` `D   Β 2у!(͒ !ʒ @&! 㿀`<@@~ -S  x  r( ` > 0?"0`, c ,'`0_ ,# l谒   0" 0`, N'`00J ʐ  @" Đ  " <@ "@`" `"`" $ $  " `0?"`0`, "`<'t`0`< $`<$aҐ`RS Y Z`@@ l$ ` YRH `@@ a$  㿘!6` D   & 2Bې!   0 "0!(! g! @$!㿘!>  ` ά`&@㿘"   D&`&` &`@ &`&`&`&` d` S  `TS Z `S Z `D`@  [ \ \ \ \ [ \ \ \ 㿈'蒒 > 0Fݐ#0㿐   ``'%@? X `  > L .> %UK #X̀  2> "`<    "` L +> (`J@ `"$`   ϐ & S<&cX &  %cX%e``  l`@$` ΁㿘`"! =VV@@"` )  2` =   沔  &```'t@ 'l  \  X a ఒt ltbP 2l` (t lH /` * ! t` `8 '> 0` `>   *t  6P$% t` `8 "`H 0t`8 2`zt2 tx x @ @3 xtਐ @2` ``'x`'|`'` R7 P'''    ?؞P''t ''''' 8 pl 'plh耢 ' &` @'ht'p ` Vp "l  'p @l  " 6l ْ`>l`@?4  2` 4 = `?> 0#`Ex $  @?` Ւ 2` R`  u   =H 0l% \ l "tYt ɒ t㿐  ` @I$ $  X  d""$ < $ @.Đ $ $ *`" *  * $ 4$ 8< H$ ($ ,$ 0$ <$ @$ D @  !$ 4 $ 4  !4 4 $  $   @2  @ -  㿘   ذ 㿘    " Ӓ &   Ͱ  " `>ԄT(`  ` "`  `    㿘> 0D# 㿘  ` J 㿘  V @ 㿘> 0B#X Ȱ -> Bc`  Ɣ `1? ``,> 0ЖaD  ɐf 0`  `4`Z    &`􀊠2` @?` =` "``  Ț   '?''''''@?'䰒 2k``    '?'''''''@? 2W` `   K,:I`  ' ` "@`   '?''''''@? / "?`@ 2M "        # 6" 2 `  *'`` @\&`Ò 㿘#`4 4@2`, ( @ے `,6a<`H(@&`,`4&`X  N`1  `H`,(0)6a<> 10|}4> 10w`,(} 7`H&`,`4`X " `,D `,*@&`,#x&`X_N`1`  &``,  @>  @r` J&`0O`,(1 N`1  `H 5> 1! X !g N`1  `,( `H +N`1 2' `H2# `,( N`1 !> 1! "` != N`1 0 Ah"hN`1  #ː x> #' 7 - 'ܐ@,ܰ .> 0ܒ@M#  -`> 1ܒ@? P "N`1 2``H2 ``,(`#6a< `  > 1+5"x㾐@ْ 9! $@@  `  &``, `@=O` @r   2` 2 `N`1  @r!` ? &`> ,2   X> B#` >  h l(   +*" +@ ( , + +@ #t* + > 1'#h#l#p#x;#\#`#d#|##B" 2  "@  `  # > 1*#ȁ㽈> #"''@%쀢  `2  "@@''쀢`  b# > 1*{#"@ 㿘  @ `,@ ` `   "`` @=@Z` 㿘` ``,!@  `4 2`,> "Ԁ `,@ # @> #耢'   @'@  -# > 2* 8H 9 P $@@  `  &``, `@<3` @p ̔ 2` 2 `N`1  @p` ? &`> ,2   x>  H  4c '24!$       4@ #> 2@ $ ,` @L!Mޔ /`@ 3> 2#\AU!`ߐ@ $ , '> 2 `#?`l 2  `n > 2A<!`@  @ ޔ,!$@ ٔ;L@ ԔD ,!?A ?`@  > 2`  > 2!A> 2``א@ ܐ!$ ` `> 2!@> 2``Ȑ@ ȐL ,> 2@!`@  , > 2  ؔ Ԓ!@ڐ`@ @ |# l> 2ؐ@ɒ!`@  a > 2#\@!`@  l > 2 > 2@ M @ H#V @ CF`!> 2@!`@ ^ > 2  @!`@ OV  > 2'> 2,   @m!`@ V @ 7V  , > 2@X!`@ '`@ !  > 2(! 㿘   -   :  &@4` D  q< qX qX ql q q q q q q q q q q q s` r s s( sD r r s| s s㿘> > 2#P  Ҙ > f!"!"` 㿘>  > #  ܖ p> f!܀ 2 X2  ؔ > fR&@2> # Y F#@   $ "" ""* "">ې#`. €!m2  $ <$ @!$2 $ <!m2 $ <! !$2 $ <> 2=!X" " ""  @* # k 㿘 `""`> f"!" ( &  㿘   `  24Y  2  > "Ԁ`$ ` 2 K ?` F>ې#*` € L; b4 ?- & ߖ  G a   -㿘  @"!   (  "  > .@@  J?` 2&?.@& 㿘 @   2 㿈 <@@< - I̔  1 " <+ ' < & < @  &! I[ Z Z`@t"  @p Z> 2!K !LJ  $`㿘@  > %!$`   * 2!- @&! 㿘 n > @    h@[> B>  > "c`b(&`Ԗ Dؔ c`#@ &`&`&`&` &`&` d` J  `TJ Z `J Z!LaJ  `D`@  y8 y8 y8 y8 y8 y y8 y8 y8 y8 y8 y8 y8 y8 y8 y z z z, z, z z z, z |P |\ | | } } }8 }D }P }P }P }P }P }P }P |, |, |, |, |, { { { { { { { { | |  L㿘   {  2 "  2   (2     "   ($  ` >݄@(`"`   "       㿘  (`   㿘 `>݄|(`  ` "`  `    㿘 > 2`"` ` `=-`㿘    㿘   Ķ  x> # '         ¦ !> B < $@ 4`$`$`@#` $` <`H@&<`$`4ܑ*`" *  * $`$$`($`8$`,$`0 ` >ݐ#ܓ*` €,!?`" @4` 4`@ $``$`  4`$` $` `L*`>ݐ# € ">   4`$`$` 4 > 2<Ґ: <`6<`H   <`4`$`$` -<`H 4` " $``<`$` <`H - #`Ȕ  *   :  P !  <`H<`> 2:"# > 2$Ԑ"Ё 8      K㿘 >    `%@`@*@ ? $` ` 2 M .2%@Ð    `*  0@ `   > 2`"@ `?`   `> 2"@ `?`  X9 Ӏ`ђ ߔ`@$`> )!h > )!H `!h @@  !h X€ !h !h X ` ⨔`@$``@#"@u X  }`{ ≔`@s$`@  }`@$`XV b``v  Z`*@V$`B  L> )!D> )  E` `D @n  D " X€ D  +@ 2 '<` .`@$`%@ wX ` `@$`@    @ 㿘a `    㾈>   c '   ʰ @  7 B 2  > ) - @> )aD  "  X€ " `` *  '  Gs/ /      D& ~> !H  u r=  K>ސ -  €  > 2"`'/G@ ,@K/  '/> 2"    '/> 2" G* 5/X!`  . '/> 2 "pX!` - '/> 2"xG   /$`@4> 2 *  '4!: //     `  = = > 2""㿀> # '   >  `4> 2 :J   > 2b@  \ c > 2"u# # Є #* ((Ї8 #2   ȝ㿘> #*` €   㿐`X``  `<  <`>#*` €> U p  ` ?3, ` .> bԀ  , * > Ob"* `$@j Ԁ , H\? ݔ  `D U S@_Z N , > O* "b*  $@  @ $@E```A0.> O" * > "Ԁ`` ?`  > N, #"@*`    , "> Nc* @`` x     > 27j#0  2  >  " > 27^#@ 2<  > 2 > O *` * " *   `ؔ0  6 (` ' `> O" *"> N*c" * ` @`   `h@   `  ` "  (`` G'' ( 2@i > O L @  > @\ &@ 8 `?'#\#`ٚ ?" @"@8 H 쀦 " 06#Pݐ 㿘   9 㿈    > 26#` 2 <>  "<> 26#p  > 2 > O *` * " *    `  2 6 > O ( b*"> N*c" * ` @`   `h@   `  ` " ``"G  ( 2@>=` H`"F@   @ %@ 8   $ '?`@%@@8``H @@`쀦`"5# 㿘   < `` -> 2* * > O" b* `  * @ *> N*"@ *`  @ > N" c* ` @    @ 5#㿘 `< 2 `> O *` * " *    㿘 > O b $*`  * " *  @@ (   € 㿘 < JH /d4p* %p  > 2 0   0 5P< 0 $ 0H 0A0ڠ` > 2  p` H 0> 2#0H 0 㿘  p   F> #`"> N@> N, #"@ *` €  "    "     2" 㿘`  <`/ `U> 2' ` !$ ` `!$` " 4 @!+4 * @*`> O"@*` -``X`  `  İ`D  4 @!4 > N* "@*` 4#``㿘 ?   > 2 2 #6+ `>(`  ` "`  `    㿐      #\   㿘> 34M  6?@  *@2 ?*  6?` ` 2 ?*@㿘-!a8c<a4`ǒa  >>Ēcؐ Д  $!$!$!$! $!$  !,$!0 $!(t $t t`@"@tp$ ? Yp Z@$ @ x` Y?pp @@v$  ޒ @㿘!6` `D   ƒ 2 {!Œ @&!    @  'xX!8'ta` > 3 4   ( x  $ "$ @ 8" $ @`$ @` "@*<`  2 ?"" ?z&` `> 34w X "  `> 34j! ?%'t "U"` `   ``> 3`4P!8X  x``> 3`4C!px@8*` €  @?)  ax"@ ` `>    > `" @<`  ݐ @ @2 2 @2   `X  ?`  ?`> 33!?"   '@`"   `> 33א! ?!` ` ``> 33ǐ!t @ " `> 33"(㿘    @`X< "? 8  >   `鹔`P!`  > 33"X ` ~ $  `> 3 3|"h   `"> 3 3n"& 8*` € @ @"`X <`"   2 @`   "@I  6   `> 33,"؀ $ ` ``> 33#㿘F " F X `d"  `X!  ` > 3#82  Xa8c<a4a< `  " > 3#h2 #"` `  " > 3#2Ғ  ?#"`  㿘 > 3`#2 㿘 X ` a $`  `> 3 2#X  `> 4 2 ͐q$` 8>  @8 26  @" @؀`' ! ֐' Z` s  > &(@  '&@  > f| 6 >> % ȁ 㿘> f"d.    "  " > 4  T  㿘> f"d.  `"  +"㿘 @ 4@4   `   2 (  (  ?& (`"  "` "@"   "?  " ɒ &   "?& ??& > 8  "???& > 0 > f!, & " @ " &  (`& (|㿘 㿘 }㿘 < 3 ???`0 2 `4   :`02`8`8`< :`8 @v= 㿐a\ ` ` `> 4/  " `< <@" @'     "' '􀥠@R 2  "` #> f #> f"= `"97`"54  #> f,Ð a`"` 2@`  2@``X2@>      `2```r@2`(`( 2> > 4/   "*`  4`@ $?"$!` > 4/ `(`> ``(> 4 $`(`(  ˘ ~ ` $`( 4?$`@` @` `"` ` "``(  ?$`(`ޒ    $`   쮐 $` =  `*@ $` "`s` % > @4  0>  Ȓ  ` U  gLc  q H`"`@ "@`< <"`<??$`$` <`8<`0$`$``  $`(`$`,$`$ $`(>  "? 4 $`@   $`   9 $` <  `*@ $`$` $`$`> f!, $@ " @ " $``(`$`(㿘  (  ?$ (`"  "` "@  "  "   "   "   " 흒  횒 &  p   ?''օg !ԃ w Y  v@ 봔 жت )@''''''   ?% '''''' 耢`  A Ф4@  a4(` 5$(`*Ė  ԍ  4 ԏ 8Đ7<'x4԰ 4 @5 `$   f4 Q$  $$В 㿘\ d' 0 ?     ;x'  ' `*  '' '  `2  '  ' '  M' ה 2 0젒 ' #\p "" A  |'7]  4i  &` ]@t#\ `S0̀   a^ 0` Տ  L $%@`@98  ad'] ?  _ `:''` 't'p'x'|` '`''p`l0 ;`l `Ե`l@ll 0"'` ӽ4`(l lA.  l  H`" Hl%@ql㿘` H?& H8㿘@ (  ?& (`"  "` "@ (` > & (  Ԕ 8     .  ؀   㿘>   8 `"@" &@`&> 4+ѐ  &    ۔㿀`'U  , ''Ȓ  '*醔 '  "`,"'' @'  `"@#\#`  X Ř  " ,`" , 㿘 ,    , & ,㿈<@@    -87   ~ P&(&&$&&,$  &<   @   ``$ ``    | $  $$ $Đ $$ < 2    f  $ @ "@ $ 8 !`$    X <@ "  X`< "< $<X<< ` $<$ Y7o Z`@"   "> 4  > 40 > 40 > 4 !8!H> 4!X*!p@a9  Z"@?7B $@\@0 6 @ `C`> @ "@㿐!@56` `- %>  T`D (`   "@ @ `! @$!㿐> !   2   " В`    i  #\#`  n ` ^   Ğ@ ( "(> #!H'@!    X  2[TX&` \&``&`d&`&`X  L LDHP&@&`&`` :@L&` `:@L&``:@+L&` D@T` X\`d`&` ` ` `@ &`&`&`&` d` 7  `T7 Z `7 Z `D`@   > 4! t X X t t X t t t ܝ㿘 ` (`& (㿐@@ @ 1 X' &@  @ 2 X* 3"# @2`ڔ   ` €q " & < 2& `&  >   X  ల `쀊@   < " ? 6    $ ` ``'''P'`( 2 p )`(`$`( vk @` @`( $`(`i  `"@  ?$  ? @2      ؀    >`2= `7$ 2 $ `$ $    .` @' ' '`"@  ?$  @ ` `    ' ``?  ?$ 2  @"X <`"   2  " f % <`# `( ?$`(з`δ`( ` $`( ETA'  Й #\#`XF   "9 $@ `  @2 q    J`. @> 4!'˔㿈   `' ( > ( $ ( XΙ  #`#\  0 㿘   `  - ( 2 >    r 㿈   `' (  ( $ ( X_  #`#\  0 㿘 ``    7 ` < ?4 ` ` =` ;7 <? 8 `$  X`<, `$ $`$`ͷ!ϥ 0 <? 8`(`X <` `( 㿘  ` 2& `$`?"`$2 & > 4" L > 4&"8> %"8*` €㿘   X  ` ! <`>"4*` € X <`" >  "( 2&  7& > %# 8*` €) %`?& '> % 8*` €     &  8*` € `8`  ` `(  2` ` `ͦ 2F`? ?s  2 <    20 ` `͉ )`? ?V ` "` 2`R`T  "``" `T  22` `X` d"`㿘 @? ?2X ?2X $?2 X ,?2 X ?#@" X <`P  ? ?"` <?` >"X*` €< X <`7 ` 2` ` <`2`    @ 2 #`  `( 2` I`     ?2 ?? ? 㿘   "> ֐`? ` `6  ( 2      (   ` ``04 `4   ?}?0`8  `<  ?m?㿘 >   `` > 4%N"P ( 2 ̐  ̯     0   4  ?A?㿘   " & > %#8*` €㿘   " & > & $8*` €㿘   " & > & P8*` €㿘  `  ` " ``?`ˁ  `( 2  _  ̡d 㿘` ` `  ` > 4$"x 1 ( 9 ( $ (`( +( $(`    & m u0 2    X ` ``㿐      `> 4&"Q  `88@"I'` 2E' ` `2  ( $(    `@2$ `'> 4$;"  ̔      ̾ 0*   ̶ 0  ̱` ' `"  "(Y 0 F( $(L 㿘 > 8       J( 8`Ȁ@2 8 <   "   8`Ȁ@`  % ( $ (  ```8 2 ` ` ( $ (   ˠWU`  㿈` `  . (  Ð ( $ (` `˅ "`)`0 #`#\X `` 0 㿘   ` > 4#P"` 0 ( ʒ ( $ (`( t`( $`(z 3  $ ? 0 2   X `E VT㿘    ` ( 7 ( $ (=    3 㿘 >   `  ( 2& ] & > &"  8*` €㿘   "> ֐`? ` `W & ( 2&  5& > &"L 8*` €7 㿘   " `?( ``& &  2&  & > &"x 8*` € 㿘 ` ,     , $ ,  (` 㿘  㿘    ` (``.`@ > 4#"5 > 4#0". $ ( @$ (  `?   ` (  `D   ȱ " (< $ ( ( "  (> 4#`m> 4#x" >  "  ( 4 @@2 ($ (> 4!#> 4 $ ( (   ` "? 4$ @ ( $ ( (  $ (㿘   (` > 4!ɐ#>  " ( 4 @@ ?$ (> 4!# ( @ > 5 !  ?`$ ( >  ( `$ ( $ (R ( ( $ @ @ ?$ (F 㿘 >   ` `?` & ( 2&  & > &#T 8*` € 㿘 > 5   P#   ` `> 5   `> 5   ,   !> 5   2  (2  㿘   "> ֐`? ` `ǿ & ( 2&  & > &# 8*` €ɟ 㿘   " ȼ    ȵ E 㿘   " & > &#8*` €㿘  \  " & \> 5 Ր  0@    > 5 ɐ & \㿘>  > *`" * "̢ @K%> "̒ @엑4` <@@쑒 <* .@@슒 * > 2 Ta@> Ԗ ,'"Ԙ  !n!m:"`> 5!> 5!(@  @" `@:*  '4А8D* @4Ѐ>  6&% * ,  , @Òb.6@㿘 6` &k& g2`**`" " `* * .`@ * @ d@낐> @@'> =)> ?" 2` 2   ! "!n!m  `> 5!> 5!(6  ?> 5!@!  ? : ?*@  ?, @*`" *" * b $ ܓ*"@ *`@  &@Ӓ d* "*"@ *`@*`@*`&  > 5U> 5p `> 5p  (   > 5> 5pp  ` `+``   " "*@ .*@ ``  > 5> 5pp  ` `+``  *@㿐  ` *? 6*.`  .2 2.@а@ .  . .`@ .@  `   " ."       .`"2  < *`#"@ &  ?> 5!p .@ `2 @ .@   $ &   ?? "? ."?   > 5!p .@  `2 @  .@   $ * 2@ _.@@ ` .@7 5  @꼒  0?,@   @ ?@ "&  " @ "  ~  .@    @? "."(("@   ( ** *  * 2 ? (@((` ? @((` ? @((`   @*((  @* @ 2?V? ?+` (@"@ `K@ > 5p  * @   7` 3 > 5p   @   #`  > 5p     ?@   `  ?<璂 @a ?a @ ((` *`` 2??P`@?((@  +` `/"<+? `4< `  +` `/$0 ` '*`8+? < `  +` `/" +? `  *`+??<   ( @0`㿘`? " .`` ?` "`."` ` @߽ 㿘> a> 2   ;:  > "` 㿘>  6@+> )> #` * @ "  @2 2 2 , `  `> >  `0(   2  2  2 ,"   2 @ 2" """@   2   " "㿈>  `tc 2``"`<`  &> !L@(   & =ڐ @j > 6   X 8"` $ $ $ $ 4`$ $ @$ `1~ "$ 0 "`0` $ ` $ ,`t#@&`<@## @ "@, d`tc 2$ p`<$ p`@-7`$ t !4 n4 f, e4 h4 jS4 l@ k찒 p X*  c, d , e  * @4 f  * @4 h  * @4 j  * @4 l  * @4 n  * @$ p  *`  * * $ t 0`t    *` * $ p9 d  " < p?c @C  > 6`T*  $ t   "`< ! &㿈  X`<2 >    *`" *  ' * `%'`  &  n l  d . d 0 `   j     h f e  ?&    ? d`&  , z @ 耢 2t X)   d * *  e*`  g* f2 *` i* h2 *` k* j2 *` m* l2 *` o* n2 *` s* p2 *` d  w*` d  t2  *` d耊   u*` d耊   t*` 0t#耢@  q* 0t#耢@  p`* 0㿈` @ `d``0  t#@> 6` `   ` @a `t@` ` T@ 2@  @< "  `0o`p?''$`p `@  T@92@  X@/ ? \ T"  D*    T \6@ "@* ` ` 0C@a#``H `@u"@p$`t` $$``  `   􀢿 @?  T2@$`$`쀢`  t2@ ??@ې㿘 `@   0 t#@" d5  d " t/ @ 8 `> 6c! T@@2@ 2 "  P    @    t '   & t $& ^ 㿘 d R㿘 > %a(    D > 6! > "& ٯ =$  㿘> % a(   ``D > 6!Hi X   , `X <`   ?И  , X   z X`! 㿘 h@ l* 4"@8*  4*  8@@ &2&  h@埐'㿀> a@ `0 "a@'?2`p `p 1' `d ) T`t.@ ϰ  \ @"2@& \ <".@@&2&   T`t.@ `"@ 8 ' 2&   `''@&@'> aH "aH>  * `" Z# t2?x * @ g쀢 " i ?谒 W t H   *`  * *  ' H  *` ' t/2 t 2 ' t ' t2 ?8'  ' t2@ ??    T \"@  D?*  && $`x$`| 0& "$`?$`  x    "(  " " x?  :" 㿐 x "Y  P ) | 4 *`   *   L :4 @?24      4 4 * " 4 *`@ (͐8?& | $ x?U & x!  H S* P2 * P* P* * |2 * |* |* @   @"%   6   4 `< N ' H`<&`H @   & 4 @s0Ґ㿐 P 2* $ P  * *@# @   @" P$ P& 㿈`2`> 6 !  > 6!  `L`(@``?  0)`t#@  H  *  *` *   H ` * /2 23 3 8 &`b?`t#"' R#&K耎 H  * /  < / 3`H* 7 `H*`H '* < H@  @ *   *` * +@ 3`H33 * `H * `H *  &`d'耢  Y㿈`@ L?  I0'@Z 3 ? #v` t?#1 a4\蒎` H   *` < o (` `H3쀠*  H@ *``8'5`0``H*`H*) < H@@  @ *   *` * +@ 3 H33@*` H@ *` H@ *` '@ 􀦠2q  $ d 㿘6` *@` L?*2`&ΐ `"  "    * @" ?& 8㿘   2`* `(  "  P & P `?   2'`2'@ 㿐`   q@` : @qbm&  L`9 @ @$ 4` ,  `  * ?@, &U8 ?t: L` " @ 4` @!4` ,  `  * ?@, &08 ?O(` "     X㿈'?&u@ 耢` ?v "0{ P6`  $ P* ` * *#  t?#@")o" R@ #@,J t` `H   *` 2  <@ H2 *@  H@ /*` H  ** @  H !*  H@  @ (  *`+@ @ H+ @  * @H6` @*` H@ *` t@ 6@ ?8@ `( L@(p 耢`n 㿈L  2  '?," L 2 *L [$P%@0@h 쀢 2t "  ? "t08#@  H@ @  *  *` *   H ` * o 23  2LP4 $P*  * *# L(ð 㿐p  0 d > 6/" > !D`"!Dp ?>  " c   `0W 0 2' '?, p&@& p 2  $p W     ?$J$F' d  `T?`\ `D" `*@ '``@8 !`\`T "@. ``- `\`T T P"@ :  P ?$ T T?2 H> 6"0 H@׳ <$ @& ?`'`2p H > ' c ' '`'`@*  '''''$` 0" d ? ` ` @ > Ȑ۔ >  @ "``J@ .2``  2 `J` .2`#  'Ԓ` "  ʰ  "` `'`  2 ``2' @2 '̪ 'ضT?ؘPа {ЀC H ``? '`.{ ? &     ``2?   @ٔ "$$?$$Y$(Ф ` ܒ`H'\  J> 뀤 @' @&@* @'``2'` @""`, ` ` )> $($$`(` $`Ē r`@$`?`@`Ȕ"   * #t @    * @*`< " Ԁ " '# t#@` "<`7` @1#;` ` > p Ԁ Ȱ "̰ > ̀ `"@Ē `@$``4 0 @-#2`  `~ > pԀ q̰ > ̀` "`(s$`ĐȒ n @3Ē `!@$`ԐN̰  Đ  V> `*@P$` > @:Ē  K`?> `*@+$`p Ԁ0#"@̰ > &#!>   @ Ē l`@$` "`@Ȕ > # > 6ِ"h㿈`$`t `0?``"`T 2@'     t ?~ 0`T`t*@ &`t`$`T2 ٘찒  `$`X `?m찒 X`$ `X`H @  ǒ d , , e, g, f2 ,  i, h2 ,  k, j2 ,  m, l2 ,  o, n2 ,  s, p2 ,  d` w,  d 2 t2 ,  d  u,  d  t, 0 tc  q, 0 tc  p, `( < `(? 1&`(`$`X@!m谒 L`$&`$`T2@  N찒 @?`찒 6`$`XH &`$?B Ψ C谒 "  d p'`t#@`<"'  #㿈 0    =`?? .H"%> 6#> 6 `" 2쀢`x@@ b@:  H *  0  㿐`d ' 1' d "i `ppb a`00@"`t> 6U"V #@>`<N9 `d H` `  > 6b@ " `<  `#`t*`  ` `*` * pԀ ( `<#e`L' B  `d Ֆ?`\`p`T?" *@`D`@ ``   * 2> 6" 5 㿘 X` ` T  \2 "@  @* `*  T \6"  < \ D" .@@   ?   &  X H  '㿘  0 㿈`,$?0 &`,  *`?  `X "*찒 1` 2- `X( ' `T?4  Ƙ ?`` 0`XH  `"Ơ $"    㿈 0 ``Ɩ  D B   `5 3?$ ( H H@   @Δ  H`͐A  =㿈 0  J 20 ? " 0#H@ @   @  "` `  ` @ * @ Ӑ    x  |  `<@@"Mxa  ` @  B  `<@2 -  'x`<@"x ``- @!  0  *@&x x۔| @&(&&$&&,V  < "  > O `&   `"`<`< !!` k 0l ˔`<@@2 @b  א "aҐ0P& &6 @ & &"& `t#@2&@t @s0&t`   &0t`p Yp Z`@@љ$ x` Yupp `$ @ю@aL! |㿈   O < >   3 `P@    ; `<   ?  x ' `h ? 2`( "x``  ڰ O "?c찒 2  0 ; # 0!HH@"!$@   *  @4`  * @4` ,`  * @4`   * @4`"  * @$`4  * @4`(  * @4`* ,`$x`2`"+  + (*2  $*2  ?8 O`"2   *`   * * $`,  *`   * * $`0 * @$`,$`0`?@L2``0 @8^ ` 2,``" 2V `4 2R   * @2L #  $`t$`$`  *`   * * $`4  *`  $`` $`x A`t#@ " 2 O`@@2 O`0  @@ 8 O`@`0v4`$`0`,r$`,`n4``"j4`"`4f$`4b``tc $`8 " !*  #@ $*@ *@ $`<`4L ``8@$`D & %* @$`x`4@ `` `*`8 $`<@ש$`D$`@`0 `D @נ" `4$`H`'$`L$`px /`  `?`*?* 2  ?/  `t ///  ?#  $`t$`$``t/2@`*` $`h``h@f$`lx?$`\?$`X$``m? *@ $`Tg O8'`x`8$?~찒 2Z> 6 Hc @դ  2$$`x> 6c(!@՜  2$`x%> 6!0@Ք  2$`x0#@Ս  2 $`x ! !*` ! !* * $`|'`L < 2  ɤ* $`$`$` 2`< ` $` ` $` $`d` &a&`d  &`h" " 쀢   ?` ` "' <$ ;&a 㿘6`   a` "`` `  ?` < ;`<*@$`<$a㿐!   `&@㿘! D`@ &``&`H&` P&`P&` &`&` `T Z ` Z!La | `D`@  㿘 < " ` <2`  p ` @` `` @ 2&`@  㿈!'''' d  > 6> 6 #8c1耦` `  2' k 㿐!`` 2& `&  2@ "` "`㿘!6`  `0`4&&  g0 gT gT g g$ gT g0 gD> # '  p`2 $ t@h $2h> 6 #@@ & 2X`  ! >  /''ܐ  ` *`'| " 't*  0 *  <''d'x֔Ԗ '`̐ /`x  Ҕ 鉖 x Д遖x 'x\ 2@̒ v\ "@ kc > 68#㿘  ɮ X  㿐 `D 7`Ԑ 2>    *`" *  * ''  $  &  n l)  d . d 0 `   j     h f e  ?&  㿘 !m` d` 0!`    a2`@` 2`*`2` 2`@* 2  R 㿐>   *``0" *    * ''` %2  $``n`lɖ `d ,`d`0 `` `j 躖 ` `h`f貖`e` ?$``$ `d` \ T`p" D* 7`p`  \ T`"? D* (  <"` 2 $ `d !m!4`0  4 `d @4 a2`@ 4 * 2  `2  4 4`0 ` ,$ `0 $D$`t <`n`l`0 `  `j 躖$`h4`f `e $@,0$4$8$$$($@ `d 2$<@$@$<`0``$ `0`tX* 60 耊 " t =a # Y  S "t@ B 2 t@ ? t 2  (  ֐ .':`t '  B  2,``@ ()``:```@ E@`TB B?@?4"@    耧  '耊`Ҁ  {G̀ `T7@ ?` ''@Ȓ`\% @7`X  @ P @E @ӵ@& @ӭ@4``2t@ 8 ``t 42````@- { 'H@ʇ<T"@P`\T`T"@ ;   ?"`T`T?2`Xz "c 0b``?y `X `` @"@ t <  B 4  &t  @M @LHt܀y`` zhz&  &  `T @ I@ G   耊 ?ܐ! " @ b %= t ?@ 2   ܀E   㿘   `?ؐ   /`?㿘   < ` U  =  :㿘  -F 0 P> > # ''''X!`$   $2`X> 6ɐ# X  #X̰ ̀ h̀ YW> 뀢   `5 ے d`"   J`.   `  @ @Ȕ   $ '̴   ` ` $' +/Ȓ  `pp2  $`" ̒Ӑ 2`@2> 78  2 ̴   !d e  B` ~ g …S   ׀  ? $ > 7 0` Ȁ 2 > 7 X`q  `$' > 7͐ X` ZN uXА   $($$   `,`$,$`$ ``T 3 ۘ  `X T `X @$ E`  @`?p 2`\> 7j p?`T?" `D*@@ `wL`` "x& H s+ p2 + `t@ p`<@" 3`+ ;+ :`t#@ 4 3`4 3`+ 5+ + + 4wİȔƒ rp ?$> # > 77 > # '  p 0$t@   ?\՚ 2h @Ǵ>   <  `*`" *  * '`'d'x֔Ԗ "'̐ /`x  Ҕ  x   Д x ?'x\ `\`T"`D*@ ``@ x` H@s`` H> *! @_ H+ \2 + + Б2 + + Α2 + + + ґ2 + + ֑2 + + ԑ2 + `t@ p`<" 2+ ;+ :+ 0Ж2 + 1+ .Α2 + /+ -+ 2ґ2 + 3+ 8֑2 + 9+ 6ԑ2 + 7`t@  \+ \+ p+ 4 p+ 5v /\$2> 7P  "\ /'''| 'tX \@Β x X   "@  j  > 77 ȁ㿘    S' I " B` @ BR  |ِ=  В  |͐ .,㿘  -8 " h'D> #?  '` '  `d`0 ' @|!  ` D %`" 'Է2  .D"@"`p 2 t#@j<2g @  @'2^Ѐ@ Zv)Dv%DС5`:  J'# '> 7t2 '\<T?D" * ; '  /   /@Ϣ!  > 7/`@ϙ!  ? 7@  < 2D` E " &ڴ  $t:` 'Ȓ@ T@eК X%@ ` "@ 8 `t"  8 Uܸ ?tܸ  @" H@@  @ j 2 ` ?'̀   y̐r'?n'̀ "+\ ` `#t*`  ` `*` * 2 \ 2 \T<"T"D*  '/T"?D* x <rH $@: '/̐  ᪒/*@?  ? '7@  q 󀦠` &ت` `H` E @ r u 5D `"@""@ %=`t@ Ȓe @  b 4DD` D "@ui`">  > 7G  㿘    8㿘 ఔ  8 ߒ`㿘 `ː 8㿘   `0` "  2  2" \T "@  ;  9  㿘  \`<? `> 7ܐ  T P@2 T`0\ TT"@  ;@  ?$ T T?2`  H@~ <$ @ T?2` H /d * % xH 00 > ' ` $ D` 8*` € 㿘 > 7`! p >  ?  2` Z "> 7> 7!p!> 7)!X) 8 㿐 `  t #\   4 ``0>̇( `  " ` $`    `     g g h h h h h g g g g h h h g㿘`>#`.` €  ..  . . .  h H /f * ' >   "H 0`! 6`H /f * ' > b` 2`H 0 `$ &`6`&@&`&`&` $@&``+&`H /f * ' > !ƒ "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` 2&`  7&` &` `"@&` &`Ӝ  `ӕ  JO" `"`"` 㿘 4  . 4 @   " > 7w!   > 7`@k!2"  2&   "@& 㿘. *  3 #>  $aX%> @$TaX@@ T  "```㿘?> 2 aT  >  . aX*  2  @ߒ `> *#  & @&  㿘?2  . > X* @H /f4 * '   wH 0@ǐ 㿘?2  > . X* @ 2`  @ H /f4 * ' ?   $ 21$ $>  -$ $+$ $ > 7 $> `?  > 7!ރ  # ? #H 00I     )$    6 "   " $  $  $ $ $ H 0 | H /f   H 0 * '  $ $ $ H 0㾈?2 >  aX> . * '` 6 ` `0 `   '`@ (8H  (  /H /` * ! ` H 0 > 7+! "" 0" " " 0" " " ,㿘?2  > . aXo* @  5q@ "i@ "`"h@ f@rj@"` "@O s@t@"`8  w@n@>   ~@" br@" "k@bp@" bu@}@"ܰ  bm@>    v@bg@9 0 "l@y0"f@"`° H /f * ' ` ``@H 0&` 2    8$` &$`@H /f * ' ;H 00} "{ H /f4 `4* ' `4   ` @ :  ,`4H 00] "[ X ` "U  @0P@L  >  @m @$`  < :$`  ` @=&` @ג>  -&`,&`0(&&,`66#6@ $`8 ?$` $` $`<$`D `$`H @  $`L`D ($`@ `@&㿘`  (@ 2L H /f * ' & (H 0-@b1,`  x`  #@, H /f * ' & (sH 0     㿘N@ .` ` А ( `>   0@   8.@ $@ > !P`"@ ` 7 @t 23@ 8 2 1 2  @ 'H /f4 * ' @  H 0 @`2` 㿘  Q 㿘`2? ?2  @> *` X* H /f4* '   6 "  "  H 0 ? $ >  "$TH 0 ? 0  > (RaX( 2 > *$ X"8 " (aX(H4 X( X  " X  2  " H  <?0> (aX(" H4(  6 H㿘  !>( ,& , (@ @C! 2 ,㿘#> 7 2  b  U@㿘`   ` @` #> ,& , (@S @`  2 ,㿐    @ 4   $&  `2  0 r& 0& & & & h&  <   @` D Hp L T X& Tv   @$$@""  2" 6`& = <   @` D HE L T X& TK  $)>  ` #  & $ & & & & &  <   @` D H L T X& T  㿘  %  &     & & &   ђ  7㿘  " (ǒ   "   " (  ( "& &㿘    2> > 7 "!P "@"!P""" "&""㿘> !P B!P>#|/> U+> O 5%p @ 6 b > #|b`@ `,@ 2` '> %>   `T@ X `    Z  2 & ,   @ 0 ` L h h p X 8 p P L (  0 8 < D d D"@ @6   @ " @ * ( (,  ,   % "  " @  @ * ( (  * ( (  * ( (  "  "@ @6   " *  2" "   * H  *?? `#> !*` €   B2  t`   K2  ֘  [2 `   "  6   @ 2ܰ  <@ @ + *  *`   @ 2°  l@ @ *`   2 `   "  6 yJ w@   2 `   "  6  ``, @ \, Z X  * S@ * N@ * I"@ * D"@-  () '  *# !  2   "  (  *    2  "  * #  0  +3  #  V   @°     + 3 ޠ ܘ  3 2   )  $ 944    Ҕ*` `?㿘!> f">&c@"㿘> *#8> *`<"#8 `6 4%> * '> *@ D4-> c8D@ -> * @6* "DD *  Ԑ@#< " D>4 #< D%#<*   @@ +4 @q $@c8@* " `2 > *#4&  &  & `& & & @㿘 ܀  @L @_ =@( , (  @Z`(,`( , `0> *#8> * =*` 4,  <>&c<4 , , # !t$`$`  `$``"``&  $`& $@& ܠ$`,  *㿘> * 4#<*` &H /f * '  @  ` "`&   "&  4<* "@H 0㿘H /f4> * '> !`  @  H 0㿘H /f * '  @ɒ > "  ,`" @*`$@   2 ,H 0㿘> *#8`!> !`$!`"  & &   ”  & > 7ݐ" " "!`!` & !` "` "`$!`!`& 㿘> *#8`!> !`$!`"  & &     & > 7"8" "& !`` & `""`㿘 @     0@  㿘H /f * '  8>)>)>)>) 0 ;`4 6 8& & & `& @o} , " w " 8  > Ր > " '> ,)> +> M#>$,  a (  , @P@V/@`H@] @Zb `"  "`> "!d  "@ #>  `"`& " `   <`@"`@$ @<"@   2 4> *#<*`& "   > "   0"  * @`" €  2 0H 0㿘@  ` "&@$`` "&`` &`?"` &` 2㿘> !` , "%  `  2  @ @f  8 "   "   " @U    2  2  㿘> !` " 8 "  "  `  2   `"   @@,    2  2 8 㿘      > *#8 > > *#<. 9 > !``4` ",` 2#  `` @@ @   @`* "  @, "   2``2` > ``` " `    2``2`  㿘  C ` "? `26 ` 2 @ "/``"'  @ 2! #  ``   @   @`  @  2㿘 ,`D ( `$`   `D` ?@r &`D"` &`D    $ >&!t㿘> #" `> 7bP@C  8 x @6 8 "  <@   2    Ȑ  0>&  ` ` & & "` ?& `@n㿘> #" `> 7bX@   8 x`@ލ6 8@\@P㿘=  & && 㿘H /f4> * '> !`  T 6   6*` 4 6 `" @  2T 6H 0>  ֐㿘> !` "  @4 2    㿘0a@ a$@@KGܐ  @ !J@ 8 a2@ a1@a@La@` a@" @aI !F@ !F0aH@aG@a@"% Da@"6` a@a5@` 0 !6@" a~@"  @` 0!K@" ` && <y D̰  8  H /f * ' ېH 0 " 8 8 2 8H /f * ' H 0 8?bR!   4 8 8 v$ D   @@e@Xb 8x u  R  g -! "$ ! "8!! "` 0a"a"a "a!` a a" a% ` 2`  .a#` ` @0a a "   8aa2 86 8 `H /f * ' @NH 0p> #@'! > !` 0   !  `  2 &@\ > !`>`;` 0!     7   I ` $>  2 7`  @ 2  ̀  В |  `@ޒ  "@"&@ > 7-"`㿘 ` ` & & "` ?& `;    p> #'`" ( 8`2 ( 2  & (a 6 8? & ( 8 > 6 8   8  a7а# > 7ݐ"h 8  㿀8 A A   2"8`4  @  `8?$`8`4 "`4`x " `0`4  @ `0@ $`x 2`4 A "`\>  @ :@ A @ `>)!t*` €@ y `!(8( D  (沔 ; (7@$ !"~7`0`L ` H ` C ` @_ 8(P M沔 ;q  "F` ``' 8# `  $"    ܐ"   "    % %  :ڔ       %    `  `7     7> 7"xO Ӱ / @g```'`8# ```$"   `ܐ"   "  `  &` &` :x <  $3   ` 0` 0 +   D  0 @  2 2  C  0^ 7 } C @j V H /f4ഐ* 'ഀ    ਀@&$9  7ࠀ 2" $$ࠐ $र "dଐ $" dH 00b $dl $l8$@H 009㿘`<( @㿘 8`2 @ +h> *  ` @"`  2` `  @O  > *#H@G  !"6 h & h `  & ` 0``   ? 6@l^ ,   !2`@2 @  t & t #  4  8! !`@   4 h") 8 h `0] 5@:!"݀@=`0T> h `"hi+ > #> W *`  >  >  > h "h i > #> W *`  > ,ؐ > ,!H 8 @:0> h@ "h h > #> W *`  > M > Mk"f4 c @ ^  ` Z*@"@U ";: ?& & & 8 $#@"   "   ?`&&  8    &:@2`2`2`2`2` 2 ` 62 8D0&H /f * '  @`8/"0 & 2" "" "H 0> f> *P :  0 *@ `  *@`*@`> f*#㿘!`      .!a.!b.!c.!dM.!`.!e>)!  %& . =. >& @s. < ܐ!`  =`x &!h ,   㿘!h`""`"@  7!h2  ?> 7 @  (2 (2    ?0G@ 2 * 2   *@㿘  "    N /"" J / 1 2  > *#h  > *&#p ^.@.`.`  `.` .` )   3  3   3   3> *#x > *#ߔ  .`.@ .` .`  .` .` 㿈H o *@ g     H 00Y 耊 2 ahH 0L  @  2  @  2      & H 0.  7    H 0  7s  o  & & ah & ah "`&ahah& al`&alH 0 4㿈H o *@ g     " ahH 00> @  2  @  2  2  H 0$ ?  & H 0  `"  "`  "@P 7al?&alH 0 4 p p p p p و p p p p p و p  , , , , ,   l L L p p א א ר ( ( p p 8 ր ֘ \ 4 d d  l  4 լ ؜ ( ( ٸ ڜ ٜ ܜ ܰ ܜ ݀ ݘ D \ D t D ވ ޜ   L L l \ \ \ \ P P P P P \                              P \ h t 㿘 8   ``  & ``> 7c Y  P p`& p5& P0`8`  "! |0  !  > 8 `   /  P 0!@"3> 7 #`!H  !@"<! !@*#@".!! !0&!``! +  3  @ǚ  > 8 `P     t & t"В@U0@! =@i09 7@03 1> 7#@@0+! 2P 8> h `"heq > #> W +*`0.! 2 k> 8 /`h  5@ t & t@z50\> h `"heH > #> W *` 8 >  >  => 8 `   ꍔ 5 P 8 0`"/ PH /f * ' `` @&&`` $`H 0 > 8a e   P` 2" $@`$` $`H 0 㿘  H /f * '  8`@@ 4H 0- 22`@6 8H 0> 7"@H /f * '  2:``  * ` 4xH 0  1 !h!l@6`  2!` 2`` '> * c* @ " !`  *` 2`!````'`8# ```$"   `ܐ"   "  `  &`&`  4l ` ` `` &`2! 8 > 8a0 雔  X & XH 0 7 ` **  ** ! (2 !2!` 2 2`3ސ X & XH 0a /`  @  `3& " 7&` 2" $$ $$      @&&`3  7 2" &  &  &  " 8  & "  8 X & XH 0$2 d @ d & dH 0 㿘#> fcx !> f>Db#|t >  *@ *`r#|> 7cx" &! $cx >0 2``. <& &!&#&#& &!l6!6!&!&!@ &!@ M@@I㿘> f#x !! "x! 2!!"@x 2!> fr#|!԰"4 m h㿘    Ȓ  !t!`!`!t3  ` ` & & "` ?& `@Ð@H4!`(!`  !t `?H 㿘H /f  !t K € F* ' !t    &!t&!x$ !|?&!| 0@  2!`! '!`    &!`&!d$ !h?&!h  Ԁ Ɛ  2     & & $  ?& H 0㿘H /f  !t & € !* ' !t`! "!`! !``  Ԁ 2ߒ  2  H 0 㿘H / * '  2@ 1@z@w @#p @"  8j  !@e 9@]@"I[ 0:@S~@"N @Q  8@?Ȑ*@6 8 8`   @ @`? 8@ `?`2!`! > 7"@` 8 ?6 8`! 8! @`6 8> 7"@0"X(& @H 0 "@:H 0㿀` 8  \> 8aX - 0V ``> 8#\` a#``#d` #h@ `@A 3 ;> 8!` 066!`!@&!!  > 8 [! 8`6!@2!t! 6!&! 8@  6!E> 8"@ 0  @􀢠@ 㿈> >  " ,"*  8 `* H /f * ' >  g H 0 " 4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ N   $ $ $ `52 *<c"*4# # 3 3 3 ?2 #\ > 8#` b#d   h !|!@ !p `&!p0&   $ !x 2" &!t!|&!x &!| 8$  @  d   & d㿐/  82   ` ԑH /f * ' >  ֒ H 0`" 4`H /f * ' > b` 2`H 0 `$ $`4`$@$`$`$` `]/ 2  `$`$` $` , ,,4 , 4`.`@2 @  > 8#\b@ Ԕ  "> 8@> 8"h!|!@!p `&!p0,&  X   & X$`!x 2" &!t!|&!x &!| 8$` @` d`  & d㿐`8`  > 8 bp`吐 0  a*`@ @8 #\> 8 b#` x``*`2`@^> 8"h@4 ?` ª>."*` €`4  > 8 "奒``Pa* @   4    * `>."l*` €  @+ ,@Q 8  @0 abl* "  @ 86@  > 8 b ` ( a `    c> 8 "A`^`Pa*@`V>."L*` €bl+`a" @Ք 0F@Д  ,@ 8@ǔ  8bl+`a" @ > 8 b 䴔` ( a   > 8 "``P ` 2   $  a*@` >.",*` €bla+`"  8@}  ,@ 8@t G 8 a*@`ښ >." *` €@` > 8 c  W`    0‘+`a"@@I  ,@瀤 a* `>.!*` €  @. 4@0@&  ,@L 8`@ѐ `> 8 c@  a* `~>.!̓*` €@ 0v0 !@]0o0 !V a* `  ^> 8#=`Z`P`4V> 80#bP  > 8`4!> 7b€0F$> 8# `+  3  060 !@ b`@2*`P` '> 9 `0!> 9 @`bP@26a0> 9  X ``a&a T `P &`P㿘`8 a *` @`> 9 `x{  a* @  "bl0@n 0 a"@ @g  8@㿘`8 a *` @Ѡ`> 9 `P  a* ` >."*` €@@ 0@;  0@0 @3 0@.  ,@㿘`8 a *` @`> 9 `  a* @` >."ԓ*` €@   0bl * a"@@  8@0@ 㿘`8 a *` @a`> 9 `  a* @` A>."*` €@Д   4@ʔ 00@Ŕ 0+@  abh* "a &a  s  ,@0 bh* a"@a  &a  ` @ 㿘 a+  bl"@ $ +  *  !Ԑ@ *` , !bd@㿘`8 H o *@ g aa `*`@  *`@ > 9 `V  *`@ ?  $@  *  "  0;: @= * 4@8 % 4@4 ! 4 * `#>.#$*` €a &a  ޚ 0@  8@0w 8@H 0㿘`8 a * @" @n`@k> 9 `  a* " *` * !ə@  >.#8. €>> %ܔ   ""p""L""T""d""h""P"!"!""\""X""l㿘 8%ܠ ``@  @&"L&"T6!&"P&"\&"X6 8#> 7 > 9a ᧔ !  "!> 9!!bА &!`€b> 9!(b㿘 8 > 9a0 ე !> 7"  8 @" @! 8 &!6 8㿘" "L  ?&"L!> 7 &!"7㿘> 7"g㿘> 7"ڒ㿘 8  Ԕ  > 9aP 6 s ` p!> 9%> 9" @@ U @vh @ "   0F C  ` H0 ` A0  ` 90 4 `"+ `I!p' `0 `* @#@ 2 "| ` > 97! `"| 2 ! > 9,! `  &!> 9#! `А `@ `% @ ` > 9 !-0`!3 ͔  > 9> 9!(> 9aȐ औ ` 9> 9" @@ @!h @ "3 `  "L ` `S 2| ` ` `*  `*` * ` "P  r> 9!Ē n `> 9ྐ!!"P 6!8 222,`,`,`U,`  `  `  ` K> 9"H `> 9",`,`,`7,` `*  8&"X> 9" 4 ` ` `* @"|@" "|@ "@ > 9"(t"|2 ,`"},`0"#@2 ` ` " > 9`"@ ,` `  `@ `% @ ` c,!"p  &!Ā> 9@"P-0`!3   0(> 90"`! > 8!2 > 7"@6!&! > 9"&!6!.0`!3     㿘 8  A  U > 9b ߨ D`` @> 7"%> 9 "@@ @h@ "!  " "L#`2!`"L&"P ?&"L ?&"L  "€  > 9ʐ""L ? &"L> 9"@`&@` ǀ > 9߱!( 㿘 8    }`> 9b H l`` i`'> 9"@@ k@ߌh@ "J`  -M`2K`"L FE` 2C&``*`* `@*`@ "P@ 8@ `> 9c#*&"P(&"P> 9Z" $`"` 2 &```,  > 9#I:$"$8%"L&"T  &"L"> 7> 9;"> 7"@`&@` ``> 9)!(  㿘 8@   > *$> 8" > *#  , @ `"  @  , "L  !   &!!@ I > 9 c ޟ> *#, @ `"  @  , ! > *# , @ `"  @  , > *#  "\ ,  `2  @  ,`! @ɐ㿘  @ &!> 9c V   )> *"\#,@ ` 2 ` @@@,㿘  @ &!> 9c 1 # `@㿘 &!@ Ȑ > 9c  #`@㿀> #"L ' "P  &"P / , "P 2 2 2 , , , "S, "L  ,   , "T 2 , "W ,  "L  ",  *0 2`"#@   , *2 ,  0, b#2    ,  !+  &!.!0`!3 } c > 9ǀ#0> *"\   *`  ``* 㿘!   > 7"@"!""t""x"!㿘> 7#㿘> 7#㿐 8 `@%    > 9c@ g 0  > 7"x"t `&"x&"t> 7#3㿘> 7#c"x @. 㿘> 7#В㿐 8   ǔ   > 9ch + `4  1 /> 9" @ v lh `   > 9]!p > 9W!   $@`  ր > 9@!- ` `!3   > 91!( @ > 9c Ҕ [  X /> 9" @   2;   * *`  *   ` " "x@ > 9#"x !&"x > 9# @ > 9#, , 2 , ,  ꅐ  $@`    "x   2 2  2 -@-`-`-`-`-` > 9ܮ#耥 > :ܧ -  ``!3  > :ܘ . ``!3   `?㿘 8    / > :`  $ ``  %> 9"@@r@hh@ 2`"t ?&"t`&@` 뀤 > 9S!(J 㿘 8    R`> :`8  A`` >`'> 9"@@8@.h@ )`& 2$&```* `*`"t `*  &"t@> : P"x  @`> : ``&@` Ȁ``> 9!( "\""\㿘"\ &"\x#> "t c耊 'ܔ @3  /  , ܘ , ܘ , ܘ 2 , ߘ ,  !  &!.!`!% c > :( p>  8# '``4 ` > :` E `@4@ ƪ`   0`  0 $@@ 0  @ "#> :`` 0  @"#`> :`` ,@2`> :[!@> 8U"h@ϐ @ڒ`" @)@Ґ@ΐ@ "/ @` #d> 7#\#`#h##l  @gA耥 > :a  Δ `$ > 9> :!8*``@Ɠ2`> 9!(H /f * ' !0"| ?b# &!"L "\  H 0  H 0 @> :a@ ڍ ` > :ې!8*``@2`> 9Ӑ!(> :aX y  $@@ 0  @T"#> :`ap`c `*``@I2`> 8ڬ"h`!  > :a L "Đ@x  > :@ > : a8 ,2`@7> :ڄ" @`* @-2`> 9z!( "@!@0@"#``> :#\ b ,@2`> :^!@> 8X"h k> :b@   d@Ő @В`" @@Ȑ" @Đ@@>  !> 7`> :#bx#\ @a # ,!   `> 7> :#b#\ @N ! &!> 7# # (@@%!`@> :`b#\ ١ `*``@2`> 8"h > :]"Ё "!"!Н㿘"|0"#@"L  !> 7# 8@"l&!u 㿘a > 7#j 㿘 8 H o *@ g   !@Π > :!bM !? &!! !> 7# ,@= 0!   "l&!!> 7# 8@+ H 0㿘 8 "l"€ &!ܠ"?c > 7>  4`a,鏐!  > :#> :#(> : c"€ > :> :#0A0>#XH /f * ' "\! ` &"\H 0 0 H 0 ! @H㿘 8 > :cx ؼ u""\> 7 ?&"\b€p"@ãnk&"h$`e$`$` ! /" .!&!@Ɛ! #d> 7#\#`#h##l  @㿀 8`  "> :c v 0``4@    0׀ 0` ?@ `$@ 0  @6 #> :`c`E *``@+2`> 8؎"h0!` @!@0@ #``> :#\ c' ,`2`@&> ;s @ > 8m"h`  `4/@q"Ā   @j"䀢  /`> :bx !> 7#\#`#X#d  @#X" ,!    /`> :b > 7#\#`#X#d  @n! !> 7#Xה #X (@0w"4 > ;`( Ȕ  N@`" > 9> :!8,``@2`> 9 !(H /f * ' !0"| ?`# &!"L  "\  H 0 0 ;`8 ׄ  N@`> :ϐ!8,``@{2`> 9Ȑ!(0> ;`H o 0> ;````  e *``@K2`> 8׮"h "!"!̝㿘"0 #@2 "|"L > 7"l&!#XE "|0 #@> 7#@"4>Cb"d㿘a > 7#X( 㿘 8 H o *@ g   !@ > ;!`  !? &!! !> 7#X ,@ 0 ! > 7#X H 0㿘 8 > ;`  > 7#@㿘 8"l  &!> 7#\> 8b ͔ H /f * ' "\! ` &"\H 0 0 H 0 @.㿘 8 > ;`А ֢ ["Y"4"\> 7 ?&"\b€p!" .!&! @"/ @! > 7#\;h#`#d#p#X/#t @㿀`8'T 'XH /f * ' >    H 0 " 7 H /f * ' > b` 2`H 0  $ ' 7 '' ' ' k  '  **  * 2 ,`T  X @@2 ' '  4` @@` `> 8 b@#\ ` , `@2`> 8J"ha|a@ap``&ap X&``X  &`X' ax 2" &at J0a|&ax &a|`8$ `@ `d   &`d㿘 /  & && 㿐H /f4> f* '> f#x M > 7"!`"D! 8 @?`2!! (:!! 2!> ;  !`"᱐Ő!t!@!  4!!  !` $!! !! 0!"P ' $!,"``!  &! 2!H 0>  *> f@ #|Г*`        2    "   `"   22"`2"@  2 "  2"p> #'ᣔ# t @#@#@ i 0!:@2d #t@S @P @M @J န# N!9@2J ! PD   0#@#@29 ` 0#@#@2. T"|@ D6"|"⯔ t t"⨔ `"@  D  6"6"♒" "⒔   c > ;Q 㿘  @ &!> 9 vc > *# , @ `"  @  , > *#  "\ ,  `"  @  ,`㿘 ` (>.#`*` €1> ;'!1> ;$!1> ;!! 1> ;!01> ;!@1> ;!P1> ;!`1> ;!p1> ;!1> ; !1> ; !1> f> ;#է #㿘. 06 `# b#4`"1> ; `   ` 1> ;(!&!1> ;#!1> ; !` 1> ;1> f 1> ; 1> f!1> ; ! !1> f> ;#(a #(㿘 ?`>.#*` €1> ;"1> ;"1> ;"1> ;"(1> ;"81> ; "@1> ; "P1> f> ;#8 6 #8㿘 "1> ;  1> ; 1> f1> ;1> f "` "p "> ;#H  #H %>.* > ;"> ;"> ;"> ;"> ;"> ;"> ; "> ; "> ;"> ;"> ;# >.ԇ* > ;#> ; #> ; # > ;#0> ;#@> ;#㿘. 06 `!"1> 7 `#  !*1> f b# * 1> f#1> 7#P1> 7 #1> 7 #> ;#X2ԣ #X㿘> ;#Hb .`  !> ;#PY *`  㿘?.`#`@#> ;!> ; ^ @cX `;#`*  @㿐 6 6 !> f#\> ;6 h `#h^ #h    2㿘??8>I" >G>Ic 8#> ;!` @  (@!`  > "!l cx-  , <, >$$ @4 8$ $ , =  $ $ Rۈ , ( ??֐!`㾈> #'` > ;*#`,`8   ''' 7'&`4! @"`Tɐ4  3 A`T $`T`d``@$`d`Ԁ "`>I 8@2z```'`8# ```$"   `ܐ"   "  `  &`&`  ͔ ` ` `` &`2 7`"H /f4`* '`   `` ``@&&`Q  7` 2" $``$` $` "`` $``@H 0d  > ; `>    > M" #L /H /f * '   @ ` # H 00 7&`  2" # > h  , @ # # "h L! > #> W*`  `L `L $`L``` $``H 0  > ;,#㿘 H /f    " € * '  Ԁ   2  ` ` & & $` ?& H 0`e`@6   > ; #>   `> M @4`b jy0IH /f * '   @  `d# H 00.$`  2" # > h , @ # # "h K~ > #> W*` o  LG  L & L` ` & `H 00j` "`T 2@  1@ @"  8 @" A2 8>I""  /  /" @ "  " " " "" " 㿘    2"`> ;-#"` "`"@ "`"& 㿘 `` ``㿘@ 2 & > < ѳ8 > < 8㿘 { `xv0!50 !6"$m `@j 2c ` @2&2&X &&@ P&M& ` `&`&`&`&`€`   *   ` .$@` &2 02   ` *`$܈ "` $ &`  㿘 8  @%> <  2  H 2 㿘 #< 2 @2 $ & "@  ꀦ> *  @2` @ 㿘. * "* *   '>  8$p!> $!t@ڒ!t@/p0 >P>L%ap!d'> <$!` x !(  2 $ @, <$ $!p`$4 8$ $   $ 1=X ܖ t@ޠ㿘! 2!H /f * ' >  Ғ "$!H 0!`' 2`H /f * ' > b` 2`H 0 ! "@!" !$"!2`!" !"` ! "6!`H /f * ' >  "Ə!!"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8! "!` $ 2 !!`> <  8  4 8!0 $ $!$`$!|@v]$!㿘> `  f`h > ` !t> Yap d!x PT "O 7&`&!x`& HH /e * & `p$ &`pH 0 H /e4`L* &`L"Q &!```H@ &!;#x  H 00&!&!H 0   㿘d ؀`'. hH /f * ' J$ax& aa$a $a$a| $a HaaH 0X@ ?` "㿐 > <R at / &tx`2`pV 2 2 8` @28J A@ ` >w 4H /f4* '$ x H@ 2  \> " ' " 'Вb@ ? $x`@I&  @&&`  7 2" && & >  & H 0X &X` \&``" x`H &@  H 0 X>  #`\'  H   ̟@ H 4- ,# L H" "Q&#H /f4!d* '!d   %!d%!h$!l?%!l"  l % lݒ  €    2    % % $ ?% H 0 X-> 퀢` HȲ ` `@@`  8@  !@tՖ  @* X`  /ʔ G`%& H`  d `% d> "/>  1  ` `? $<  d% d     ݐ    d % dH /f  T0* ' T* 5   "#8@ <"`<<8"`8> $Ų!($0,4$0 ?4ŝऑH 0 2 - "  ds%  \`% \ T `% d% T# > <ސ 㿘!H /f * ' >  ê $!H 0!`' 2`H /f * ' > b` 2`H 0 ! "@!" !$"!2`!" !"` ! "?$!H /f * ' >  g!!"`$H 0!`$ ("`! 2!"`0!" (!"`,!" <!"`8!`  `0`$!@$!$`$`$`$`  $! 㿀> "0> `ؒ`B  ;"0' d?2 !`p 2  `` @2 `! T$!  8 `'$ ` 2!$!! > ! @6$!! @!  $!$!!  -> $!   ܀ "! !| 2!|! 2 !|! 2 !| $!  ?$!!|!" ` X`  ! @ @*  p 2 8 O*@ 8#@ !@t^! ג0@Ҁ p2 P`'͒! p@tM! $ P 84 8Ӑ  X`"\ L ``' 8# `  $" 4   ܐ"   "    & &  e       & } *ؘ H /f * ' `X >H 0  L>  $ L` \$``" H /f * ' >   @ `" P p`$ P$ p0 &  2" "> h`"" "h D > #> W *` Ғ 0٫ H 0!!|!@`*@$!|$!! $! P $ P!`$ $!|$!$! > <ސ 㿘H /f * '  a2@ a1@a @a@"9 0!{@2  `2- / 8 )6 8 `"# /  /@> 0``&`d$ `L$ `T$ a$ a$ a$ a$ a$ a$ $a$ (a$ ,H 0 ^l ^ a a ^l ^l a a a a a a a a `L㿘>   ax -> <+>S)>T'>[%> *$!x  4%ܔ  c(!x$ @, <, >$ $ $ $!`$ $!$!$4 8  $ bn!  `٠"|㿘>  !x!``"|x!   ``"|! 2`` 0'%$!%4!! $!|@$!" Д  $"(@p!$"$" !ؒ "? 6"$!$!>  $"$"㿘> #" `> <`@ A 8&! ?6 8&! !  &!&!"!?&!!m !  &!&!"!?&!!Y !  &!&!"!Ȑ?&!Ȁ!ؐ D&!!؀2!Ԁ :&!@"&" &"  &"&""$ ""( &"$&" "(  &"(p> # Q'@$ S@ "a8  Z N@"@3?耦@ "4a| V@,? J@{? `G@ `F@R@RY@?  M@`K0 L@&?a&ax&&n  @H /`4a|* !a| @ @@H /f4a|* 'a|<?c $a|H 0~ 9 y> $@(p4ao l&) ib( e H /` * ! b(@oH 0N   I 4D$a A 8  Ԁ 5р  > + `  2|  = H /`4b* !b  b@$b€  $ba|@@> < ` 7H /f4a|* 'a|* $a|H 0H /`4b * !b  b @$b€  $b a|@@> < ƒ` 7H /f4a|* 'a|* $a|H 0 a|@@|> <А!Ғ` ȟ  ! 0 L@a&I a@ H /` * !  *`" @2a@H 0b H /` * ! > `b"&b" &H 0G "*    uӁ ( 2%    &    G@b bH /f * ' ""H 0     > <p!@㿘H /f * '  2@ 1@1@") @"!n @" 8h 0!z@ "P!{@"[ @V  @S ?Q6 8  `  `I$ @"F / B@ /@ 8!&!&`!&`!&` !&`!&`"( - &`"(` &`"(`&` "(`&`$"(`&`("(`&`,"(` &`0"(`$&`4@ 8" "" "`€" "`4€,H 0㿘! " 2 8 @. 2`  2`?Ȗ*@6`> <`  !` !6` ,`@!P6  / 2" ````8```$"  `?ܐ"  `?" 4 ` j  2&` ° 7?&``<`* * ** `  `&` `` @`!|@> <!h @Ő @2!!` *@"  ̙ 2"$ "$ ̍ "`>  $"`*! H /`* ! !ܒ`"&`Y$!`@  ! @& &` `"0 7&` 2" "" "$      @&&`  7 2" $  $  $  "!  $ "!H 0 X!` $!$ X@ T d`% d% TH 0 T㿘> #" `> <ax@K !؀ l!   *`@ `! !"Z YO $ @ #  ! @ `"0 7 2" &!" "%        @&#    7 2" &  &  &  `"  & `" X! `& X&!  $ 2 &!܁㿘H /f * ' !|> !h*@ &!|#!h > > #> W *`  0Ӽ H 0㿐a    $a$a& aȐ?$aȀ  `Ԁ `` 2``    $`$`& `?$` 2 a `€ ͒  $a   , !   -01 !a|,0b((    0  ` 02 @kܖ  p " ,  / -,, , , @ϔ 0 !3  "0a|b +a|@' '   a| b`@  `b@`a|    a| 2a| 2a| 0 !" a|   & & a|  2  , ,    & & 㿘> #" `> <a@ΐ > !xH /` * !  '!|2"` ! "`H /f * ' !|$!|H 0 !@`"|@TH /f * ' !` ` $!$!"`!?$!H 0 `߀`H 0㿐` 8`@`` ` `` ƞ ` `( @  @!|@> <! 60 @?`>P"*` €!| H /f * ' !|?c &!|H 0 0!| ` @ ` 2(" "~@" @  !x rH /f * ' !| &!|H 0 0[Y@ @" #\`$ !!x KH /f * ' !|@ 0*@&!|H 0 02!|`/2" ")@&"@ 0 @"(@ H /f * ' !|* &!|H 0 㿘" "" "@&"" " @&" 㿘H /f* ' ` 6`&`! 2" &!!> h @ &!&!"h < > #> W *` { 0T H 0㿀!!| &!䀊@ ' `   > <!@` ` `,` `  @?А*6`H /f * ' !|(&!|H 0 D" B8!|  <" `, 2!|  ` ` `,:@@> <! ϔH /f * ' !| (&!| @&!|H 0 !| !|@ "`0€  2!|H !| `  h-"(  @j H /f * ' !| 7&!|H 0 -J/!| F"( B` #\` @j쨒 @!|@3> <L"H /f * ' >   H 0 #/>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ $ $  (M`H /f * ' > ![ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      8 `   $ 0   " `  ?$ `"` ߐ0 " `$ `$ `$ ` $ `&` ?6`  !,@,`,`,``[ !  $ ` `"@ &`&`      8 `   $ 0   " ( a$  ?$( X$2V$   `'`  `  $ H /f * ' V`> b*`@ ?2@ `f ` "#@`8@ `<"`<`<`8"`8> `$Z!``(`$`0`,`3`4`&`0 ?6`@$DH 0"! !| "( ` #\` p@iN쀢 6  !!|@@> <"( 0,`J ` F H /f * ' >  I H 0 " 4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $     ؔ ֐&`  &`&`` *" v ""$ l "`>  &"`*! !!-  8 ! "` 0k> `` !h?&`&` `&`#!h 9Ò > #> W *` γ > ΋ >  ! H /f * '  @&&` "H 0 !|@@> <"XK  p & p 2" "" "H 0  L  ``& L& `!@0  ; P!` &!& P> #h ' * | > +  ఀ 2  @*   @ *  ** ޔ "> < >*> <*"pc > <P"x㿘!@㿘>    ^H /e4`h* &`h  `؀ ! H 0@ `4 2 !H 03 `">`@>`a!`", 6"`@&"T?>^>`>\!&",&"8&!&!&!&!&"L@N&"P 8`@6 8` & HT&`ؑH 0 㿘H /e * & <  ؀  . h& !@ ѐH 0 㿘H /e4"P* &"P  J&"P"T "!|C&"T!|$!`!| ;&!|H 0㿘 ؀  z H /e ;!H 0k H 0c* &#     @  > #H 0D #x ! ! h " !H 0+ " pi (!  $!$!$!?$!H 0 `  "x>  p ؀#'2  h  @2 h  " က @` @` (耢`Ī> ")> ;H /f * '   "H 0  4 H /f4* ' 4H 0  $ $ 4 $$ $ $ `?$ 3$ H /f * '  w "H 0  4 H /f4* ' 4H 0  $ $$ 4 &$ `#(& H /f * ' > !? $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82``"   $ 0   @$@   ?$`@8  >$ ` C/`Q ܐ`"ܖ ` #` ܰ > <"㿘 ؖ !p? P@\  `U@.`X@V  W@ "  T@J  O@C IF$",",C&  =:$"L"L7&  1H /e * & ",ޔ "4"8*  $"8$"4$"0H 00",ʔ 0    R@@> +ȑ*  @2 (2 `* 2 㿈> #a 'H!?bP2 U "6 H  ?a ~`&aH?# 6bd U@b,@ @ 2`*  `* b,    2 *`  +@"  Ha$@&a%+@&H /e * & H }@ < @: ,H 0a` &a@`? s o bdb,8 ; *   *   }//VH 0݀H 0Հ/bd 8 ;  ; *  *  },@` ,@,@` ~,@`H /e* & H ВH    ?0 * H 0 $a &a쀦 $P$ H /f * ' T> b*`@ ?2@   "#8@ <"`<<8"`8> $!($0,y4$0 ?4>  ВH 0 "&bPbd&bPH /e * & @8  a|$a`’ a|$&a|H 0# > <"㿘H /e * & ! # (אH 0㿘 ̀` ؟@  H c` p    @ ! 㿘!H o *@ f !| {&!|̒ H 0㿘H /e * & !q"T> " 2_ H /f * ' >  ` H 0  4 H /f4* ' 4H 0  $ $ 4 $$ $ $ 3&H /f * ' > !' $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0$"$H 0㿘`؀`Ia@E> 0@a`B :0  $aa|@@> <~"`"* `2` "``p%> O`n* * " b* `&`p@€ 0  `p`̐ >` &`p@0H /e * &  a|a|@ $a|> +> * b@  * a|a| $a|H 0a|@@ؒ ~2a|b`bx 4b`@͒?a|0   2<bb @. H /e * & a| 0@ $a|@@> <bb"``Pa` $a$`P0*@$a|H 00 4(bX @> <"`H /e * & `Paa|` $a|$`P$aH 00i` ?  "` bTbX@ 2@$bXbX! " bXbT$bT"a|D a|H /e * & a|* $a|H 0`02@*  bL*@'H /e * & a| @2 *@ } @$a|H 00 $a| H 0b` @ bT 2bT&bT 2 bTa|@@> <#&` bT`  `$``$&`$bX`<c4bb $b\a|`@@> <#  *$b\ *b``$b\4b``  &` b` 2b`  @a|@> <#H`a|b` 2b` "b`b\*b` bX`$b\4b`  " b`  2a|@@o> <b\J#h*`fa|a*2 `  4b`a|@@Y> <2#bX`  "@`82@` ``$`0 `  "$ @+` `  ?&@ 4$` @ 2@@ 2 @a|@@(> <#`#a|$bX` &` `$ ``$&`$b\` > + &` b\*@bb`*2 $b\* 2@ (4bb@$H /e * & `Paa|` $`P$a$a|H 0a|@@ 㿘`"f"x*@ &"x"x `  > < J#"x@"f&"x> #h '"> <造  >/hi> +2b @ + @  +  +   * >+ +# > <#Ё     0 @ x 0 ! " ," 0" * " (" $" " 4㿘  , )#  $ (  22 " " & & $  #   & , $`*@n  ( 8& (Ȑ  㿘 @&@ <&` H&` D&`  8&` 4&` &`  $* &`2``@C`&`㿘6 & 0㿘`$M  2I   2E  6  2@  `!>c"*` €#  #)  "] " Ϥ ,  *@ P s   @yt P`*  s  & LuG  & L&& . & . 㿘 L "u6 u3 㿘 㿘 㿘`@ 29 ` 25 `6` 20  ` 2+ "! L "  !  L*2@  *#@2`T2`V. \&  &  . R 㿐#\#` 㿐\ #\#`㿀`'H`-  ` '`? ` 'T' H"T4'TH /f * ' >   H 0  4 H /f * ' > b` 2`H 0  $ $$ 4 H I"$ `T@ (&`H /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8` @ $      8`"  $ 0   " @?$@  ` @,@``,@`,@`,@``2 ,@ ``,@``` 5` % ''쀦 '@? `* @,P@ * @`@  `  :$ , P@@ @ `->  `" '耤`'7 ,@`@* $@$ H /f * ' > ` $H 0` 2`H /f4 * '  5 H 0 ""`"2` CT" %$ H /f * ' > !ْ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ s/ `@ * ?@ `'-` .` X@*`@ `T22#2`T26&`%`% 4 @2 -> " 耤`'7 ,@`@* $@$ H /f * ' > `] $H 0` 2`H /f4* ' 4H 0 ""` " 2 CT" %$ H /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ s/ 耥`$@%`$`  %` `%`$ !% *> b耤` '7 ,@`@* $@$ H /f * ' > ` $H 0` 2`H /f4* ' 4H 0 ""` " 2 CT" %$ H /f * ' > !w $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8      82`"  $ 0  " @?$@ s/  耤` ' * 2 ,@`@ z  $@$ H /f * ' > `" $H 0`" 2`H /f * ' > b` 2`H 0 ""`"2` 7T" %$ H /f * ' > !ߒ $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8       8 `  $$@$  * ?@ `@ `  -`  `@ `<%`@T`%`<H@ SH"`4`8` %`8 %`4`H `D `%`H%`D㿘`   +     4   `& 46 `  ?V`S`  Xc   *@*P  * @       :" * P @:   #` @ *?*`. *  T@"2 T03 #  L& + ,  2  @2 , @`2` 5  $@ & & $ 4  8* <  @`& 4& 8& < & @   . x  'L&`"'  '  '` ?`2 ` ` $@ * ?    D> < #f 4H /f * ' >   H 0`" 4`H /f * ' > b` 2`H 0 `$ $`4`$@$`$`$` `2'ذ $` "H /f * ' > !f $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`@`$`   ?`8` ` `$`0 #@ $@` 0++ +  !'Z``V@? * '' J3+'a' @`0@`2`   E> = @  -'@ @@@ +> =  0> = `6 @  L,   ' > =  h @ <`&$` H /f * ' > ऒ 'ܰH 0  ܐ 6 H /f * ' > b` 2`H 0  & && 6  F& &$@H /f * ' > ! e'& $H 0 $  ( & 6 & 0& (& ,& <& 8      8``"   $ 0   @#@ #@   ?&#@ ``, V*``P *,*. "HC, ,* P.@-   :" * P@*X *` `T23 #2`T3 2"L$ *@+2   "',  @`2` `& $` $ @ $$z$ " H > = b H `D@<@ $@$D$H$<L"㿘t l{ 㿘n2 㿐`2:   24   20    2+   ' 2` ! d lS  >k>k!b& 8& <#\&  ?   @ &  H@r 0m  㿘@ m 㿘$# @  2 ` 2 ` ` 2 2`   2 ` "&  & &  @& 㿘 @&㿘 `c `- &@4H /f * ' >   H 0  />  4 H /f * ' > b` 2`H 0  $ $$ 4  `&@$   (& H /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   $  ?$ `6   $  $   @- `- - -  : - -  $($$А"@$($$   $``$  "$    2(" ($ $" (  $ H /f * ' 0 $H 0`" 2`H /f * ' > b` 2`H 0 ""` " 2 E' %$ H /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 $$   "  82 `"   $ 0   @$   ?$$( А"@$($$@  > =0 > =!X  "R( M  ($$ 6@ 2P " @PT`$P$T@ "XB&@X\@ $X$\HL@ $L$H㿘 H&@ L#&` P&` T&`  X&` \&`&`*&`2`@w &`㿘`25   2/   2+   ` 2&   " 2``  d j  >k>k!b& 8& <& $ @  &  H@oߒ 0k  㿘@ǐ k 㿘$% @  2 ` 2 ` ` 2 2`   2 ` \  & & & &  @& 㿘 @|&㿐'@` ` `" ` `$@ * ``*    "z > = j!t &H /f * ' >   H 0 #9>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ "7 $ %@H /f * ' > !k $ $H 0 $ 7>  ( $ 4 $ 0$ ($ ,$ <$ 8     82 `   $ 0   $@  ?$ `6   $  $@  -- - & & @`    & $& (     2 (`"  (`& ` & ` @`  ( & (   -  $ ( & $& ($ H /f * '   $H 0`" 2`H /f * ' > b` 2`H 0 ""` " 2 pH /f * '  $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8 & $     82& (`"   $ 0   @$@   ?$& (@    > = 0 !@> =! % "G  ( B$@$  H L P T@ & T& H& L& P'@  㿘` # * <:8 &` ?& & ?& &  & ` & ` @& "@  > = 0 !p> =! 0`2` X \ H L@ & L& X& \& H d H  (dh  \<D!H"t"# 㿐#\   @ 㿘  &  ?   2m? 4h?`` $ a?' (   W? ,@,@ & ?$,$L$$(  $$$H$D@t$$P  ( $0   (┟$$8  D ( $<,@ $   (0  $8  > ,< 2 > , h@1& ?␑*`  $ $ $ ,\$|$ @$㿘 "(?  "$? " ? $  ?. ,& & &  $   $ $    * q $ $ @@M  2` ( " (" 㿘  `8  `` g & ` $`   @"& & `" $``$` 㿘 ` 2@? 2 `` > , `?$`` :> ,  *& ( |?,  :  ,  *  @t $ q&   "  ` "   |2   q`& `2u  `" `> , l?i$`` ` l ```2 |"&  | @Β @ 2L ` "H `.`- "(`` @ ;0@ 0 @֖ `  D <*  2? D <@l!*`A` ` |&  `2   2  $ ?c ' ?& `?㿘   2 0.?`" 8 $ $* ( 8`" < $ $* ( <`"  D $* ( `" $* ( $ (&  㿘`` 2` "$` `2@ @B@& @C@`@$`$@㿘 $ D*` <*  & 42? D <@k*`> + |c*` `& x@  & @ `& @ & X& t& @& d& T& l& `㿘`$`d~`0`t`p!"@ `0`d`p`a`8`, 1 ^  Y T  N  &~ 6'@ /'@ ('@ !'@ '@ '@  '@ "ɴ'@!  ` `h@ ( ?2㿘 $ 4 l d"@ @ ??9?2 $4?~  / 0m h d" T# D" <+`@& h& d& T@ "2@2@ 8+`@@ "2@2@2 #  0 d l@ ܒ@  l@`& l 0 d @ & @ ` P L*  & @ l! `2 4㿘 & p `  d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2 " X d $"@>@8 X ڒ& X X l 8& X XF d h@̒"  X l x" (& l %& X d 0`& d@  @ P L*   <& @ ,*  @  8*`2  @ <* f2  X? & X d  X d& X@ 0& d @ & @ ` P L*  & @ 0  d@  l d & l& d`" l T  0   d" @  d& T `"&  l!_ l!`"  T T  0   d" @ d& T  `?㿘آ `( X d 0 ` @ P L*   <& @ ,* @  8+ 2  @ <*` f2  X  h& p& \`+& X x@:( p d $"@>@8! p  & X X l 8& X X`8 p  `2  p d h" ( p& X p(V ` X Q d l \`" @ l? p " & l& p d @& d 0 @@  P `*  L  <  ,& @*  @  8*`2  @ <* f2@  p? & p d  & X& dJ& ` T  0   d" @  d;& T )` ` ) 0 d  @ " d T  0   d" @Ɩ  d& T d l & d& l 2  l9  d  l & `& d& l l!( l!`"%   `   0 d  @O & ` T  0   d" @ d& T  `?x> =!> h> h#   ؞   +  # b(+@ ?` > ="* > i    > h * $@ +   **@ ?  *"; > ="> i  *> h + "?,@  ` ?(!*@?  $`2? 62> f#  ,   2 7耤 !> f# ,  3  7ꀤ!!> f# ,  3! 7怤!> f> f# ,  3! 7> f#@=!> h   4`@V 4@  `㿘> h `Fbbbb b& > => => =& # )*t&+&+&+&+$&+(&+06&&@!0t060 H060" 2"" " 㿘.T7H.46.P*` /  ) (`@/`@*  / / / T@.@@  ..  .'@ ..T 㿈`+4@ '`  +R ' 2@ L +T'*` * @2  `<;",@, @* @ `@$22 4!,`   5 $* @@@C @ & 9@ @& <쀥C- ?,``,``",` `?2 *   2  2 " ",@  * @ `" ?@ $@@&6`? 2`ߑ,`xؚ    * 2 ` ` ` *` *6 @2 6 㿘 LH"= & ?@& P+T " 2  & * # +@`@`H +T '+4`P b b  *  & % % , 4 + ?&   "@ &  急 H&2`@ :`` `4 H L P*+X &&+X ,`+X?&* $ +`?&* $  ,   4  @` -+`,`2  2`&+Xe  Ϡ `L +X& *% 5㿘?  `   .<c:0jt "-.@7@ .@7@j 6j 4jj6j6j `       ͞㿘 ?      c* @R 1 +`b tbv "@.6 (&6 .@ "&>6@(6&  `v@,v+`b #@t.6 ( &0.@ #&>& 6@(&6궺b #@$.6 ( &0.@ #&>&6@(&6b .@6 .`6` ( &0. '@( 4J꺺b #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@H(Lb #@$.6 ( &0.@ #&>&6@(&6b  .@6 .`6` ( &0. '@&>@& 6(&6      @    * 㿘+; + 7)+(> ="ذ  *v $  * `"?  *` @$ 㿘  ~+  6  `+  3  *   & 2`*  " ;6 & &  ~* @6 &  *  6  `*   3 *@   & 2 *  " ;6 & &  +  6 &   +  6  `+  3  *   & 2`*  " ;6 & &  * @6 &  1)""> ="ئ *v`  * @+ @6   * ` & 2* `$ & ; 6`* @*@  6&㿘  .  6  `. 3  *   & 2`*  " ;6 & &  .  6 &"` * @ &@Ζ 㿘" "   *  ` & 2*  `?& & 6 & @b   ?& 㿘   +@  6  `  *   & 2`*  " ;@6 & &   * @6 &> f#d⸢ #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 &!" ` @& "" " [ "  +@ 6  `  *   & 2`*  " ;@6 & & "  *@6 &cd #d +@  6  `  *   & 2`* #?;@ 6 & & d * @6 & ` @& " &㿘!" `?  `&@Xz+w+"" `  2`2 (     &@{&  `0p 4  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &> f> hc@Ȑb 8b  +@  6  `  *   & 2`*  " ;@6 & &  * @6 &++ ` @)b b   &  @ b  & "6 㿘" "*`2 "` *@ & . @  -2@ " > h & b @ *  2 `> h> h`>`  ! @*)`   >` ! @* @ 2  | '"2# d> = Tb" *)  @@>`?`" "2@ 64  bb  `?㿘☺@ > h> =@ ᠨ@@+ @ ) / @@ #@$@@@.7@ ``(@ `'`0.@@ #'@@@('@7@> h⸅(`  @"@@$@.7@ ``(@ `'`0.@@ "@'@>'`7@@@('@7@(`+> h"@ "@'@/7@ / `6`(@ `'`0.@@ "'@>'`7@@/@'@7@3  (`@"@ "@$@@@.7@ ``(@ `'`0.@@ "'@>'`7@@@('@7@> =+> i"@ "@#@+7@ +`6`(@ `'`0.@@ "'@>'`7@@+@'@7@@ 1"d @"@@"d@.7@@ ``(@ `'`0.@@ "@>7@'@ '`d"@(@7@'@d'@     *```` ` *```` 3  *``` `?*  0`* 2 b b ( "2 (" "2 b (   " 02 " ( "2 ( " (""2㿘ڐ" & 6 8*@  & *@  & *@   & 3 *@  &   @ `*@ & 㿐 "? 2& ?& &  ` " @ 㿐 ? ` $ 2`0 @W $  (  $ 㿘 2 1?  (  )& "  `"   "`  ( ː?"  `  >! *@  "` ?㿘ǒ 㿘 "? ? `>p d*` € ܔ  & &  @   `" &  "> =c( 2    > ="#H &  " "   & &  @ ` &  "> =c`   * @f  $> =cx $ `@B`      @``  " "~  @Ҕ `  "@ "@  b? `& &    * "` &"  `O  & &     *` " &" `:  & &     *` " &" `%   & &   " &@   "> =c &  "" " ? ?`2   " ?"㿘` ?@㿘 F?`2@0@  "@"` 25?     `0 `  ?( "@$$$ "`G $$ "@?㿘 8 " <&? 8  `$*`(  2  ( @ @N @K (& 8& 0& & $& 4   & <㿘   ( @    (  & (& ,& 8& <0 ( $ @ p 0 4@` $ "? ,"` J>p *` €  *``` 4  `&  `/`2  `4 $@&إ4@d@耢 & & $& @&``$  &`&@& 4? && &  &4> =&#&`4& $& @&``$  &`&@& 4?  *```?c82   > >& &`& $& @&``$  &`&@& 4Ҕ? ` &&  q ` & $& @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & $& @&``$  &`&@& 4u 8 " %@%&     &  *`` `?, `& 4   ! > >& (&`& $& @&``$  &`&@& 41?@ ( ` `(  & & $& @&``$  &`&@& 4? & &4&   2  @> + #Ϫ  *```  *@ *`"  & 2  4    > +#* *`"  &  &   @ ?2 & $ `(*`$  && $& @&``$  &`&@& 4 &&  4   ! @  > =# @, `y  *`@ ,   *`    $@ * "  & R4    @ `]  *`@ + 4$@  4 @ ! @$@ 4   > >& P&`& $& @&``$  &`&@& 4E?  ( ? + "@ &  4   ! @    @ْ  4 #\&  `   !`''#`@ؠ ?2 & $ `$*`( && $& @&``$  &`&@& 4@䠒 2 @@& $& @&``$  &`&@& 4ߔ?`(*`$ & & & && $& @&``$  &`&@& 4@ @  @h @e 0 4@` $ "? ,"  `I& `&& 4@ 4 0 0 4@& $& @&``$  &`&@& 4 && $& @&``$  &`&@& 4q & $& @&``$  &`&@& 4c?& $& @&``$  &`&@& 4U& $& @&``$  &`&@& 4G& $& @&``$  &`&@& 49& $& @&``$  &`&@& 4+& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘@ (  ,`(`$" `(`$ @㿘 0 4@":? "`5?  ,@" $"  8 <& <`@&` ,$@& 0 ("& 0〤& $& @&``$@&@&`& 4 2?" 8'H\'L'P'T'X''''''''''''''''*`  " H  X ";" `    , `" @*   ,``"@8 " *,  @   /`,` @?"  '' "@`  ,  *`#`" H`@*  '?'p ͮ / '@"¸  .aH . @``'+@`  "? " `@*8 `+@`('''  p@s`?X " 'Xp"" //'*` $4@, ""4H+ @'  / /L    `/'LT" * @ `P/P" * '4@)  ?, * ""  ) @)@4 @2@)@? @  %*.? @ F 8/ ` `2?㿐#\#`    ??> >"X & @Ғ> >b&?㿐`\> >> >#\l #`!o ??> >"/$ -@@> >b$ %?,`> >> >#\d!#` P ??> >" $ 2 @@> >b$ ?@@0 > ,L> i ( |"L> ,D   "D)> ,%> m+> m'> m -> mD"D`"D H U`D>>!Xa|x?h'pH "? 6"  *```"a a *``a"a4   *``a"  $ #\> >> >! !l #`ٚa "? 6" $#\> >> > #`d!ܔ Ú % H`D ?$`D%&@a&& 㿘  ? *`$`( ? 㿘 (    * * " " "㿘 0 4 @` $ " ,"` >p *` €)` '& $& @&``$@&@&`& 4   @e  0 4@ ` $ "@ ,": $   $ $ $ @ > =`  *`@ > =c+`@   * @  @$@ 4  $ $  @ $  $ $_   $> >$"&`& $& @&``$  &`&@& 4? @ > =`Y  *`@ > =#+`      $ $@ $ $ $4  @ > =`H  *`@ > =c+`@   * @  @$@  4 $  $ A$ @ $ :$ > >$#&`& $& @&``$  &`&@& 4H? @ > =`  *`@ > =#+`    $ $@ $4  (    ," "@  "$27  ,  0 ( @ "?"2% & 4@ 0 4 "@ ,? ,"  0 (@ "@""& $  ( ,   ( ? $ $2D  ,  0 ( @ ""22 & 4@ʐ 0 4 "@ , ,"  0 ( @ ""2 & $& @&``$  &`&@& 4 (m$& 4@ 4 0 0 4@& $& @&``$  &`&@& 4r $& $& @&``$  &`&@& 4b & $& @&``$  &`&@& 4T?& $& @&``$  &`&@& 4F& $& @&``$  &`&@& 48& $& @&``$  &`&@& 4*& $& @&``$  &`&@& 4& @&``$  &`&@& 4& $& @&``$  &`&@& 4?@ 㿘`(`$ 㿘 4 0@`  ,"` " `"&`&` 8 <& < ,@@ 2)&`  4  (& 4 4`"   " `"&`&` 8 <& <@&` & 0㿘04@$  "$" ##@""""4 , > =. .`(  ( ( @`x@> ># `!d7`(`!   7 (   (> > @@# `!97 `( & (  (`@!'@@ 7'@/@ `/@ `,& &/@ `(/@ `6`@2 1 (`@ ("`@` (` (`  !/@7`[1 " "$" ##@""""4?` e 1  "$" ##@""""4 㿘?c6  @`f a !E&@`@`@@`@ `@@`@`@@`@ `@@ @`@ @`@@ @` @@ `@@@`@ @ `@@@` @@`@ @`@@[5#@[1#񀦠,`㿘. * !>   $"pM* "p*@ *`@ #> *`@R$bt"p =>!8>>b\"l )> >t @4!` # t 5@$@, <> *#4+ $ @4 8$ $ $ $   $  , >$ \$ P$ X$ L$ T$ `5$ dA ,  bpа!㿘XO "?> 2 bp  .  * > bt* `   2` 㿘?> 2 bp  . v > * bt* !`?# @6!`H /f    Ȑ    !p* '  !p Q  ` ` & & "` ?& `H 0 8 "1&!d!`$2-&!dH /f * ' ސ 8 @  `2  !`2  @.   2H 0&!d `8?a`` A2`8n2a`1" `8"`8a`2a``8" a`" `8"`8a`2a``8" a`" "a` 2a`232a` 2 a`2a`"`8a`2a``8"a`"2a` 2 a`2a`"a`2a`2 㿘 H /f * '  a@ a@a @% a@! a1@ a2@ a@" V0& @"  / / H 0㿘a` "`6 @``"`8```$"  `?ܐ"   ?"  `` ?`&`&`  [ `" `` "`` &``" , "`B` H /f4 * '        @&&`ڐ  7 2" $  $  $    $  H 0 \ %$ \H 0 T d`$ d$ Ta``@?# @4a`na`  ad  ah\alap 㿘?> 2 bp  .  * > bt* H /f * '  }@ "d w@"d"@"m0 \@"@0  ]@ "! v~@"<0s@e  [@m"@*<28l"H& <686Hd&   8` H 0Y # @28 K28H 0J  "``!<2`? " "`` 22`?# @-2`X  €  ഀ 2 "& &"d `"h @  "l &H 0  H 0 㿘?> 2 bp    . > * bt* ` `  @?# @4`H /f `H 0װH 0ϰ* ' ` "!> >!#Ȗ k ` Ԁ * 2!` ` $$$`?$`&``!`@H 0 #€  `@4`> >Ȑ! kX `"`H 0`i`_^`> "` @ 8 ``_hH /f * ' T`* 6` ` "#@`8@ `<"`<`<`8"`8> `$!``(`$`0`,`J`4`$`0 ?4`@>  H 0 `"` `ՐP $P㿐?> 2 bp   + . * > t* `c  (H /f * ' >   H 0 #1>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $  ް 7V 7'`S` N> " 8 $  ^$``6H /f * '   H 0  4 H /f4 * '  5 H 0  $ $$ 4   쀥`` `  "PP {$P" "`, Q`"` ?" `?"`0 >    > M"  /0SH /f * ' `` @` #`H 0\ 7 $\03" ``#@"``> h `, #`#`"h > #> W*` ג L L $L`` $`H 0㿘?> 2 bp  . J * > bt* H /f`* '` `$0*Ò   €   Ԁ   2   > ֑H 0 ` !p0 H 0  H 0  㿘  Ԁ + Ԁ    `"  ğ€  !``@?# @4!`k !`  !d  !hY!l!p㿘. "* *  G! %>  H$x!> $"|@L"| >x> >>ct"#> d "/ !$!$!4!~4!4!4!4!!cp$!$! > >Ж  , <> *#4%ܐ , >$ @$ $$ $ =$ I ,  b| ͠!p> > @  'H /f * '  aU@@aT@ !G@ a? aS@ aP@a@@aE@!   !@"=`8 @  a<@Na=@̰  aB@0 aA@  aH@  0S@P@ !N@ "V !M@ { A@ՐF@"q 0 aO@b 0!C@aD@ b 0 a>@aB@ X  Q˒ R] "L `0 2F   t2 2;  `< 7 `8 ,В @U`8' `4`87` "B   @Uv`8 4`87` .  *    2   E    `<    @K    7$ x, `$ $ t$ d d$ h$ l l$ p؀`$" $ؐ$ $`0 QJ א؀  t @Tڔ  2 t " 0 t` "` "@ t@ c @ _ 2 t0b@ Q  " `0  2     t2    Es  Ӑ@KK $ t$ d d$ h$ l l$ p`$" $l$ P n  t @Tq  2`"  "` "@F  2 t H E Q "@ `02< ؀ "8  t2 "1  x& \.$ `.% &( t 5%.&P ', " `02 ؀ ? t2 ? #@ "$ x `< 2 $ x Pr  " `02 ؀   t2  !T@2(%, ` "ڰ $ @ Ӱ PG Ԑ @ Ȱ P< ɐΐ " `0 2 !"@e    P! @ "& P @F$  P  2 '> @I#@4 n$ {`nVu r& "`8@ `8 j @.f  Oْ fk "Z `0 F2T ؀ "P  t2 "I  ? 8C ! ` =`@  =! 2@  -O /4 "# `0  ؀  t2  @  @ג O|   @H 0 > >p#㿘 0؀  t2`"  "` "@ @ @ E} & 0 2 t`> #!ؐ '    ! `  `2!h 0`+.,* "*   @R tВ`@R  x' \ ,/ `/ ' t `5`/@ C,``,?&`  +8ܒ ! 4,` +/,* "*   @RƐ tВ`@R  xa' \ ,/ `/ ' t `5`/[@ ,``,?&`  +ے ,* "* &`c > >of#P> #';`  `  `0 2 a؀``t 2@`2`d `l `   ` `2  D- "* ` =` @RN`t`@RI  / / / / / / / / / / / / / //  "`$j`$@̔ > Q- ` >?&`  ¨ `l D- "* ` =>` @R`t`@R  / / / / / / / / / / / / / //  "`$i`$@ >  - ` >?&`  ¨ - "* &`  > ?n 㿘 8 @%!܀ 2 8 BI  &!ܔ !ܑ*"@\&! 8! @ 6 8>  !' l㿘 8 @ lP! @w 8 6 8㿘`   ` 0H /f48* '8 @ @d   ؔ   @t ʐH 00`  νH 00 @؀b`t`8 @X@ x`` \ 2P`2`` # "H` 2``@& ` $`X`7$X .   >   沔 6  2sX $X @@ 2@"@    ` @`$ @ 2t`KH 00 @`8 @ @ lH 00 0H 0 㿘> "| 3%> *" *  x* @@)H /f * '  ` ` $ $ "` ?$ H 0 `|ӑ*㿈 8 @ , `+ L & L ``!ؒ@& `  t2  x " ` \ €  `  Ϻ  x  2 x?#@     " x @  x "` \ ` #   @2`0`"&  8 z @   `  ` ^k" x @ d ` ` ` ^\ x @ɒ S d@ K @ n` # 2 h28 h & hH /f * ' @H 00K @!؀  t2  x  l \    l@ 0) @c "`@? @0H /f * ' @ H 0㿘 0    2 ?> ?  6 08 @؀  t2 @  # > ,`x@K  2  x@ "k  x "  \ c a _沔 N  W ``' 8# `  $"    ܐ"   "    $ $  ̮  %     $   H /f * ' @& $ =H 00 2" && &H 0> h "h R > #> W *` B  <  < ؀ Ӕ t <`2   6  t& 3 t x   \   ؀ "1  t `< 2(a`@JӔ  x ` @  t&  <`  6  tM 0`@J   2 t ``' 8# `  $"    ܐ"   "    & &  ܔ  "S      & "J   H /f * ' @& & jH 0,  2" && &H 0> h "h ~ > #> W  *` n   = B  㿘> #" ` > ?`(@- !؀t`4`4 "x  \ 2x2`8 # "p`8 @"l` ``@ ` $` X`[& X@g 2Ul@ "M .   ˡ   沔 ˙  2֐ X 0& X @@ 2@"@    ` @`$   @ "`@?  @@א2|tʛ㿘! x沐 M  p`"A!``'8# `$"   ܐ"   "    &&  ʫ <  &3 ! * t`8 @""` ``@ ` &` X`& X    X & X@W 2 t㿘!܀  2  =0  &!ܢ !ܑ,``c"@C&!@!ܑ,`@ ' !!@w  =  q   , $ , , !ܕ,`@ $! "`!" !ܒ@ S$ `@C   "`,` $``",` D` !!@<  <֔  6 D , $ , , `$$ `"!$`2Ϣ!!@  <   & , $ , , @ $@" $@$ ! &! 㿘!܀ @!ܑ* @ "  @B    4    `' `ṕ* `+ ( `* @ `! 2 "(""2 "  2 "(""2"  2  "( ""2"  #㿘!܀ "1!!!@(,!@O!!@%!ܢ ,`@"`  "$ "@!  =&!!!@瀢c$!!܀` !   8  = &!܁㿘H o*@ a@  H 0㿘!܀ 9 !ܑ*@$  2 `? * * "*  $ "! &!=| ݖ$!! >  ! e㿘!܀ / !ܑ*@`2 2 $ "! &!=J $!!   8 !=9 &!܁ 㿘!܀ 1!ܑ* @ "*  @G9  2`"  "` "!&!= ! 2  8 2  != &! ܐ 㿘!܀ 4 !ܑ*@2" " $ "! &!<ْ $!!   8 !<ɒ &!܁h> #ܰ ' ; ` `? ܑ- @ "- Ȣ`2"` ''[  ؐ V  R  /` ( @/鰒 -`?&``(( ڬ #$ܑ-* &` > ?f @㿐` (?  (":  h 5@/!"݀@+%8, ` '  t?c*   #2  2 (   5(!"݀   㿘' )   `@F7  2 ` @F+  2 2  @F   "   2   $  㿘  ::  `"(   `(  ` `!, N`.`, a`.4 4    , $ p" & p  , $ h"& h 㿘 d " l d d & d& ha` ;  d 2 d l  l l & l& paM ;  l 2 l P> #''P  ``(  " U  ?ΐ  l@?  /P/ђ  Ȗ 23P*&l0+" 1  `?ΐ   l@?z  P//ђ  rؐ 2 3P lP d  P ['Đ wH /` * ! @ж f$ b ^̀@2KH > ; >ȑH 0 'Ȗ B 8̀@ #ܐ '$ "Ȓc@Ȗ BȀ 8̀@ #Ԑ@'$$"Ȓcp PH 0: H 02 #\ @ &`` P > c\GP > c\JSP PŶP    @֖ '   > ?e P㿐  h/'T!"݀@*e`    dž?c* "2zT #2uT 2qT( hT T T  h!"݀@TP T` JT`  G   'T> ` `   @"` T<  > ` `X +"`X2 < ` ` ""`     'T> ` `  "` T@* `7 > ` ` "` @T T$  8 2"@ "  "ǡ  8@ T 3  T"`GT TT`ـ `  Ւ 'TT` T`7 T@@7 T` ' ǿ (  'T> J8 `B :T @ `> J8`B :T@`B:` 8@ ݔ (  I,T T  @T``$T8  T`$"  ?ܐ"  TT?"  T`?"`T  " T į 'TT` T` T` "`T F  T``$T8  T`$"  ?ܐ"  T ?"  TT`?"`T  "  p 'TT` T` T` "`T    TT   㿈  !" ` *`@? *H /f * ' @H 00 *2 (#%   ͖?c* " #쀦 耦(䀦 Z U  Ƣ   @    #\#`@ 0`@@S`(``&@``'8# `$" 4  ܐ"   "    &&  å I  &@ݔ ``'8# `$"   ܐ"   "    &&  g    &2) 7 H /f * ' @*  H 0 H 02W` > ` `D "`Dѐ㿘`  `` ``@&&º  7` 2" &``&` &` "  T` &`" T X $ X d`$ d$ T`d&`d`l &`l`8$ `@ 㿐沔 9  \0ː` @=h `` @$` $`  ,"@&& 4 `@D"@4 < "@& &@`*  @$@@B4`4` ,`4` @+4` ܔ ה Ӕ  @``'8# `$" 4  ܐ"   "    &&  [ T  &K ``'8# `$"   ܐ"   "    &&     & U   0㿘`  +.`^.`N!`>`0!t&`@!h`X>`8@6`L "!p6`D`&!6`D!x6`F!z6`H!|`]6`J.`O!.`P!x`D  `0.`]@.`^` @D XH o4'*@ g' t 8 @2  H 0 0ހ   @ H 0 0ΑH /f * ' >  n H 0" 6H /f * ' > b` 2`H 0 $ &6&&&&   4H 0 0& && /Ē B?//*` ` '@ ` '/ƀ/ł`@ 2`* 2`* 2`* 2 @2 ```````777/'7//////777//////c!`> , x^  &7X `S &      @&&  7 2" '  '  '  `  '   8$ @H 0 !`!h !l!d`? `8B 2` 8; `86 2` 8/ `** (`&   `  8 2!h `8 !h 2  !l " `Z`?㿘>``$&`>`6`Z@`2!x`2!z`2!| ` *!㿘!؀  x  @ "  \ Y 2 x`!h  !l``X`Z`? 㿐!p t`8`@H /f * ' >  m H 0 " 6 H /f * ' > b` 2`H 0  $ & 6 && & & h  & & a` & ? > , x:  4  / B//?*'  /'/ `$ H /f4`* '`   `` ``@&& q  7` 2" $``$` $` `` $`  `8$`@ H 0 J 㿘@@z㿘!؀ d  x \5 2X \ "T !h@ @ 2L!l @(G`"C` 8? `  @7 872  ` @80  @``@ *&8%`  8 ` @ 82 Z `@8 Z`Z@* 8  X`X@: 2 x`&!p!h&!t>!``>!``` &!t㿘!؀ = x 5 . !`@) !d@$!t @*8  !h   !l@ 82 X!l @8  X Z@8@ 2 x!`:`!t"`!h`X:`2`Z㿘!؀ ! x "!p, ^ , ]m " , ^@/ $@, ]@ 2 x㿘`\ @$ `(@ 㿘`\ ``?  `_ "`t@`t @ @`(* \㿘  .!!@   !  -!@ܒ  .!㿘!@.!㿘 *`]Z'D!'P ' x `t 'x "tP `ڀ   "@PԒ  'P j  B2P B2P 2P* @2P 2P `  P/D@PP & 'P < &Р ԅ,`' 'd?ә,d'?`?'|բ 'l'?h'T'\?4\d?X4`+,ܠ ޕ-`|-?xT?P \* X + x,`d4 @* |'t*`T3P 2`* 4@t+@| \   +. +ׄ ?  ذ  τΆ @ ??'77777 /4D//@ P  㿘}`\ : -”ri 2!p "!p@!! " !p@!!@ !p@  0ɒ 㿘`\   㿘!@n 㿘"[!  !~!6!x!6!zd6!|@U!r!@L 㿘`\  Q `(@? 0I @  `_ @!؀`" `x"@`!h2 @`!l2@ `2`x 㿘^!@  *!*!㿘 `^ 㿘!ؤ !  x " t < 2 ` 5*  4 X  ``@5p  6 t 2 x2 `@a0] b(!+ a+` c d -  ;  -`     e ! !~!6!|!>!`6!x6!z>!h&!t&!p.!@.!@!!Ԁ  >`!X!Ԁ 2!>  X!!؀ ! x @G@K 2 x<@w 㿘!؀ "!Ԓ |@o @m $@k (  !Ԑ  X!@^!@\!@Z!㿘\ .`]@.`^@K`$@I`(@G` 㿘㿘> `$.`]@/.`^@-`(`tB ؐ  !~!6!x!6!z$6!|@!2!@  㿘!آ  x 8 2<  2 x>!h `!~!6!x!6!z6!|@!!@ڒ 㿘 26`Z6`X!h`@!l`@ .`Z2  v}㿘&`u * _* _h> #`t'8 ! '0 a6Ȁ 2 `\  " `\`\ #O#耢  P #`\ H# > ?Z `㿘H /f * ' !آ! ! ! x  2 x!z@] "!ߐ!@U "!8!@M "!8!؀ "! x " !x@= $ ǒ 2 x!؀ " 8 x "!|@) ( Ւ!@!  2 x 8 @>  WZ!H 0 22 22 㿘 .` !* @ 6   㿘 ? @Q  aR@"E aP@0aQ@70CaS@,=@<<@0!P@ "!8 !RU@/T@ -* @ " ! !S@0!6!~!2 . 6!  * 6!~ * 6! *  6! 㿘. * *  , > `""> ?n x!>  @2$"" @,>!\>>)a,! '> ?"!|"@"@  p> *c4$ $ $ $   $ y   5, >, <b`@!㿀 8p$6 8 Ԁ )  2   " 8  & & $  ?& " 8`8 A A`$` X`V& X Ԑ € z  , "`s`  $  &4  7  a77z7Ԓ  x  2  P & P   $  K  `d $`d b"``l $`l` `` ``@&$   7` 2" $``$` $` `"  T` $`" T X l& X & T`8d2g `@b Ԑ ;6 8㿀o > b * > * b *  !p@2!z@2 &1 8  1    !777O    "-?   `&   "!? Ô   ? A A"& ? , " Lrǒ L`$ L~ 㾐> #'`  `b  2``P  F$`P` @ /> b * > * b * `!p@2!z2  8 A A"`=!?&``6 ` `` &` &`&` ,   '7'' ,rn L`$ L~  > ?Wu 㿘`< @ +ap < $ap` "`@`@ $`@> ? $`@ `n``8?  @4`8`<,`<`H$`H`  $``4> *<* `4 *`   **   `{j a` {d 㿘!p @> *#<% 4& @&!p*    * @0*!`@0  㿘 8!! !p{  ! !  !p{ ! ?$! x> #> ֢`  @!2'@  !@ "!p8!1! @"!p @ !@ ")!p!9@7 0a!@a:@` 耢 " `8 4`8 ` @|!`zڔ v耢`"r ` `@?@4g `-$d b$`@ 5Ԓ ]yW  UO؀  QxА`8 ?H4`8 o@D yN =  94!z`8`@R4`80ؐ@/ !p > ? n !z7y"  6!p @ !p @e  > ?V' 㿈!p 4L! )ڔ  `A !h$!| $ @5   @5  2`z$!| $" $%!| a1 2 `""`"@+S 㿈!p  ~ِ` G!h @5P  2  @5I  2 `4/ a2 %!|  2`"  "` "@+  2   > ?> ?> ?!aXkT"~㾀> !p c'`'`$` $!|`$ $ '   y`2`"  "` "@*Ԓ !| 2 # > ?UI!hR` ` ` "``R`6`   R` `  "`  "``R`6`  @  @    ` "J2#  ` @ *J@@ `J@`  "  J   `?㿘   ` @:  2  @>       2 `  @ `> m ( 8@ @ @   @ ` @  㿘@V``  ` `  "``V` 6` ` `     JJ@   ` e` 20_: "  :  ,@8 ` V`4 `E ?``2` `@ 2@  "` T4& + @8          2  T    2 @2`  ` 8:`( 0 " ? 2"( * 㿘@`     JJ@ *J 5&& "@ *:  ` ` @ ``V`8`     $ $ &` &   @ 2& & &  㿐> " @ " @> " , )> m> ma(!  wȒ`! @w”$! -> @ '> , ! L? "?! $@4 6$n , 6! "@@- ! $*@!! ` ! @2 2 T`R␒  0'  I ␐@,`0 0! w{C` > ?aii ( 0-   "  $L  :  `> , *`J:`@ 2 +  + @8`6   .  @ 2  :  @ ` *  㿘> b  "b  &  > ?ai  @,q  6 .  " & & & $㿐  `     2` ` 8`=  ,:  @뀦``"T r     2 2$  , $ `2$`$` $ $? . & 6` $ `4  ` ` ,  @@8 T` 6 @`2*: ` "`T`&`@ 2 `T &``2`` *V: @ "$V &$&`P-`T:   0J  & E$ `T@@21,V: @&!4* "  ` > ?ah ӐÒ ݐ 2<`V@&$&㿘 4  @@1L" 2 `        2  `"T O > ? $`bg  > ?bg 8  ? 2" `T V 8 4,  V 2 >  & 2> "@""2 > ? gb(   ` C 2 & 2& &   `  ```" > ?`2``"> ? "`bXgT  r & & & &  & & `2"`"`" ["`   `2"`"`&3 V  @ 2$"@ > " & ? " " `2#"> ?> ?bxf "  &`& `& ` & `& `& " " ``2"`"`  # ` , , #㿘V  6   `2  "   V ` V  6    @   2  "  㿘  t9  $)  "3 @* t&> ma$`,M `\ * " " @8*` 2`$`\`!> m# `># ` ># `># `>!(># # ԄbTP$@$` $`$`$` $`( 㿘> " !> (␀@4$"2("`*`> ?bfK 0)  #֔ #> m $a$> ?e""*@)@ "> ma$> m  "( "  *  **> " > ?eӐ"㿘  > , 7> , 6 "$   `4 4 > bb $b" "b$  㿘  "``"  "` "@%9 㿘  `Ԩ||||XtՔX|՜մ|>  㿀> "'T'X'P'H'L H  @@2@ `" `@28  "  @/  2.  @/ 2$沔   Lǒ   Ɗఀ    2 Lu א0 nఀ  0ʐ 㿘 `  k -    \ -J`U.`>"( €  M I "F 96C "> 9A0 8 1 8$ + 9 `€"  $ #   2   2   9r& > ?d"W> h㿘> "  "  $* €  2 㿘k> "㿘` `@  `4  @ &`` 2   X > "*` 'H / * '  `3 `€ .>  +c4`"' 4!" 8̒     @4 ' 8 $ 8  4"  ` 8 $ 8> c4`  "` ` @'’ 4'Đ@  H 0㿘`  `@  `4  @ &X > "*` 'H / * !  `F `€ "A  2= `5' 4!1    @ƚ "' 8 /$ 8 " 4"( @'a 4 ' ' 0' @ "  4 ' D' 4 @  0 8 $ 8  > c4`  "` `   @'5 4'Đ@ f H 0㿘 2 8> ?cc#?-& 8 4 )  > > ?cS#b? "b> ?# d0@  @ D`" ` ?"`  "Ӓ "В 㿘 2 > ?c+#H ?" 0& X > #" ` > ?cP@Ԑ n  3k) @'  0 @2 @, 2  D@ n* 2 A=`` "`4  `4 ,  j'''''' @4``4> #8> 4c< "4  @b A  `'@=> c4 "c4" $@&Q 4''''ܒ@ `'D@&@ 4DD` '` '`0'`4@' @d  D`8  "`8D㿘 4@@ |ѐ 㿘`> ?4!2 (> ?bL#`2>> ?bF#b؁ -㿘` `  ?  m m_m m 24 "   8 4?` & 8 `  2 D  D " `   m "`@% 4''?Ȓ@V㿘 ,   `" ( ` 2  (mk " (` & , ( 2  (  " (m& ( ( 2& (    "  "   ,`" m& (`    $ $ d& ( (`" 3 , ` & ,㿘H /` * ! `>  b* @` " /`$ 2&` " ` "h`(0L0``    4!  "  x> ?aU# $x  8 ?$ 8$x|`"4`8?"`8$|4D ? $4 > b "b&8 ͐ $80"ǰ  "ð  4a2 D  v@@&`$ 0&` H`&`  &`$ 2`(! `(  ܔ   7@$ `$ $ 4$ `@`    7`  `@ tMQ 4`o%   $ $ D $ @P$ PT$ TX$ X\$ \`$ `d$ dh$ hl$ lp$ pt$ t$ |8 "8` `  ’ @`4@" `8` ` `8 ?$`82  ?$  4@@"  x | " x x "       " 4& 8 $ 8 4!H 0㿘@ ?     0 "  ?  8  (      2 & 6  & x @& 0noni  x `8 ?"`8& x 4    & x P 2   T" `T8& T 㿘@.@ @`.@ `     .@`@ *@ @#"X ' `0   g  2} 7 Ē̒ " 8 D?@$ 8d 3b Aj L$ D@#P 4 ' '''̒'```   @ 8 ` $ 8 `24`21 "- 8 D?!$ 8> ?a# D`   D` ?"` $ D $ @   &   @w㿘#> ,` " > > ?> ?> @#c8_#""!> m!,>Fc>  F!, $`㿘> , `     @"ƒ && &  & > `&  "`"& "㿘3 `"  "`   "@` "`&  `"@ "  €      ޚ i   "> @?& `o P  2  ` "`  " 㿘$ `"  "`   "@`"  "` "`  "@ ` "> @?"``> ,  2 㿘>   .  2&  `"  "`   "@`"  "` "`  "@ ` "> @?"``    2   3   7@"  $ $ $ $  $   "`  & $ $ $  "@&  `  "`㿘>  H /`4> * !> "`@ 1``"  "`   "@` "`$`  "@ "  €         ` "> @?$`_ ` " ` @ & ``2`H 0>  E||ddd|㿘`     & @!~ `* (   > cH ?"cH > #H" > #H"> H` ?"` H`?"`H /``* !`  >  `   q`>  ;    H 004  > cH  "cH > #H`" > #H`"> H`  "` > , $ H`A"  @6 H 0P'L'P'T'X'H  '  `  `  ђ  2` 7` 2`> @]!`K('`@ '    '} 7  > 'q + `4&@  4 'L@ՔĤ`' ` 8Y Ȁ "  8Q Ѐ " 9  "G 7 @ *@ 7@&l` ": 7 '   & "- ?`'>!*` €   8 D&8Ȁ     P @S$`8?"`8"H>  b* @2  / ̠ "  " 8 &8 c  π0 ʀ0 '0''H' 0"@`"'` 'D'`8 "'D '`46' @ @    " 7jr @ 4&P&$T&(X&,\&0`&4d&8h&<l&@p&Dt&H~&  zȀ   m E "g{ " `؀` Ȁ   "g͒ -$ D؀ g 2  Ȁ  4 "  "  D "  D   D` Ր?"` $ D  ' $ @ $@k P D "   Ѐ 2$ H P * $ P $ $ P - "& @&"    @ > #X`4   0/ 24 Ā  > ,2  A`  "@ޒ ` > ,> ,> ,`  4   `" `" @`" `" ` "  `" `"` " 㿘@ƒ  :  *" ?  @ *㿘   L  T L$ > @Zِ!  .- H /f * ' > !R & $H 0 $ (  & 6 & 0& (& ,& <& 8    "0  & & & @Z`  ,`-@@ &@ ?   v``,`  ,4,4 㿘 &@    L  T L2 `,` @*@&@ ?    h``,`)%`$  &   "’    &&  & ,,4㿘> #X`` @ "`"`@> , "`  22> ,> , `t`> #X`@ 4   D` 4 <4 V 8 h%$ > , $ > ,> , P3 `> #X ` `d  @w 4  `  `    @' `'`''ࠒ >  4 2 `$"`"" ` > ,`")` '0'' "`  424" "" > , 22> ,> ,````@    4`@[ @ 4 @  0' ' H''  D''8`'  ` "6` "2` 4. 4 #  t#  P# $ T# ( X# , \# 0 `# 4 d# 8 h# < l# @ p# D t# H @`4# 3 # # # e` "`&`&``@ 4> !`"p ``" 4@2d `_ @'Ԓ f``M'` "J`` 4F`4<4 T8 D$ g $ `e 2@0`@ `2-`'` '`' 6```"`` 4`` `42 `"`$""`e` "`&```΀ '''2` x  f `a  @( '   ''''H /`4ؐ* !؀ %   0> " 1>`` .`  `@2` (" `0@H 0 ’ 䀦@ '"  &  *` * " @| & d             㿘b@ ( .t-* "?  .L$,   6 &. . 㿘  (b @ @/@/h@/@`.`"* * ? @* "?  "* * $,   6 &. . 㿀> #'@?`@    ',@   B @ &` `@2``@2  ` *  @@ "/ @ &` `@@ ``@ @ ` *  @  @ 2&`& 2 ,2@&#$@" 3 @` @ ,``@``@ < @  ܐ` *`@ ` Ґ 2   ?* @ ג Ɛ "  * 2`?* 2  2`, , , ,  @ " * 2   2 , , , , ` @?#,2  4, ,,  , `  ?#x+ 2  3 , ,,  , ``!> 0-` €`` ^@\`2`` "2 ` ` "2` `` # ?* 2  3 , ,,  , ` 2` `dޔ$ `@"  `.$ `@.@ `@ ,$ @.@  4 "@& & , , d     & `d ` p.` `.# > @@m! 㿈  #\@  @` & d&@   dy$㿘\p"3   ? # @/ 7 *" *  ` * ./h ( ` 2 * …`dE4`   ' '@$ ' `@   "  $? ' $ ? c 7 /  `*`" *  * /h ` ` .*@@ 3     + `   `0` ` "@    # W# `  `@"@ P#   +     * @3  3   + ```2    *  @ 3   ` 3  ```2    *   @#    # `` `2    *   @#    # ` "` `2 `   * ` @ 4`    ` 4`   4` &@ ``" 4` 4` @@`?# @3`@ @3` 8 4`'@` $ ? ` ' 7 㿘!> #\@ƒ!`#\ , 1> @/>->+>)> *  !0VՐ#4&Дa  $`@$`$`$`,`<$`,`>_#$@^/ Zϖ `!`ߢa`㿘H /f * '    ` & ` & & "` ?& H 0 `q 0ہ㿘k `&"`T @" 88 @"  8 @ @2   8"@2 82 8 㿘. * !> ,$!,  \* !,*@ *`> ,@ "!(@.*`!, />Ũ#x>?bt #> @ a8V;   % /. >. <& @.!&. =& & & \& P& X& L& T&!h&!l^6 8] , Z0 a, ۰!㿈 8 ` 'Dh l  2   D@Ӕ  Q       D bb D , " Y  7ʀ /> ,!8`D `   D` ` * @  D`@ * 7 'l$  h@    7 'h$ 7@7``$" :p` H /f * ' >  K H 0 " 6 H /f * ' > b`  2` H 0  $ & 6 && & & 2 `D`7" 7> & `& ` & ` & `&` 6` a  *@ @ & & `@&  ` * &` ` `*`" &` a &&``@&` &`   a*` a a4 XD> ,!0`2 D`" D` ג  JD`( `" /``8`$"@ܐ"   " `  &`&`   `` ``  &``"V `2 D 7` M"`D`"E  / ` @ - 2 * 2 . .  . `7"h2 . 2 2 . . . l@* 2`. 2`2`&. . . > - !.  . `* 2 2 . . DTp`"TD d ` @ d@(  D`X "`X㿀> >   'H /f * '  af@ae@la@"8 a @a@ a1@ a2@0aI@ 00!g@ 8 !jai@* !J@ 0π@ "; a!h@zư 0!K@"ah @ /,a 7,a" /  / y `/,a`7" 8 +8 48?Đ*@486 #$ap Z @$ah@2ah$alah {al wap``8 ߐ?"`8$ap@{ap 2 8$al$ahH 0c 8 Y48@|   // ah@s   //al'_ 0A  < 28 / 24 / 20  2, $ah$al  !$al$ah " 1al  1@9   //ah'>> al'> > H 0c > @;{!@㿘!p@ !l  $ , ,  8#!l `   $ O!p``@2  8`8 ?"`8 $ː $!l$ 2`  ` ? ( ? 228 * 2 㿘H /` * ! >  > ,a<8Đ>  `!> ` \@ 8@ `2`H 0㿘> ,d`0 `L>  `"d "!> m!D>ɔ8`D>  8!D`4 `@ `< `@!@8&`T0Հ "` 0"@ 02 `4` &`4`4a&> ,` t@`@> `<`0,`@ 44`@&`\ <``P `T!@ ` @ &`T@" ` ``@ @  > @ 8`@aP` `<,`@`4}4  0   &`L> @axP 0p O > >  Ē`# "@ $``4$&`4> `` $@`" "`$`>   O `@   G  2 <`  H  2 < : &`\`@ ,` !`^\ > ,!``> !l&`@`D &` ?"`   $ &`D> `Đ?"`@``"``@"&`L`4 ;&`4` "v 㿀)> # '  4 `$ $ @$> *#H^ (4  4`(  4 4 , , ^ `^ `] `]   // # > @9!㿘!> *#H= "  ^// /   / / q/ `"`L @e 2  `2 `\> @aO Y `0>  ( 8  2  8   ] 0B 8 2?  "$ $ `\ 2 `\> @P!> `&`\`\"* `4 ?&`4 `> " > ,&`\ \ @  $ `D!`@`  > ,!D`4`\` &`\&`4$  㿘> ,aH Y H /f * ' aH aH $aH"`"`?"`H 0 > @ 2 > @Nڐ"    &aH "  aH  *   @  u aH h@@  aHk aH p> #  ' " Ը\ \ >  H @0`"< 0@" < H@2<   @  H @ H2<  @2<   `22 Ɛa`H @    > *cH@   А@'> @b@'> @b@Nm 0Ѐ'@ʐܠ`> @bxNZ 'Ԕ @`? `~`0z : `@ P`4@А@'ܠ`> @b`N* 0^`@ @'`@ `q> @)b@~'ܠ`g> @ c0N ` $`\`@" `0`" 0 А@b'`@ `I> @c``M 0"  `, [ `\ > > ,@ $`\`4 ?$`4 `$`` $ 7Cc耢  [Ĕ [ @]  [ `0   [[ Ԓ[  (55[ [ (4  //` c > @7N#㿘 `2`8> @M'# $``0" `  2`*& `4 ?"`4 `    㿐> m \*\ @ .&6 28 4? dd"80 `"L`@'> @cM4   -㿘`H !``>ɒa!&`&`㿘      *   h@@0p㿘   /  > ,0) '0%!l` > ,!p  #> ,ah > m` @@  > map Zܔ > m alZה  $ah> m.1!l9㿀)> # ']  3 $ $ @$$> *#HZ   54`  4(  !` 4 4 , , Z Z Z   // # > @6U#㿘> ,!h` . > ,> , "ap"!l'> m%> @#> ??ah`l2 : + #"?ah %!l> m!pZ\ > m!lZW   3㿐ƒ㿘 2> AM 0> AM  > A%> A#> AM}? Mx` 4> AMr 㿘 > AMj (> AMe 8 > AM` H > A $ X MX 㿘 > A   MM 㿘> AME  t> A \  4M> 8> AM;  > AM6  > AM1  0 @> AM+! @`"> A> A!M#` DM! D> AM!  D > AM!0 H x> A LM!@ L㿘> "> AM!X >ΐa 0> AL!p x> #'  `. 8` > AKM! > AKG!@ /7`` '``'   @          $``` (@`"> A?#` @`   @"   "  &* 2 6 #4& * @.    %@                         ߠ ,       "3 * 2 6 #4&    * 2`6 ?# 4&.       ? * @ `2f` > AL !Ȁ?# * 2`6 ?# 4&*c > A4x!GhGhGpGpGhD,D<D<DdD<> > m ́ t㿘> m!t  2  &    2  8     !t""" $!t&  ?㿘> m!t "  2   8  !t """ $!t  㿘> m!t!t  2   "  8㿈> 'L'P'T'X'H Ф ` " $  ``$`0  ` :  2 ` $` "& & @sZ `r"0y  "@& & ```0g0d  $ 8`^ `2Mu  L0S"`"`8 @2D >  '' ` ``t`<`'`'`7 `2` 2@8 ? " b&`@G 2 &`> "  `` ``t`<`'`'`2`0< 8 2 `$ 0 " >  '' ` ``t`<`'`'``2)@8 "@@ 2`?`>ϐ#*` €`( &`@ &`> " ̐ &` `` ``t`<`'`'`2`0 "8`<` 8 2^2Z ?@> `" ` 2`<`"`0& ` ` 2`<```t``@@  ``"u@ 2``n&`` "`` "` d b `&` `"[ Y  "8`S<` 8 2" `="0D?@> `" ` 2`<`"`0& ` ` 2`<```t`#`@@  ``@ 2``&` `" `` >ϐ#*` € &`@)U㿘H /` * !   ?8 &   8`2& ِ?@  & @ 2 & > " & H 0㿘    8 ?   8`   `@ 㿐> `̀ Q H /` * ! >  $`'' `4 `t`< '+  ? $   2  ` @L   @G  $  $` ` `t`< ' ' 2 H 0H(> mt 2    2H@H /f * ' >  ?\ H 0`" 4`H /f * ' > b`  2` H 0 `$ $`4`$@$`$`$` `;> ! `$`  $`$` 2* *2" ""` ` ?$` $`*, $ @p4 4 ` `  $` $` /' /  @, > ``  "` > ,> `" `,`( " `<`2`, > `"  `4`0 " `<`2`4 <  8  ?     * H"*  @"   *  @   :@2㿘@ H   . ``:` `*`?&@ #: . 㿀> # !'@  !@ 00!@0  "[ q@^R >     2 < a@"'a@"< a a@a@2 a0a#@ a!@{ !@  aa%@q a      2 < H@2 < !@2  " 1  O > AE!2q   ֐ x@  xH /` * ! > $ <`` <$ @`""`$  $ "& D T d $$ $ , d8   , T, U$ $ t8 > ` "`H 0/      "    H ``<` ` 2`<`H 2`<` ` "   1a@?a@"H8a @0ma@a@0e0a"@" 8  !@a!@ 0Va#@a%@0N D& H& L& PS&8  N  T& X& \& `D& d& h& l& p;& 9 H /` * !  T' X' \' `'$ T$ X$ \$ ` a $ T$ X$ \$ `H 0   $   . T$  ( H 0 8 2 $ T$ X$ \$ `H /` * ! @Ɩ  Ȓ H 0$ 4$ h   H /`4 E* ! E   2  D & H& L& P& H@" 0 @0 $ d4$ h8$ l<$ 4$ p8 "! 2@q  $ T$$ X($ \,$ ` 28`"8@_ 8  !   $ T$$ X($ \,$ `Q H 0KH /`  '* ! @( ` "`&  "@ <`" @ @"`@> "  @ <"@ ې?$  H 0  -   > A."> #'2 > AC"!@ "!@"Ȱ -0!@2ð - @" 2  2  `  2  @  "  8  !@ "4l!@"  -0!@(l - @2 @] @Q Q "Q  // ai@?  @0ll @@ 2[   !@l ܒ    `2 l  2  09 1!@p D DQ8  T TQ0@! h&&  @ @Q  D DQ8  TQy T dQu d a > A-0"8㿘@ؐx> #'H o&*@g`D &`D'`H`L&`H''&`L `P&`P' a  &`D&`H&`L&`PH 0a#H 0> #" `> AbP@n   &@`D&@ @ ?0 @ ??&`,`4``,&`h&`4 &`,`,`d`4 @ @ &`(&`0D&`$8  `4`0`,2`(&`X2 &`8 @  &``U   @T8 8 'ܒ@А# > A,"`㿘 X H h >   `8  "HXh @ 2<  <2 r    $ 㿘` 2` N `8   `X`H`h >   "48 `8  " H X h @ 2# <  2 <8 ` ` : ` $` 8     ,    $  2 8 ` `   ` $`?1 /`2`> ` @ "1 > ,`8"(`` "$`a2H"X" 8 " 0" (2  2`@ 2`8 p> c'H /` * ! >  ` ` 2`<` `t  $@      $ 2   $  Z&  6I  2 @H 0R  && &  2<2 &  6H 08 t & t "`t"t&  ` @// ' a1Ѐ  ` "`  " 6H 0  ܐH 0 > A+$"pp> c'H /` * !  ? &  `"  "`  "@ / '  a2t 6H 0c > A*"㿘&&   a & > A@"6 >(0 *`0 *  * 2`~0> ( 2`~> 0(@ ` *   㿘 В j  ^ 7@@ > - a> - > -> -, $  !, , , $ 8H /f * ' $ `@$ &`"` &@ 4  6 `  `* @ $@ "  4  6 `  ` * " 4  6 `  ` * @$ H 0  & ?$ `2$ Ȑ!$ `$ Ȱ 㿐8>     @  @>  `" 16 2 0 2    ` ` `U`` ` `< 8 `6`'@  -`԰ 1 2"-`2  /# 6 2ð ` #> ax 4@   ax 8 @ 2 0ax4 @ " ` 8R  2` 0`&0`266`  > ,> ,!a   # "X   > ,> ,!a- ,`2 2`9 2 $v@ [$$@,`2 $4 ?ݰ 10\?* 2`@46 : 4   > ax 0@# ې866,`?@ $&@@,`2`&@ 4 ? 10% * 2`@ 46 ( 4  j > ax 0@ ې66@J 㿀 8  ``@op `!"` > A>" " d  " _ / I>  " 0  ? H2  0  8`" 0X&  0 2 0 8R` @ @ 2  0쀢 7 1'3 `'`'  @f 6 " 0" 0 2  6 2 `~ 12` 1$ 0 $  @4 4 #\#`    @^͚ 㿘 8 `> !!` & `& `& & & @6 4 8 `@㿘 8 G"` " @ @ " ` `!@4 0@ H /`4 * !    ` "`"  "@ "   ` "`"  "@ " @XP Ā " @XJ @[H 0H /f  "@* ' ` "` "  @ "`"`   @ "`H 0 㿘`  @&`  , , 64  0$ 㿘 8  @2`@p0   @}&`  , , 44  $ 㿘> #" `\> Ab@ik ` /``+'./ 2 2` `!2  2  8 "  42  62   0 ` @2 `㿘` `` `!2  2  8   뀤` @`& @@  4 D'`0'` '`45 `4  ``  G`00ΐ㿘 @ & @㿘 @ .2  6/ 2 @2 `v  `!"  $ 2 ( 2  , 2 0   $   $  $  $@  2{   2  2   2  "    2@  2 @  2@ @  `   `  ` = @j  2D  42@ 3` 2/`` 2+`` 2'`` !  `!2,    2$  42   0" 0  0 2 `````"  @6 ` 2U 6㿘 @ 7 @@#  8 `#2,             . .  &  &  &  L&    . .  @& 㿘@ ` @28 8 9?"8&@2@@   @ 2@  .`.` &`` @Ē @` `@ 8`"`D 2  Gc4  2 4 G 4 >   2  1 &@< 8 2 D" D>    2 <  D 1'  DH(  `!"14 46    @("   @(  46  (" 46   ()" 6   @("   @( 4 6  ("4 6  ("H 㿘@.6/  7 @  *  1 `!2( 2$ 42  62 0 2@ `"  "` "@ &@" #@&  2 `  > ,!` (+ > A"2<3 㿘` @. 6/  7   *  6 `!- @  2( 42$ 62  $@  2 `"  "` " &" $&  2 ` > ,!`> A A2` A#` - @> -"a㿘` , > a "a?@ 2%`!  @*           > a` "` #  @k  8  @ @*  8  `(8'   0` - H /f * ' > !1 & $H 0 $ (  & 6 & 0& (& ,& <& 8    i`  &  ܐ"   ?@& `( > A9#> ! .` ``" *"` "*  `2 *2* "* B2*O   2    $?쀢 : > A9# ? & & & @& ? *@  #?* 2* 2  "  -" 0 㿘 @z㿈'L'P'T'X'H '@` $> a` b"`@8 @ :   2 > }a "@& & @b > a` A"`  "@& & (4> !*  `" `() >ߐ"$*` €n>ߐ!. €   _a Za Ua    `#a  *`@`<  8 "<a  )2 > -`C0@6a` "` `*``0i@ 2 a` "` * > - !#  > " > ,* * a * `@  0a` "`> - 耢`2R/  # aK/> - 쀢`> - 耢` `  # a`Đ "`Ā`b @/' 1' > - 䀢`` $Wa> -> - " a"   `pDB k /h'  2    8 2X " X&   ޒ a``  "`* `@O" 0K  ˒ > - `?a`#( `  `*` @`8 a` )"`> -!$#  > -a"`> - !"  ' Ԛ쀢 > - `> -!> ^a쀢 !x! @0p>   '   '-`   ?  " x >  % ` > - H@ `8   H@   8`" < X@2 <  "  ` C 2) Hؐ@D ܐ * /"Ӌ؀`2`t>  T`1"Tz    H`D "`t`8 ?"`8 H % ``- @     A   $ "@8`  D 2  E  $ $ $    (  `@ހ   4     *@   $  "5 @* @%  "`&  "&  EU  |6 @cgc > A! #㿘   , "@& & 4`@`z"@4`  "@& &    @  㿐@"T@ƒa* &. . @(#㿘`K ?`E>ߐ"ȓ*` €> - > - > -  > - > -  3> -֘`5> -  ``׆  &׀$` V& *㿐҄  "3  4 $> - 0   g " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t> -!>`ױ ̐ 㿘> - ! < %PT  `   * $ > -`@ @> -!D P aD*@( !' @ @   "PT "T҇ 㿀> #' 2 4> A5#  2$ P   ' ''  ' 0>  b> ,* *  *    #耊 "& T# > Aΐ#㿘> - > -> !|``?㿘 2 4> A5#      ӡ 0㿘.`  .2 .   ,,`6 FU2 @}6 , 4 FM@u6` ,`6 㿘j%?'> m)!$@I #c4  > m> m2zY2ax > mU2a|$ሒ` 2 !> m 4!! > m2a~ 5> m7> -3> m1> -> -4!! @!*  `4#$@c4 $ሀ` > B ( ,,`2   , @4*  2` , 2  @` ,2`z b @  ` ? 6&a5b6`㿘> -!`a/  > > m`!> m|!> m! $!!a` 2 @/@ $!i -> m> m> m!~a`)!xE@Ē!?4!x`> ma`> m!|x႒@ &5a`> maz> -b . 6 x 8Ph(@Xp 㿈> B'1> m#\!06 !x"K7"""#g""7777> > B`@77777 7#\   +   |x  > ,> B4 H#@ *"@ *`" *  *  * " * "> b: > > %> `*@@ 6*@> -   @/> ,!+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > " ``2 `4S```:+ `4@ #> `> -!"`  " > -a > -Ԙa> -"a@j    +``2`*` (  #  +``2@  > !8 +``2`*` +`@ +   > B> `P @А > B> `X @ʐ > > B#`h@Ĕ 㿘H /f * ' > ` ` """`?"H 0 ` ` > B3B p@ 0ց㿈>  `h'D>  `"      'D  W$ D<  @  `X G"`X2 `<` ` >"` @  'D ` 2"`   "  2    8`2  `p "`p 2 ?    t `" " t @\v   ` "`#  `t "`t @D ` "`  ` "`$ D 2"@ ""  D  D D> -   @ ,``"!@H  D@' "   8`2k  < 8 .  D     <  @2< t`@  ` ``@ 2``2: j 42> -!``D   H o *@ g  ( @@J  D#\ @L˘ H 0 9 D@0S ?@D`   ˒ 'D `  A"`  H /f * ' > `   H 0  >  %`H 0 > !Ā    2  @2   @2  @"  2   "2 4 *` `"  `` "``H /f4%`* '%`H 0 0  * 4 *  i  %> -`> -̒`Ȑ  $`@)`d $`dH /f4%`* '%`H 0 0>  )z `d $`dH /f4%`* '%`H 0 0 `$*D" @" 'DH /f4%`* '%`H 0 0z`@ $`@`   `,`4 @H /f4%`* '%`H 0  ΐ < ` l9 7 )5 3 1D ֔ H o *@ g  ( @?  D#\ @K H 0    (D`{"(0 4>  "4 b @ > ,* *  *  D  0{D> =H"8  8 40 ", > -`"!<`2<8"<X`8 `0`(2 <`  `2`2H 㿘`  ` *`  " & -&   U  ,> > aĔaĀ &@" "a&` <.` ` .` `6` &`   &` &`3 `2}` ``   `  `   + `2` 2> ` ` `  `@` ``  (```   $ `>  }r`2`"2`5``  ,`)> - @ "@ "@z` @`"``"``@"@> ) !̢?` %!`  4`2 @` $` " &` `  $ $@" %@$`  `  `` `@` `  q `? @c *   >  h`@c"h_ ` !> |&@)B > -a̢?`"a̠  )4!̒?$!|2 5``%` `%`@`"``"``@"@  @ * @& @  *  "@&   @& >  `y">  (> -a̰ ?"á㿘 "'> %> -y ` "` "(ْ̠? $`"  "` "@ 㿘H /` * ! H /f * ' > `   H 0  >  $఑H 0 > !Ā>  ? *`  `$` 2 H /f4$ఐ* '$఑H 0 H 0㿘H /f * ' > `   H 0    $H 0   "> aĀ  >   `!Ē`P$`!Ā 2`H /f4$* '$H 0 㿘 2#>   `/"aĀ> -!ȑ*` > - ̑: @?> `>  c '  -` `  ` 3> -a؀``  ?  $`Du ``NϪ%@`2˪%@> -!`"   a $9K 2?`%@   '@"%@ - a< > -9!؀   H@'̀  H<   b,<ҢЀ$р` Е2   *` ? ~'H%@ ?; Ӑ  "   ,$@k $$@ѐ  c%9x & H;̔ ѐ  Q> -Ēa; 8a؀ Ґ /C ' ; Ґ /Ҫ%@` ``  > -!`@E 0 . '̢ @ '̔> B`-   ?  ?  $ Ř > ` `P  "`Pc > B, 㿘>  ?` #> ` #> `8 ?"`8> " ̐  , $ ,``̀   D > 㿘> -! `@> B . + > ma;$?2 > -> m"a"㿈   //'7ے "D  4 $$2: 8 0 `> 3 8E4 !``"+ 8` "#` 0  @2     `@D 2   8 ?$ 8    2``2`  8 ΐ?$ 8 㿘!> -!Ԁ  v  !H > -!+ `& > B В . !> ma* !  "@ > B- ?  *`*` `:   @   %> B! "@-ߐ@$@ > m!!`$> B!-ϒ 㿘  @` ` , ?:h"  "`&  "& @* @@ $@ > c> - '  `   > B` !`- ` ! > `' 2 `>  (`v"(耢`  , l> >  ,` -> `@    8 ?$ 8> " ̐  ,,`Ǿ$̀     Q ` D4 w  " @ @ `yM*` @ @2> - 4 0.> -  (> -!`$`#> - > - D!4` 0 > - 4 "` 0 ᰦ   > B!0 - > -!`  !#\ ̘ @ >  (` "(> ` $  #"$, ",)A >!* €  ̦    T` @'И` `L  "`L uڐ > B,!H㿘` ?`>"ȓ*` €> -Ř!> -!> -! > "Ԁ` > -!> -!!> -"!!` !> -! > -˪a$! !> -! Ē !R $!!> -!> -a!˯ 0> ,m!> ,g!> ,a!> ,[!> -U!> -O!d> -I!h> -C!l> -=!p> -7!t> -1!x> -+!|> -%!> -!> -!> -!>  >  > -! > #  -4@X@@LLLL 8\بؼؼؼؼؼـــــ٘   ܐܐܐ܈ܐ܈ TT> #''L'H'P'T'X'l 'p/g`  ``!l> B)!Xl `> B)!x @۔tt'll  <* @ &6> `* *` > 6& 8  "8# #$@ . ~ `/gؐ@7 @`4 "8@" @8 ߐ?"8$@@   ,,$"4Ő 2 4 >    @@.< 8 2@ "@`>   , @ ")<"% 2<@ 2@0@`2`T>   TX A`D`@ @`t "`t@`4 2`0< 8 H& H /f * ' l } l``$"`> B!( $` @6`( l?'pl} #\ p @Cu lH 0p ?R "'plH 0F S `$@}  l`@` @ l` @R  l}`2`6 '\H 0l` " @ S l` ?"` < 8 #g 2|`2@ؐ@* @`4 "8@" @8 ?"8$@@   ,,$"3 2 3ܐ ~>    @@.< 8 2@ "@`>   , @ ") <"%  2< @ 2@#@`2`T>   TK A`D`@ @`t "`t@`4 2`0 2H& < 8 |`lR !"2``    .>   T Al  T 8@ `"  8 2  `2  >   T 3`" T'p  > `" ` 2`<`H& ` ` 2`<``t&     2 l  "` " l@Y l` ?"` l@9 l 8 #l02l|'|咒 "l 8   1'p2 'p @@l`!` >2`` `@ " ` P  ` 6 ` H /f * ' > c\ 'l   A'pH 0all 2  H 07ؔ\@5* 2 > - A'pH 0Dl!`S@Pl LH>   :` 8 2?l l: /$@ H 0`2@`"'`4 `'  /'/''`' `"`T@`  (`8 Ӑ?"`8$@Đ ('pl  <2l@T 'pH 0pl {c  l 2 ` @@`qQle A`    0 " @T l`  ?   0   @D l` ?"`  `l  Al'pl~ @1. "6  0 2 6  >  " ` `x "`xl@O6 l > 5ba,  "a, > 6b`0 "`0 l@'pH@ ( @'p@4  > P  `  @T 8"T> ` `L ="`L¨ Kp @R (2'pl pl`"`p   l@'ppl 'lp @> ` `D "`D@!p؀`> `8 ɐ?3"`8p ( > -!`l@Up> # > Bِ!㿐  -&ڰ ( "'@w ?& '  > > "` H /f * ' >   H 0  6 H /f4 * '  7 H 0  $ & 6 && & & > &!  & $$ $  $ $ `  #@6 @ = `**` $& %?Ȑ*:`@4  @ 4  & "@ 4 4 p  =&& & `  `0    & `x`&`x4 @N4 `H &`H i$ r]%``@44` `0 ` >  %` ` `x  "`x> ` `< 7 "`<@Nt4 4  㿘 ?` c @ ` 2$    $ " :a H /f * ' >   H 0" 0H /f * ' > b`  2` H 0 $  0   :>    `       &  6     ?`& &  &   2&   @& &  & 3   2& 4 㿘  ,`쀤`'`  $?'> B `,  8 $.Ѐ  $'2u$@` 〢 ?& ,   㿐> ր  `  Ԣ ' * 2ΰ`> *` €`@Ē "  2   `> |*` €.`e.`l`` &`` ?&```` &`` ?&```` &`` ?&```@ܢ "ڢ  2բ  "``"``ɢ " ``Ţ  ?&`` ?ߐ &`` ? &`` "  2  8 ` " `H /` * ! ``"``"``"b``"H 0 `  H /` * ! ``"``"``"a``"H 0 > -`09)`04> -! 6/.` 씒 2) '.`! 6#.` 숒 2 .`> -! 6.` { 2 .`> -!Ā 6 .` n ".` `* @ *` € ks '` "$  $ ``0  kb ' `>$ >#*` €6`e4`l``1 ``2 ``2 *`@i k> ' $ ``  2   $ " `  "` `` D" k ' $ `$ >#ܓ*` €` 2 7` 2  7` 2  7` 7` 2 `Ā2V 2@  @ $   3n!V *㿘 `k`&`  `U kQ La`   F `&`  /Ē`@’ `$4`  "0`   `- )'``2$@` ?&` ,`/2 /`$@` ֐ ` ,& k9 x> #@'   X 5ޗ &@ ,$,4?`>!*` €"  2 > $ `  `H2`<`2`  T8@"װ 1$"Ұ  2ΰ  ,"ǰ  2ð  8 ,"  2 <8 @@ 2   /'ؔܐ *["؀ " 1 @>  `  `H 2`<`2` p T8@l @` @`@  ,` @2`@2`@ `f 0b ;p,` "@ Y 7 U4"R  2N <8 @@ "D   >  `  `H 2`<`2` "0 1 @ ,` @2` 2`@ ,` 1 ¢`@ ,` `$?@  ?4 -  #@@@#@C 5&@# > B "㿘 iC   &0  # -0+ ``"` @`>  `""` 2`<`""`H"" `` "` ` ``"` `*  -㿘     , @ Q  ,  5㿘沐 j  ` 4 `@Hד*`4 M 㿐  @ +   " ʠ * ` 7 `  <c7 `   0 , 2      k0 2@ Lp4@PD㿘> !& 㿘>  > -!Ȭ  b<!"`D `!2< m`"0 @240`"  @2, ` @2$沔 j)  Lb< ig 8ఀ  8Ȁ2`Lb< iI0 ఀ  0     ! > i1>   0 4" 4" 0㿈 'P'T'X 'H'L ` ` R`  ?`#@Q ``' 8# `  $"    ܐ"   "    & &  i3        & 2 E 7 .`6` m.`  6` 0.`&` 1&` ?#h/ ( @@  "`  `@ 2 <@6`h  > 6`> ` `\ "`\   @㿘`  C  ?h3쀢" 5k3d1 0' `" ` 8`  ` `  ?$ ` h\ gG ' "  `  "@  - g ~㿘``   ``2 `.`> ` € "`> Be" > - > -"LP~̐ x> aƐ q`n, m` "i 9} > BC" ِ_ > !``"U 1? 8O 1 "K$ 0(b "F 1C$ 0 = > !``2 6 1? (/ /}$ +~'`   8 2 9    -  > B"0g㿘> 5<> * "@*`"@ ܣ*`@ d"<"<$@4 4 $  t+!d` t@w!d```) 4+ <"4 p 4@g <4 p $ $ $  $ $ $ $ $$ ( $ ,$$ 0@K (4 p<hhh``h`&&'X'''&㿘 x` 8!>  q  > 5`g&"ܰ  +> 5 ``"     `" $)b  ` $@ `$!`@` #`` ; Bf;`0i"&`@&`b`#``Ȓ ; B;`f `"  "` "@Ò "$  ` " $$ 6 " "2 iX $ 6` $ $" & $ $" $$V d $N  "J     h ->  L `&   ` `  $`  "@ x`"  ``!"  `@  @   " fe }X``   ͔ |   㿘H /f  > 6@= 0>* ' > 6"t"t .`2   '<` @"  R`d 2 6@ "bt2<btbt<`@" R`d  2 5 b`|> 'L "`|'P'T'X''H   2`'''7''`'`     `'0 ``0`(( e `> `  iI   "+ j    " ' /@ސ5  2 ?߀ @ b!( `"  "!(@D]* `B5$& ba( B"a( "'@`*`*  `2  /` 2 ``?#@ 怦` 2 `` 2 `` ?#@ ؀` `  ` `  Ȁ @| ( b`  "`  2`-̀"b`  "`:' @ : h  b`  "` "      '` '$ 2 @B @2  2   ''''  > 6"t`#` > 6'"t'ŖФ2$<ba   "a > 6"t``  > 6"t   2<ba "a> -Vd  *d  ''L*''8  &  7 2!> 5 "p( < > 5b@"b@"" " """" " $"$ w`> 3#d` @t}` "   y 2 y Ѐ 'ה < 2 * * @$ ` '$ ` "` "$ ` "`Ā "`$ ` "`` a` !$` k,kd$d 46 `$$`$(` $,`$$0$0$x< 6d`P@Ő m H o *@ g  ( @'3  #\Ș @3Ȁ`" H 0PN A@2  2@6ɔ   $H 05` 2 !| ""`!|` "` 2 !x "$!x` "`Ā ! $!`  "``"`""@$H 0> 6 Vd &0>  > 62`@p)|:`r4 @ ["Vd  Ē #\@  &̒@& ` 2 Vdp@ &pba< "a 6&T&P̀"@ $P "@ 4P$@*PVj 2Pb!` "!> 6 Đ"@ @ S`4" 8" > 6 @ C"@ b" `` <`B ;`#`x` |``!" `@  @1 |{Ȑ"@ &&b @20਀ 2>  2`@Vh(:`ਐ y| @2nP 2jPLP"@XT" 4 4^P  b耢 " @ b  Ж & ;`B 8 x`" ``!" `@  @”  b< Ldߒ@LyRxːఀ  p > -"` G&pD> 6"`&p'|>pP@'L"XT"@@ 4 `& В"@@ & Vd 1&  ǀ À w 3 p@2   2 ``@̔   @[  # V   ` L 0< 8 E' Ѐ > `  7 J k ` @ڥ&` , ,`<$ ` $ `$ `$ 4 d* $ $'(','0'$ ( , 0  `$$`$(` $,`$$0@_' 0$$$($,a$0`! ` @[&` , ,  $  @R4 0 $0ׄ $0`ˀ`@ &t@ 7'  #\@  p"` &`&@&> -"`&&&& &&  > p  &pba0 "a0>  > -2`p@ؖbX :`&&p6d'&В4b` "` ba ""a"   "    "@   "@  > -"`p@>:@ =6 2 &&p &`&&&p"> - &> -"` Ѐ P  p  &pba0?? "a0 * " #b`u"p  ` `6dON.L.M  (4> 6 @̒"@ $l &$ 6d &̀@"@b b`̖ؒ < `ДB;`ؘ '#`и? ?&& " 2!P` <> 6`T" 4&P̚b :`` aB #a#`?;`" B  &`?6?ߠ?̀4pb 2`pb&p̸?`` < B #` ;``` < B ;`#`'@&̐"'"6?6 Vd  " @b`" ̒@ $ ?b ̐  ,# В : ؖ B ; Vd 2А"  }@@'̀  Ѐ@ pb &p`" ؒ < B; ؐb ̸?"' P@  X"  > 6`&T&P ( X@ހd?* : `>"<*` €> -"`p@ɀ = 6486db `" @ 6u p Y Vd b  > -`t^"p  ` `6dON.L.M  ϖ&> -"`* @( p@!bȀ@ b$ 8 l@v $2 p @ &p&$&&(baL "aLba4 "a4  @p*@&pba8 "a8" 4̀  26job  $ `j> -j T* :`@ V6j$  l2 @*Ȁ@ 6j( $ &(  &ؐp &p&4 `!P`B < `$!P@ƐVj$l(@&$&4p l&&$&p `!P`B < `$!P@Vj$wl(@$ &$&'$l@ @&$ր@ 6j > -Vj"T '@u  $'l &$Vj"T @ 2Vj(&$@[ ( :6j @T&$6jVjT@&6j " b` ="`b"   <`B`;  # > 6 Đ"@ @j`4" 8" > 6 @Z"@  @20, ' 2$>  2`@Vh#:`ߐ$(l #ޒ@NTVj  L?# * 8 &$"|x`" |``!" |`@  @# |@  |" &|v  v"& ਐ t!Ȑ"@ && ,&Vd "$    0E/ 5 0@ >   r>  > 62`@h#t:`jL )6d' 6d@;>  2 :*"@ LX*`rӐ  @;ô>  2 :*"@ LB*`a  3 @ @ , ̀ %  ̀ @2 &@ba "a&&D&&D ' ":"6Vd 42L> $a (6-?Ԕ@ " $&L"  ? $H @4q.H ?.H΀@!@Ԑ"@ 4&̀ 2Vd vVd rЀ@Z VSp  > -"`  &p> 6"`&p|̄bД & ;`  B 8 ` x`" ``!" `@  @  \g L_ Ls}rఀട ^p`&p  @| \>? "AVd <  rpА `&p&Vd "    ( > "6d6d 6d@>  2 :*"@ L*`q  2 :*"@ L*` "`  > 5*̓:`p R  > 5* ̓:`@ F `p > @> 뀏 W[ːp`@&py> > -"\> -> 5"hsb` D A  # <   ` 2 0< 8 +' Ѐ $    @ %  ̐ '̔   @  2> g1.> 뀦"x 8``  > 5* ̓:`p ˘ 0 > 5*̓:`@  [T > g>  > B"@㿐\V7`P>"\*` € 2I@ D`Ô @@ 2=@ 8  p @& p`@8/.!O 2-@ '` `  > 6 p!& p@&!T&!P 2@ 2@ " @ p"& p@@&$ @`` $  ` $  @`@)" X   #? ''`` А" 4""`""   "  & @ɐ  Ѐ   & &  6 Ж ""   n   ܀'$'  ` `" 4 耢" " "` $ < "`"`   `''?+ 耢   ''`"?"`"?  $& Ĕ  "" 耢 4  &  ?  + ??"" & & 㿐 2  "   &  l > B:"P  "  " `"@  ـ! " Ԁ `" > 6  & `$ $ $ $ & &   l@H"> -bT 8 $ $ " )> -'> 6  ,   $  l2" "   $&  S? @ $ $ @  $   $  $  l" @"T :$ 32 " - )  $`$@ $` $` @*$`  $   $  $  l@ː" "T :$ $   & "  @&> 6 f  $@$` l@٤"> -bT 8 $` $`@$`$` $  & &  㿘 (V d $ `&@   #> 6`"& `" 4 @`ܐ` ?& <& ` &@&` &  "    㿘` Ȁ@<  &!4` !$"@" l  l&!$ 㿘 > B 8  &> B "` < H `*H*I " ) ?& > 5 <* `(:` * 2< 2<(& >(8"@(  2> 2>((2<2>*8@"42f<*`R>(8882h2h  2h2J㿐> -"x x i`!``@ a` ( `T `4"V``8 `@+"> -!``@!"  \' `@"a@ @ `@ "   ""@?쀦"`!` 2a@`@" @ `@ "   ""@?bx * `45!.!. 8 @@* p !!5!,?2%!$ l 6 5 l@>!$ʒ%!$5 l 㿘 x lv 8 ~V!< 2>dl ":dP @a @;* 2``6!@ ` 6!@=`$@,6!<p "*`z@`H6!>2 :  : 6!>!* :  : !@ 6 h6 h 6 hd ":?`@ِe> $a 8 n|` "P?@ŐQ> $a 8 n L``"hP@h ,` * &!(㿘``Ȁ@  ``ba$$a4`$````l" @ @S$a$`& `$a$$`` ``l"@ a$"@ " $a$` ` > -T  &    < `  2   `  ``  ` " ``<" P > !    x`?''8   '> 6 !0V h"@@ *  l&!$   ! @<    !$ "@ > -hV d ! @`2N n> -"TV j@ &N n "N n   "  l "@   Ȁ !$" &!$N n  |*   6 f  |@  " 6 l`    6 f 0 & @ l2`  |   PL "@XT" 4   q  p :i!`N n 2e!`!D2` `2^!` ! @ X 2W!`?!M#* 4!( А" " 6F!`*  6B!` p2>!`2;!`  " 45!`"0!` ",!`! "    0 >   2`@V h֓:`̐  "   2  0 2 @6 f !`       ( . < . (> 뀌7 p `2&   //ɐG 7Ȣ  ؐ 2  p @A p"@A $`  p   @"  p!N@#@%@` p ` 2 2  a" @B` "> 6 !P` ""  ?#> V d <`( p ""7`( 耢`2 $Ȑ"2    ` 6* ''Ā`"  #Ę #  `@&*@Aa  `((!,> B B"x"  > a( > B 2"" pN n  2  > 5`l "`l ! @ > 5`X`P = B ;`X #`P`H`D = B ;`H#`DH /f * ' ` H 0`" 4`H /f * ' > b`  2` H 0 `$ $`4`$@$`$`$` `> H /f * ' > ! $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `Tc `> a`("@"@ $`$` U  $@S 7e'VC` $` | "$` > 5"`h "`h> 5`x "`x  " > 5"`p "`p> 5`t "`tH /f * ' `L H 0`" 4`H /f * ' > b`  2` H 0 `$ $`4`$@$`$`$` `-H /f * ' > ! $`$H 0`$ (` $`4`$`0$`($`,$`<$`8` `S `>  7'`$`  $`$` t`2` > B"&"`> Bߐ"0` t `@   p   ! @ & 2  2  0 "!   $`2  $ &  Ѐ`$Ȓ `2`<**` $ > -b )@ p@> 5"aD@ "aD p   ` `"@ 2 , *> 5& paH "aH, P2 ? l& ?!M#* @4! В"@@ & 2 >@ 4  "@` @ 8 4 ,  & !` "`   "N nN n`  $` *`2`?# 8" 4?ؖ $` @iÔ (4N n  0 2k  & "    p `& & p   "!  2 ! @"@ & !4  &! > 6 > 5"&!4&!8 "    2: ! @>   2`@V h:` 0 " ِ 6 f  2   @>   2`@V h:` 0 " ￐ 6 f! @"@ 4&!   V d` ɚ> -b $` p @ "!` ! @,!`N n  " !`> 5a@  "a@!` "`  Q  M ``2 x `l* x `e* *> -! x``@ `݉ /'` ?ؑ* `2 2 , , ,  x@ka ,   *  * *`@   2 2 2 , ,, ,  x @  @J ' '> 5`7 x@ D ( x@ߒ < A 22  pV d 06!J p > 6"`Ԑ |("@ "@ p``  " $  p !@"@ 4&! p В &!X& p & p |`' >  > B"㿘!* :   `:> BƐ"!@&V f> -"*   x 4 x>    2`@ :`vV f  f`6 f㿐> 6> B#\!xc!d   > 6> B  c #\  > -"> 6"t> ℑ2 > 6;"` <"> a < (>> Br#(@qg"@㿘t Px P  2` "   >  !> !  (& > ! `( `-& H /f * ' > !1 & $H 0 $ (  & 6 & 0& (& ,& <& 8  2`Pf `  "' N6  @Ȑ  4 , 0?$ * 2   2` 2* 2 + $ 2` 3  # *4`<$$ ( $ , $ 0$  $ $ $  $ $d*  3 3 3 ,, , , , , @i, ,   (4`6` 4@* <*@4 $` 4`4`$`$`,` 4`㿀> #'   x`8 T P L X" " 4 !`  `@@<    2 Ot  > !   &2 Δ <ɔ (. P- &&2"  <& ``'` '`$'`'&`` &``&``&` &`$&` &`&` `( (& `` &` &`` 44 2 &  <`( 4`  (`& && * <*@ $ $ $  , !M=?#44 :4 T ` ,@,`,`,`,`   x@i$ ؓ*`2`2`,`,`,`4  ` `*@  @f (4  ` `*` * 2 2 ,`,` x    @ @ȡ 4` 4 @.{4 > -4` !> -,` `  $ x   > B#8㿘> 6!x P @q!d&> -"z>6 l |b,6!,t> B#  ,`k`` > -" > - "`?&  > -"| *`: *`& p6!>& x6!<6!@6 h6 h 6 h&!(&!$`!  &!``!> 3 #C,k> - !,l$<㿘 xV d  `86 dd> 5b`  "` > 5b` "``<V!J 2@4 8㿘 x !`8 @ " ` 2 ` 2 ` 2 ` "    "   @  * ! @@ ` ^\ P @ V!<*"@ *`" *  l `* @ 2 $ l$ l P  V!>*"@ *`" *  p `* @ 2 $ p$ p P 2  d!(" d h 2 l d2  l* 2 2 @( !`  `<`( h  2 $ h$ h@,@_ p  ?& p뻐 | `"  t#> 6`_` 2` t "> 6N> 6R!xc$</> 5b` "` 㿘@  %> `"  "` "@N: 1@  ?  *!N !N *!N* * !N㿘 `k"@ g e ?>" >ܦ#  > 3 # `N>  !  6 `@ <@ƻ O  > 6`%> 6t   tż   @t0#`"t@Lj#\0 > 6#`"t#\ @L_ 㿈`>`P"耦 M> -!.   >/"? >(#  > -!`> 6 `*`  "t t  >h> #x  >  0 > 6 `*`'  "t#\0"t  <l $h%> '@  > cx   //'#`> 6> '''"t#\  @Kޚ  > B\#p㿘 <ː `" `4 2 `Tż  `T ? #$ 㿘 <ũ    4 ڒ?> 6     `(((2 *`0㿘> 6 ~F > 6  > `  ?`  @ > 6> 6" 3 2 㿘> 6 a/  > > 6`  *``6 2 {> 6`? * .  㿘> 6bp 2> 6 @"bp> 6bd 2> 6 "bd> 6bl !> 6 @"bl"` > `@ $"`㿘H /` * !  p`& pH 0H(> 6d> 6`> 6(""h"`H 㿘  `? 㿘 " & #> 6 ` & 㿀> c'H /` * !  f`*`:  6 f > 56 fb`$ "`$V!J  < 0> 5 b`( "`(!* : !@ : * V f> -"* ֐ !@* :`@ 6 h6 h`$>  6 h>   2`@V h:`跐> -!`"=V f x"9V fV d 5V f 3 8 |`"-V fd " !` 4 "!` P 2 V f!`` @{  // N' " V f P  $ Pz BV f $  dP x!<!>* : @6!>6!< d&!4?*  2 ! &  & > -"` p 2  & p !$ 8  l2 @Œ ( M&!$ p! @ &!(& & p"6 jT`p"TH 0c > By#㿘H /` * ! > 5b`, $`,!* : !@ ;  * V f > 6> 6 !0l" > -"  `0`$`0’ <0S . n&. nH 0㿘H /` * ! > 5b`4 #`4V dC  x 8`+*> > 6"h  > 6> 6p!0 "@ @.`8`#`8 t   ? / 4>  > 62`@d:`碐0 >  > 62`@p:`疐 4H 00<`"<U 6"h> 6 !0"@ @ >  > 62`@dc:`Y L0CH 0ltollmLooopp@p`qptpqqqovvvvvvzz\ztzzzzz{z,zD{,{D{\㿘@㿐 `    @@P ǔ  I  0H /`4* !  ` H 0` ` IȐ   "l € a 8@+ ]  " T 2 x4O < `!@EGC 6   `!@EҒ   2  /4 d ` C ` ` 2  2  "  "  2 6 2 6?#@2 6 `< @8 `'   6  @E  @F*) `< 8 ' 2ְ `' ΰ  6  ; ŀ R   $ tƐ 7 P4֐^E>  > 5> - "Ⱅ2`"X@  4 d :` 4`$ $ $ $! $ %$  -@ `!|0~  _'@ |0  v r |_ i 5d&@H 0m H 2 @"R !2N  !H  H  D #&  !I>*@ !H :,!H|"@" 4 |H* 7_|  , n $ , n `!@H> ͒  `!@HN ђ > B#     ൚ H 0㿘 H /`4`* !`  H 0 6 G֞P <`  @` ` / @ DH 00vPl@ *'< *"9  (5 ` p -$ p ?*$ p"(  (# `$  l@4 4 l"  8T d  4   p$" `"$ $ #Gg 0 F ' " " p *"   * "@ l"@ "@H 0㿘` > -`P  > 6> -> -"^1 !> 6bt+ ` 2 2`d` ? B4`` 7 4` `!  "a` 㿘 xV d` 8O   T  #  \`O L@  㿘V d`>"*` €'6 d  6 d V d  x\`8V d  >  > 62`@h:` % L`> #' 02 2 @"   $" 2逢  2} ؒ @`J Ȓ @`A  j e H /`4* !逢    > 6"t> 6'`"t'`  > 5ba  "a  > 6"tؖ  > 6`"t`    8  ?' 8`'?''H 0"&@"c > BŐ#㿘`h ?` b>"̓*` €> -S"> -M"> -G"x> -A"X> 6;"p> 65"d 3>  բ @*> -"> -"̐ > - "\> -"> -"ԍ *DT<T㿘> -"> 6V"㿘@@!> 6> c 'L'P'T'X'"'H   2  '   0  /   /Ѹ  `@ M1   @:> Bِ#   2` "`  ` "` "∀ $H   ?#"@4 " ` "`  ' ' ' ' '+ 2  2 ?#@s      ?#@e @\* `86` X"`/` , 2" ?! ``("`(E"`Lc@  7 @#* `6`D"9c& `( "`(`  "` р0/@  //7  @'//7 'А@Ւ  //7 @^ @Ȑ//7 @^{   <  8  > 6 А '  ʀ> 6""@  ``!2`6``!2``6@2`"`0`$ `$`(  `$`, `$`0 `$@l  ` @2f`"` ` ``  `` `` `@M  ` ` @2G``4@2B``8沔 D  0 '``@@}NFْ`L[Ŕ D' D!`   "` Z`  '`8` " ``"@j`` 2"` '``@@} F`L[ Z`   !> 6"  ' "'–`A`$  "`$" "    ) "  c` "  @c c' '  '  '  ' v6c M H o *@ g  ( @  є#\| @J|`" `H 00R`8 `M @@0 ` 2`ѐ@\   $`H 00q`` 2 `!| "`"`!|` "`` 2 `!x "`$`!x` "``Ā ! $`!`  "````"`"``"@$`H 0 '``@@|  `` 7   @2 'E`8 LZ| `8Yw L`8 c  c`  "` B͐ cBc > B #㿘 A    H `& $ $$  㿘 82 8 8Y< L 8    8Y1 |0> #>"' `Ԩ ` 2@ 2耦 ɐ? >ܮ#    > 3# `耦 @` '`'`  '` '` '`''@[ 耥 "`  @A   // ''' ' @R'  `@'`'`'` '`'` ''@[ `耤`Q@ X@   D@   //``'` '`'`'@R' @[T 3耦 #> 6b(   b   @hђ#\#`b@@> 6> #\#`"ᨚ @@  > B#㿈>"`2 ` .@ * (> -!. ?򀢠 ># `0 > 6 `*` ' "#\0" F x ` 'X'T'H'L'P  > C ? #@  (    0 8H /` * !  " H 00 2  9``' 8# `  $"    ܐ"   "    & &  A\  S 7     & J 7  @  .` 6`  0> -&`  &` 66` 4 6`6` /  & ` 3 *``2`  2* 22  + 2`3 ?# 8#6`6`6` l> 6.` e.`,`", 8 @  0 *#\m$ 0$ `H 0@@㿘@㿘 `   `! @F 3S- ``2 `.`># €  H /` * ! > 6bH 0` > -> -"W    `!> 3 #C. k> - !. lH /`4 `* ! `! @ !!` $ $`$ 0`$ ($ ,$ 0H 0  ?>6 U;  `!@E;4U@2$  `!@?M ܒ  `!@?]    - -> C ?\?W㿘H o*@ a# H 0㿘`!  >    *0  *0> - "Ԙ!8Σ @ > -"> -"ͬ㾈> #'@ "   A  2&  7&  L  $ L `/ @N$ ` 0 * @@ ``@2 @2`@2` ! * @݀@ "> "h > g  >@2c > ,!4` >   'h@ > M"h n > #> W *` ے    '>  @>6 AB ,   ''7' ,ْH /f * '  @`>{&0 &  2" && &H 0 c > C 0㿐> ,!0'L'P'T'X`'H>R0 : / ԣ /㾀> ,!8> c 'H'L'P'T'X'X@ 7 S A% #& L  &L `@&``  ``*`*`@ * ` 222.` .` .`.` @ *  @ @ "u# ``*`*`@ * ` 22`2.`.`.`.`.` `*  "@=ސV#. ** @ *`@ "* " e@ "& `"@6` "& @6` `@*`6` ,> `   ''7', 'H /f * ' `` @``=&`0 & ` 2" &@`&` &`H 0# > C @> , > ,, ( `!l 2!h  !  8 ! 㿘`    *0 > ,!0> ,!4㿘`    *> ,ǘ!8㿘 l@ ` lw  l @ `;#@ i  (! l?#8@8N dL l=@"&@ (BH /` * ! @;H 0 2)@o$ j! f!$ $,! $ $@i,!> -!h`>  $` ;`  $ $< ɐ (  '@ 㿘> -#`y > -#` )> -+> -k $## #k %##@  @,  ?$ 2 @# @  @&@#~ @ c c8  @ 【@.c  8  @  @  @ 】,`@  2@!@' 2!2㿘\`` d "9 @  "4  ,@ ޒ "* ` "@ Ԓ "   `@ ʒ "   h@ 0   l 0@p    㿀> -#``d > -#`` )> -1> -k $## #k  %##ڐ @   @,  ?$ 2 @#Ő @  @& @# @ #6 #8  @ c@f#  8  @  @  @ c,`@ '!2   $ 2  @!@[ 2 !|!!!!t#d#l#\#`#h#p-   2!㿀> -#\`` > -#`` )> -1> -jx $## #jo %##@ @   @,  ?$ 2 @#+ @  @& @# @ # #8  @ #@̔#  8  @  @  @ #,`@ '!2   $ 2  @!$@ 2 !|!!!#d#l#\#`#h#p    2!X!> -# > C 06@ @> -# @#,`   `` 2`*` ` @ " > C b )> C'> C%> C   Ѐ`S`` 㿘> -#` * > -# $ c,`@ ``#@@       ##@c㿘 $  @4 @Ő㿘 $$   ̀@@$ @㿘 $  @ $ & $㿘 $$   ̀@@  $ ;& $㿐!> -# K* '$# * # K  * #   K * #`*`@#`@ޓ*`#`@ٓ*` a> -#*@o'1> -/> -> -#`  i> - "c#  h &#> -# Ő@ @  @-   ?$ 2 @# @  @& @# @ " ㌐8  @ ,`@Rc  8  @  @  @ ,` $& > -> -co> -1> -/> -> -#`  h> - "c#  h &#> -# S @  @-   ?$ 2 @#? @  @& @#0 @  ㌐8  @ ,`@c  8  @  @  @ ,` $& > -> -co1> -/> -> -#$`  h> - "c#  h &#> -#  @  @-   ?$ 2 @#͐ @  @& @# @ > ㌐8  @ ,`@nc  8  @  @  @ ,`@ $&@ > -􀢀 > -> -cQ K> -c> -"cK K> -c> -"cE K> -"#㿐H /`4'* !'> -#1> -`(;> -# K  j* #&〒`*` Kc #'c`*` \ K> -#"`@2*`#`c@-*`#> -`@'*`> -#a`a` +> -9> qa$gZ %c  gQ %c"@    ,  ?$ 2 c  @  & c @ #~ #8  @ @#  8  @  @  @ 】+ @ p k" #* * ` d ` af %c  f %c@    ,  ?$ 2 c @  & c @ #  #8  @ @;#  8  @  @  @ 〓+   &@" 㐀 af %c  fz %cK    ,  ?$ 2 c6 @  & c' @ # #8  @ c@ה#  8  @  @  @ c,`  &`" 㐀 af  %c  f %c  ,  ?$ 2 cӐ @  &cĐ @ #D #8  @ > -@t#  8  @  @  @ > -#,`@ &`#@ > > -" ; '" :H 0 㿐> -#`> -# `!! X p +> -3> -!$ ( @''e %c  e %c^@    ,  ?$ 2 cI @  & c: @ c c8  @ @c  8  @  @  @ H4〄(〕*   ` @2@"@ ! &e %c  e %c    ,  ?$ 2 c̐ @  & c @ c= c8  @ > -@mc  8  @  @  @ > -#,`@ 2  "@ ` `2` "` !d %c  d %cp  ,  ?$ 2 c[ @  &cL @ c̐ c8  @ > -@c  8  @  @  @ > -#,`@ 2  "@ `"  `2` "`  &  @ & `"`&!"@"!2 "`"`&""@""2"  Ā`"`&" "@":"2 $ {] & $! "!@&!! "!|@&!!| "!@&!|! "!t@ &!!t "!x@&!t!x " @&!t `" ` ""`  ``""`X K> qb ?"b H 0㿘  K"@d"&""&"&!!&!&""&" > `> -`";`?> >*bh&!l (Z>*b @U>*bܐ XP>*c  pK㿘> -> -#|c @ .`2 @|` `@*@  > Ca\ H '''' '''@@$(','0'4'8'<''@/> `#d` : `> C#\#`@Ӑ A`@@D&'H'L'P'T'X''@> C@@> C&ڐ@ጀ`: ᐀ 2tᔀ (t@@ :b > C&꺐@t  > C@&@ꭐ@x  > C@&`ꠐ@rᄀ  @> C&ꓐ@eሀ  @> C&ꆐ@X@$> C&|@N$xQ@> C&p@B/> C';> C  /> C;> C+> C $@@ &@@bY@+ `2?@> C&H@@&>@` `@> C&1@  > C @&$@  > C @& @  > C @&@ @ܐ@' &''''' @ ' a> CX@ @' &''''' @'  a> CȐ@@਒&ଔc龐@䀒@"@@ ; b  > C&騐@z쀒@"> D@@ ; b  > D&钐@d> D@ @&鉐@[$`ఠ@ @ ; `> D&Pr@D$  ภ@ @ ; `> D&xZ@,$  > D@&L@$! > D@ऒ&>@$  > D@&1@$" > D@&$@$ "$̀@@ @ ; `> D&@> Dܒ&h@Ԑ$$"!$̀@@ @ ; `> D&> DԒ&@$'2 > C@> D&Ӑ@> C@"&ʐ@㿘`Y!> m!@!Ѐ &@> -> - > -c > DbC> - > -<  cH p@0c +   > -H /` * ! *@` "al 2"al@`2alH 0c     @?    > -  > -  > -@   `  -`` "!`` "`"``"` "`  `` ""`` "`"``"` "㿈#> -c' `  `" `*` !> q!Б* $c> D #\8  `c*` . 㿐 ``  1> D '@@ "H " "  `?2  2   2      㿘 `4  > DV "h v ? & _ 㿘H o *@ a       $ # $> :; H 0㿘H o *@ a       $*@# $> :; H 0㿘@@2  V ` @!   xxxpx> -"> \ '  &  ?&@ 4@ x@   ,` 0`, `< /&   4`,`  1ޖ   1ٖ   1Ԗ  //y//x`'|` ' `  24` @ j 1  1 0ED4`'\  W 4`,`  1   1   1 , ///y`'` '`'`'`'`'` '`$' `(  24`* @ ' 1y . 1t 004`,20#\&#`<   A`"8`  8 ?"8 A+  `?"8 2  A`>4"*` € A }  "   a ?0 >   a >  "  a @   2 a  a  " h  d 2  l 2   p 2  t "   $   Ā` "`"   "@$ `" ?2 2&@̒ | 2 &'> - C  2-  (( @2# Ā  | @ 2   0#\#` !#d#h !#l#pt|  y < Ā`"  "` "b   "$   <  4  -  >   :`<  |  0#d#\#`    $ $ "  $ " " "b &#\#` "    &  |  `@@  ?͒ |˒"M  ̀  |a$@a$ 2@ a@2;  "  a`"3  ".  "  a|`"&  ! " $  Ā` "`"   "@$ $ b  $ b "@'b &#\#`"> - @2  Đ$  |@ $ "@  Ā`"  "` "b   "  < $ > -" @ )"   "  >   :`<  |  0#`#\   [  $ $ "  $ " " "b "$   . ;&  5& 0?ꀥ  |  `@z "&?ꀢ 2  |  `@f #\#`&@ &  > D̮"㿘  ? & S  2     0   "  Ā` "`"   "@@  ̀`"  "`> -"#  "@ "  " y " s "> 7m> 7  > -b?"b㿐> -c  !> 7 "c> DbА #\ ؔ     % @Ӓ      2& . . . &  & > -b b&  "`А "`"& А@㿘 0 (@(`(`0(`1(`}(`a% 0f 0`0`2 0? ` < `  6 0` 4 0` 8  `<(`0`B(`@(`4(`|(` `80`D(`` 0 `d E `0`0`2 $1>  ` (! `  ,< ` 0  `  `  `  `  `$ 60`* 40`, 8 ! (`( (` `8 `< `@ `D `H `L `P `T0`\(`X(`4(`|0`Z(`` $ `h ( `l , `p 0 `t  `  `  ` `㿘ɂ  `"  "`> -"#  "@  > 6 ` "`"  "@> 6#㿘 " @@  2@ p  w  > -p c  #> 6 "c> Dbc#\    c Y @֒ i  >8bٔ 0 , , !, P, Q   "]4 "c4 "4 R , $ 4, T 8 "   | ' ' ' ' ' '' " ?$ ($ ( 8$ X < "   | ' ' ' ' ' '' "  ?$ ,$ , <$ \ , 0 @, `  ">  4 2 B4 b 4 4 D4 d4 R , $ 4, T 8 2  < 2   @ 2  D "&  2 | 2  |  2 |  " | ' ' ' ' ' '' " > $ ( $ ,$ 0 $ 4$ X$ \$ `$ d$ ( $ , $ 0 $ 4 8$ X <$ \ @$ ` D$ d H 2  L 2   P 2  T "&  2 |  2  | 2 | $ " | ' ' ' ' ' '*' " > $ 8$ < $ @$ $ D$ h$ l$ p$ t$ 8 $ < $ @ $$ D H$ h L$ l P$ p T$ t (, H X, x X ">  *4 J Z4 z ,4 L \4 |ٝ" >  > -ǫ$ > -c` $ `""`$   $  "& $  @㾠\> `  '`I `?E  ?& `? 8` `? 8 ` `? .` 2 `a  $` 7` /`2`? `a ࢀ@?a$|@&a$ ?`aaȔ0#d#l#p#\#`#ha  a| ߐ?`f `$> -`a ࢀ@> -a$|@a$ > -`aaȔ0#d#l#p#\#`#ha  a| Ȁ> -`" "@8`2>  > :; `  0#\#`   | ?` | `ʖ?& `  c਀ q` #> -" @ 1">   +:; ` `0#d#\#`|ۖ H#d#`#\ 2   U N਀`"Kc`@F &Cc `  8 %?`  j  $` 7` | `N &?& ?  $3  2ਐ u& $  , ( !ǐ!3 c > DȀ"> -"  22 㿘> -#`` , 2 > 7a` ! "` (0!@@! 㿐> -#'H'L'P'T`'X  ,  H> 7 `(" 0H@ 㾈> 7> #`"'   *Ė2   !C(  ( + F2    > D0  / *`*  2 /ݐ#+=   !`("*c  *2   !(   (`(u"(c  +g !` "`2    > D0C  @+$ 2? 0  *`*  2 / @+ 2 (Dc * *`@ *  * 22 2 ` ,,,** , *`@  * 222,,,,^#  "> - 8 23 > -#`-> !``"* ` ""`  ` 2 ` @"  ` 2  `@  "y!  䀤``2`  !" :` B3  ;` > D0 >   > M"  #, >  @  ', ''7'H /f * ' `` @``'$`!`  "` H 00c& ` 2" $@`> h  ,@ $`$`"hW > #> W*` 좒 0 !$`'n"$ cs H 0c > Dƽ#(㿈  )Ta 2 `/`"a0ia%  > 7a( a 2  > 7,`'7",& ``' 8# `  $"    ܐ"   "    & &  'V  <     & < * @ *@@ $ > -4  4 , a($ a 1$ 4 `` (۔  ,  (Ֆ   4   (ʖ )2 /, 4  /@)o,  2a%a 2 a%a 2a%a > 7a% > 7a, 2 a0 2 a4 2 a8 2  > 7,`&",& 7??  ? ? 2* * ? ? ? ? 2 ** ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  (&        (& 2  > 7a` 7 "`& `,, , ,  > -* 2 2 , ,  , a$ a$ a$ a$ $a,$ a0$ a4$ a8$ ` ` ) (  , % ( ( )2 /,  @(/ *  *`@*  *  2 2 2 , ,,  , %> 7&a`( / 3"`(> 7!``#`&a  `` `?쒂B>` `?쒂B;`a 2 `` `?ؒB>` ! ?ؒB;   "   㿘> D܉#8 %㿘`    *> -#(> 7!Ƞ> -#>   'L`'P'T'X'# 'H  , 2   `%a#  !Ȑ`%V$!  'O `  !Ȑ ` 2 "  `%="耢 (0 В!` "`Ф@* @&   2``` 0$    ///'/  '    ///'/  &$!Ȑ $!' !  @ :C  8 &  ? @6   > *#H@˔   !"6 't > E# -7> 2 Ēa`!#ad #`8 A  @ #Ēd@  #Đ 0`##ٲa#􀦀 !`$"H.*  > 2ij* @,  . ''7','# @ # & `h "`hH /f * ' *  #đ* WH 0 !`$L" > Då#`㿐a%   > 7a   > 7a% `@ > 7`` (  `$"ð   CH /f * ' >  G H 0`" 4`H /f * ' > b` 2`H 0 `$ $`4`$@$`$`$` `2  > 7`"#Ұ 70x#V @4` ,$` $` 0$` `$$`  &  ?6 `> 7@$`$`$@$` a`#```(# ; B;`(a    A/`<* @ *@@ $`> -4  ! a, , , 4 4 4 a($ a #$ ` a `*@*`*`*`*``> -* 2 2 *`*` *`a"`a"`a"` a"`$a,"`a0"` a4"`a8"` /4/ %& 㿘`    *> -ܘ#`> #' 2 3> 7a`, "`,> 7> 7bP`( "`(b` "`  2@ 3> 7a "a> 7bP "bP 3> -#` 3 l> -#` l2 > -#`2 # 2 3> 7a> 7> 7bP`L "`Lb`< "`< -"  2" 2Ā 3> 7b "b 3 l` $֖  А` $͖'ĐТ@ǒ /р  0 /А  $0/А  $0" 2 3> 7a2> 7> 7bPb` "` .H /` * ! Ē 2$H 0" 2 3> 7a2> 7> 7bPb` "`  "!H 0"h 2 3> 7a`4 "`4> 7> 7bP`0 "`0b`$ "`$e  2 H 0"F 2 3> 7a2> 7> 7bPb` "`I  2Ȁ l> #\& ̀@2/H > ; >ȑH 0 'ܐ '$` "tȒ@̐ '$d"tȒp`H p@ > DG#p8> #> ' :a >`a`2`3> 7a2> 7> 7bPb`  "`   $ 2 `2`3> 7a  "a> 7> 7bP "bPb "b 7    `*`4 @|4 4 `9' " !`2`3> 7a "a> 7> 7bP "bPb "b #yaA  aD` aA   !f`2`3> 7a )I " '!U`2`3> 7a "a> 7> 7bP "bPb }"b (#>aA aH aL  aP aT ВaH@  aA   !`2`3> 7a  '$ ( 2 `2`3> 7a "a> 7> 7bP "bPb "b ؓ*` 2`2`** " ; ) "  ߐ`2`3> 7a "a> 7> 7bP  "bPb "b "ȖaA  aD` aA    `2O`3> 7Pa )W  " ' `2`3> 7a "a> 7> 7bP "bPb "b ("aA aH aL  aP aT ВaH@j  aA    k`2`3> 7a> 7> 7bP`L "`Lb`< "`< 0 a l+  $*   a H`2`3> 7a  "a> 7> 7bP "bPb "b  Ȕ a *` `$ *`2  7 `2`l` "` $6 ` " `$ (   6 `$@  6 > # `''  @'''Ԑ 7'9Ȁ`302`3`l`20) 0&@&@u"@4`l`20 0@@% @ݔ . > D#㿘`    *> -/#㿘`    *> -#㿘`    *> - #㿐'L'P'T'X'H  # 3㿘>  H /f * '  @> 7P `""H 0B' 7&  2" "> "h` ""h Ob > #> W *` R 0+ H 0 㿘 `  @  @ 3㿐'L'P'T'X'H   2㿘>  H /f * '  @> 7 `""H 0ؐ' 7&  2" "> "h` ""h N > #> W *`  0 H 0 㿐'L'P'T'X'H  ` l㿘>  H /f * '  @> 7 `""H 0' 7&  2" "> "h` ""h N > #> W *` ㏒ 0h H 0 x> #' c耦`> -!`[<  2V2a'P <@8   //'Ŕ H /* ! v  $ " 7> H 0&5> - $ @?2 $@H 0$!  DG# 㿘 `  @   2㿐@`'0 `('  (%> D  3 *  *  4@@ & > 7bP! "bP $@\ !㿐'D 'H2 > J"8> J> 3a8 > 3#X D 4%> JH 6 ``B >` "D!@`0B:`0* @*`@*` DH> 3  8`B :DV 㿐@`'0 `('  (%> D B 3 *  *  4@x@ & > 7a! "a( $@ݖ !㿘~㿐@`'0 `('  (%> E  3 *  *  4@:@ & > 7b! "b $@ !㿘@㿈a2 > -#`3l> -#` l2`> -#`` 2`$0 A a  ``̀@/H > ; >`ȑH 0 `'``$ '`@o7```$ '`po*2`a " " ( d " 7 ` * a 2  0`$@+``% a ``@2`a a  aa aa "p`a@%  "j`   " 7  @  `4`*`@4` 4`  '  ( " 7 ?ؐ#@( z ?ؑ*  2 2 ,,  쀢` "   쀢 `\'a 쀢 '쀥 "`$  ϒ  2 I 7 ` 4``$@ &`$``@:6`@1-a  "  ( a  @ , a l2`   "@@  > 7D`"D@ @ 㿘>   a :` >` " 0  2``'?ؐ#@  ?ؑ*  2 2 *`*`c> `$ @   $%  aS.   a *` `$ %``a i a              @e  a23?0.``$a  `2 ` `$   ?D  a " (0 㿘H /` * !  $ )> '> -$!ᨔ      c耢'8"!> . > . > .> . > . > . ! !"P!""0` *| ` 8x & ` $ @6!*`2 6! `"`>J *` €> ."> . "> . "> .#> .# > .#< @"& K   & &!d`&!h L6 * ^2 &!` @3 $  '''* ''   L 6 * >2 &!\ݭ @ $ @ * ''''   @B # > EZ 0㿘!\ " !`@ !\͒ L&!\!` @ !`Ò L&!`@B   > 㿐`$` `a a    "@` `"a`?@" a> 7`"(  4`$@21   aadah@    " 00 > 7a`  "` > 7a`(  "`( ##`# ; B>` > 7""" : ! 8@ B ; 8`$"`$``@8`$``@ @U Qİ `$!``@ ``@ @=`$ ~&`$   #9  `(a@``@` a@  2 `2 @E ` 0 0 L*   @Dǐ`P 7 o"`P@ 0$ ,$" `"@" """a\"`4*  " "@ܖ 0 $ >L!0 $$($$` <$ $ ($ $`a$a [, `,$ " $a% $`$ @ aa '  8* a` '  $ @$a`$`* $`@ @C<p> `  `c耤'`(`$`, L[@D@> 7a`P  <"`PH /` * ! @`۹ ` 2 `= L> 7a`  "`   #  @@= H 0@B  L> 7a` "``  " * @`0   L> 7a`$  "`$   L ! * $@&Ԑ Ԓ !!d!h@   > 7  a0  > 7 a`  "`a`(  "`(@C $@!  FР  > 7!`"!H 00j2  l  25"0$@ *! ( ["@  " "@$$ M"   2$ " "@$ $"  , "$ "@$ "@ > 7! `" H 00 $@2؀> 7! `" H 0`( ِ` ڐ lH 0H 0:@B > E @x> #``'@# a `''$'耦('> # ''7 'T`$@a " @<`@9$   > 7a 0 $ 0a  @?@#@ ڐ H ( J$ HӐa` . B"` a`# ; B>` `@# ; B;`@`$ !``@8`$``@ @ ; `$! ``@8  ``@ @`$ ~&`$   " 8 @ !  " 8" 沔 ,   `a`f%aٰ 7"$@_ޖ  2 `Ua 7 %a` `$@ ad'ܒ`&ad` ֒`@k 2`$ 7@   ,@  &GĐ*  2/ې Gۀ 2 @A Ca4`$'  " ' ' a%' `$ @ 4apa#a قa 6   @ 8* a &   ' ' a`' `* ' `$ 0 L    0ǐ@Aa`P 7 4"`P@`aa$,  L  >O!P $`$`$`($` $``<@$ "@$ "$$a\$`* $`$ @@@@@ c > E P㿘   L[@A@> 7a`P  f"`PH /` * ! @`ع ` 2  = L> 7a`  <"`  #  @< H 0@?4 L> 7a` "`  L@@ $ @! " (!pH 0H 0@@֐` #dd#``2+   "@ : ( # " @ > 7  0 2> 7 ( # (  (#㿘`a``   "  *  R K  2   !    *C H /f * ' >  ܒ H 0 2H /f * ' > b` 2`H 0 """22&m 0  &  & ` $`  h>   c耢'"$> ."> .> .L > .H > .> .> "" " # # > .#<> .#X#t  ` $  &!d& & &!h  L6 * 82 &!\ קȐ@  $   *'''@<~ c > EX `㿘!\ @ !\˒ L&!\@<   > h> #`'`q <#͒ &> 7bP 7 /"bP ,,4  44 @  @``> 7 ` 6!@ "9` @*  @$ @@`4 `&  @  ٲ@@@ `Ҡ  ?  > 6 "@@> 7& @ΰ Ȑ c (̀  > 7P`Y"P ('/ϐ А ``/ѐ " 7Ҁ` ѐ  `7``  `   7 ^ ((  ؐ LC   > 7P`"Pz 7 ( آ (  ΀_`+K@`<`0JI@  * 6;!> 7 @2*  *  "P`$"P6 L?   `> 6"i "P`$"P L(  * & @ *  L> 7P`"P    (Ԗ~ L # > E h㿐`$!`'D   a "3 `$2/ Dx  aadahg  > 7  " P> 7 DP 7D`\"0Y 70P  7D`Q" 0*`? > 7P$ D`B"$0D> 7` `""B>``"P 8""@ B ; 8`$ !``@8`$``@ @ ۮD 0`$!``@ ``@ @`$ ~&`$@=  D 7@bP`$#@ #`#` #`a\ #``*#`   (a@D `@D a@Ŕ  D 2 0  0  L   D 7@=bP`P E"`P@ 0 D  0D  D> 6 ٖDa   'z L@=_$D `>S$`$`D!$`$`(`a<@$` $ ($ $` $a , $ , @ @<#@> #'  (` $ , LB@='> 7bP`P  "`PH /` * !  Ԡ 2  $ L> 7bP`  "`  #@ 7bP` "` @<$@    @ 0 @   L> 7bP`  "`. %   Ē L  +$@(`ؔ  dhǚ   > 7   bP > 7u 7bP` 7 o"`bP`  7 i"`   > 7"P`""PH 0d  2   B   ;4   *# (1"    `" "@$`& !"   2& `" "@$`&" @ @   "@&  `"@$`wH 0#H 0`E#@<# > E x> #`' @+'D> #  a  ``D''''''7 `> 7"P ,`$ ,ad 2`$a  `$@ D   W$ `$@  a  D? c   (P`H :"`HDP` . 2"` `# D; B>``P`@# ; B;`@`$ !``@8`$``@ @ ED `$!D``@  ``@  @`$ ~&`$D  !  " 8"  @   `PD`z$PҰ 7"'D$@s D   2  hDP 7 $PD^  ?2 , 4 `> 6$ D `$@ad$  &ad@;3  D?DP `$""`""a\"`* "`$@  00 LK   #D@:P`P 7 u"`P@ 0`$ @E 3D  0a  " 3 2 Қޒ  7D , 4 Ҋޒ  7D ސ 3* 0D/ݒ Da    L@:,c/D D `>V$`$`D $`$`(` <@$` $ ($ $`a$a K, `$ @@9[@ c > E 㿘   0 ( Lt@:Y> 7bP`P  e"`PH /` * !   2  V L> 7bP`  ;"`  #``@<`H 0@9 37 L> 7bP` "` `$ @y # L@:H p@H 0+@9 h> #'  > . > .##c& & &!h $@   @'Ȓ@6 c > EZ 㿘@6   > 㿘` @9ڐ   0 3> 7 L  (@ܒ 0`$" >W" ""$ , "  " $`$`($`$`` l<@$` `a$$ ($ $ , S @8h  @9{> 7b`@ 7 "`@㿐   ( $ L@9f> 7b`@  "`@H /` * !   2 c L> 7b`  "` `#  ; B<`> 7"  : " (@ B ; (`$ ``@8`$``@ 7 L @T `$!" ``@8  ``@ @>`$ ~$`$   #``@<`H 0@7Ԑ L` "`t  L   @ $  b 7s 2⨰  V$  /   5?1$ @ *! ( "@   " "@$$ }"   2$ " "@$ $"  \  ?$ $@8 И H 00H 0 @8dx> #` '@ > # a  ` '''''' Ȓ> 7b  $ a  "  0 ?# @$`0?`#@ a 8 ( $ 8# ; B>`  0# ; B< 0`$ !``@8`$``@ @< ͐ 8 `$! ``@8  ``@ @$`$ ~&`$   " 8 @ !  " 8" 沔     `` $v 7"$@  p  2 ` ` 7 a"` @ސ`4 a  " 0   ,  , ̐` . F"` l/ߒ  @7  2 $ "@  ""`"` "` 0"` L~˔    @7h`@ 7 "`@@ 0` $ (a$, a'  >Y!| ' ' (' ' ' `@61?# > Eې 㿘   ( "  LM@72> 7b`@  "`@H /` * !  Ϋ 2  / L> 7b`  g"`  #``@<`H 0@5_ L> 7b` "`H  L 6 a @6H 0A  "0 2`?ؑ* 2 2 *`*` @6Ő> 7" `" H 0 .@6gH 0H 0 ؐ@6㿘@`(`(`.  @` `(`(`.  ``` (` (` .  `` ` (`(`. 3 ` > I?> O??` * `(` (@ @. @1 @( @@  ``@  ` ` `  ` ق```(`(`.  ```(`(`. 9 `> I?> O??`* `(`(@ @. @1 @ (@@  ``@`   ` ` `  `$t ` `, `(ӂ```(`(`.  ```(`(`. T `> I?> O??`* `(`( .1 @.   @ ``@`   ` `$ `(  `,% 1 (1 1 `  .  @ ``@` `< `0 `4 `8`  㿐 ې' ( (@ ?"@"` "`"`"`"`  "` " ` > I`?`@?`2  c@ 2`(`2`@@2, @2 @2  @2` c` 2@2  @*3  `@ - *`@3 @ c3 *@ @ `> J` + +`@ @ -@ @> K> J-(`@ (,  * @ !> L> J ,,  `+,` > K@ -  `> M` . .`.@@> L@. `!> M-` @'@@  '`'`y'` @'D(`/`- *  ) ( @+( . -@/ /` D@D` 5> E* @55> F1 55  c',  0`1 *> F' 1   c> G '#`@> Gc0`> G 0`. 5> G c' `> H. @ (. !> HD+ D   @  @@5 !> E @(   '1 4> F* 41 1  . 5`5`> F> E c* c 5 > F> G `@ 5`5 # 4> G c `> H ( . @(@@!> HD+ D     ,@0`!> E (  ( $'55* > F5. 1 > E'ܕ*  1 > F c 55> G c0`1 > F #`@ 0`'؞ ؛5> G c;> H `(@`(ܙ+ @@> HD  0@  < @@. 5 !> E ( 4  8'Ԧ1 4> F* 41 1  . 5`5`> F> E c* c 5 > F> G `@ 5`5 # 4> G c `> H ( . @(@@!> HD+ D   @  L@0`!> E H  ( D'Ь55* > F5. 1 > E'̕*  1 > F c 55> G c0`1 > F #`@ 0`'Ȟ ț5> G c;> H `(@`Ї(̙+ @@> HD  P@  \ @@. 5 !> E ( T  X'Ħ1 4> F* 41 1  . 5`5`> F> E c* c 5 > F> G `@ 5`5 # 4> G c `> H ( . @(@@!> HD+ D   `  l@0`!> E h  ( d'55* > F5. 1 > E'*  1 > F c 55> G c0`1 > F #`@ 0`' 5> G c;> H `(@`(+ @@> HD  p@  | @@. 5 !> E ( t  x'1 4> F* 41 1  . 5`5`> F> E c* c 5 > F> G `@ 5`5 # 4> G c  > H `. (@D @(@ !> HD+        5!> F @5> E`0`5. @'* (@1 @5> E'c* 1 1> F c 5> G1 0` ## 0` 5> G   ' @@D ` > H`((.  /`@@ @@@  @'H   'P` a@1 > F`@1 5 4> E (. /`5`7> E* 5 4;> F c`@5`@ 1 1> F> G c 5`5 #4> G `@ `> H ( . D(   5> E`*.  5@!> F @  @51> F@ 0`(@57> E/`1 ;> E*``@ 1  0`5> G` c 1 @@0`> G#55> G # 9> H (@`( ;> H. `@ > H.@D@  @    @ H` @5 4> E`5`. /`> E@1 @(> F 5 41 1  > E* 5`1> F c  47> G  ;> G' c`@5  `> G> H`5`#(@ (@ D. *@ @Ȉ ̂@@ć1 !> E@( 0`5> E. +55> Fc #5> E*` 1 3> F `@ 5> G51 0`#0` c > H(` . ( .`D@  Ц Ԉ ت@ ܨ@1 3> I`H5 @(D+`@?4'D#@  `@4?((?@#@ @@ @(@1 5`P@#@0`@,  0`0`1 , , , (D@ 5`5  #(@@5@55, , , ,  D`5`5 (#@4@@ ( @5, 55, , , D@   1 , 1 , 1 , , 'D-/`(`*   + @(( . -) @/  @D/`D` 5@*1 51 0`5> J> K0`5 * .  c,  '' 5'' > L'܄  c5'#0`1  c c > Mܱ. `(@ .@@+ DD      4'Ԉ*'Ѕ1 > J(5 4* > K@'б5`5`> K1 1  .  cc 5 5 > K> L `@ 5`4# c ` ;> M'̺`(@ (@> MD + @ . @ ,   $  (1 '*5> J55 (1 > K5'> J* @'0`> K c 0`. > Jc`5@  5> L`@1 #@ 9> L 0` c' Ȅ`> M (.  (1> M+   @D'D@ 04 < 84'*1 > J(4> K5 * @1 5`> K'c c5  5`> K1  .   5  > L`@4#@ `;> M`(> L@ (@5` c > MD + @' . @ L  @ D  H1 '*5> J55 (@1 0`> K. c5'''* 0`> K' c 5> K   5> L`@1 #@0`> L c `;> M` (@  (@> MD+ @' . @ \  P T  X4'*1 > J(4> K5 * @1 5`> Kc c'5  > K   5`5 > L1  `. 4@#5`@> L c `;> M'`(@ (@> MD + @ . @ l  ` d  h1 'tt*5> J55 (1 > K5* '@0`c> K'x c 5> K'|   0`5> L`. 1 @#0`@> L c' `|;> M `(@  (@x> MD+ @'p . @  | p  t4 x'hh*1 > J(4> K5 * @1 5`> K'lc c5  5`> K1  .   5  > L`@4#@ `;> M`(@ (> L@ 5` c> M l. D'd+  @ @ @   0`'P5> J( '`1 0`> K5. c'\'X0`'T c 1 5* *5 > K` #@ 5> L1 #5P 'LL @``\> MX(T   > M(`@> M. @D @/`'H D `@` H'P@ V1 > J1 1  (4* > K5 > K4 c  5 /`5`5 > L`5`. c> K @4(`'H@ `#> M@ (  . 5`( H@ @D@D 5 > J(@1 0`5'D. /`*`50`> K '@ 5@> Lc> K#1 `1 @55#  `D9> M ((0` #;> M. `@ > M.@D@@  @    H@` 4> J(1 '81 5`5 > K. /` * 45`5 > K> L cc 45 5`1    3> L#`@ `> M ((` '4(8  4D. @ @ Ȯ̈1 > J(Ĭ5',> K #5@*` 50`. +0`> K`@0`> L51 1 5c#5c  > M (  ,. `(.` D @`Ъ@`Ԩ`ئ`܈@3> N5 `H1 @(D*@?4'D#@  `@5`?((?@#@  (@1 4P#@5@/@555 /`/`/` (D @@@ 5` #@(@1 @@P@0`0`**  0`45 *(#*@5`@D@ ( @5*5@  5* * *  1 * 1 * 1 **㿘 &  & @v 0   & א 㿘  㿘 6 H;j&. 0㉘ `va  " : "" " " 㿘 .3`+  `?@ @C ">   `@ @r  @m @ @@@& @㿀;> c'D'`2*@`*2*2222 ///////*2@ `? @" /@> -'c D   . . 2 .  .   8`X8@8`8`8`8` 8`(8`08`88`@8`H8`Pc > O H?'D?;?   (. 6`0&D @0( 1 ) @ 0(5`-` @ 0(5- Ć0( 0`(` Ȅ@ 0(5- @̆0(1 ) Є@0(5`-` @Ԇ0( 5- ؄ 0( 0`(` ܆@0( 5- @0(1 ) @0(5`-` @0(5- 0(0`(` @ 0( 5- @0(1 )  )@3a6 . 5`-` @-@ 0(5-  -0(0`(`  (@@ 0( 5-  @-0( 1 )  )Є@0( 5`-` @-@0(5-  -0(0`(`  (@@0(5-  @-0( 1 )  )@0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0(5-  @-0( 1 )  8@ 0( 5`-` @3zc6 . 5- 50( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5 0( 0`(` 1@ 0(5- 5@ 0(1 ) 5@0(5`-` 0@0( 5- 5Є0(0`(` 1@0(5- 5@0( 1 ) 5@0(5`-` 0@0(5-  (@3# `܆0( 0`(`  -@0( 5-  @)0(1 )  -@@0(5`-` @-0(5-  (@ 0(0`(`  -@0( 5-  @) 0(1 )  -@@0( 5`-` @-0(5-  (@0(0`(`  -@0(5-  @) 0(1 )  -@@0(5`-` @-І0(5-  (@ #܄0( 0`(` 5@3*T aN0( 5- 1@ 0(1 ) 5@@0(5`-` 5@܄0( 5- 0@Ԇ0(0`(` 5@6 . 5- 1@0( 1 ) 5@@0( 5`-` 5@ 0(5- 0@ 0( 0`(` 5Ą@ 0( 5- 1@؆ 0(1 ) 5@@ 0( 5`-` 5@І0(5- 0@0(0`(` 5@6.5- 'D'''    1@3(c0(1 ) 5@@ 0( 5`-` 5@0( 5- 0@ 0( 0`(` 5@0( 5- 1@0(1 ) 5@@ 0(5`-` 5Ȅ@0(5- 0@0(0`(` 5@0(5- 1@0(1 ) 5@@ 0( 5`-` 5@0(5- 0@0(0`(` 5@ 0( 5- 1@0(1 )  -@@3ta$0( 5`-` @- 0( 5-  (@ 0(0`(`  -@0(5-  @) 0( 1 )  -@@0(5`-` @-0( 5-  (@0( 0`(`  -@ 0(5-  @)0(1 )  -@@ 0( 5`-` @-0(5-  (@Ȇ0(0`(`  -@0(5-  @)0( 1 )  -@@0( 5`-` 0@3\b0( 5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@0(5`-` 0@ 0(5- 50(0`(` 1@0(5- 5@ 0( 1 ) 5@ 0( 5`-` 0@0(5- 50(0`(` 1@3\ b0( 5- 5@ 0( 1 ) 5Ȇ@0(5`-` 0@ 0(5-  -ذ3]b6 . 0`(`  (@І@0(5-  @-0(1 )  )@0( 5`-` @-@Ą0(5-  - 0(0`(`  (@@6 . 5-  @- 0(1 )  )@ 0(5`-` @-@0( 5-  - 0( 0`(`  (@@ 0( 5-  @-܆0( 1 )  )԰@6 . 5`-` @-@ 0(5-  -0(0`(` @0(5- @0(1 ) @ 0( 5`-` @0( 5- 0( 0`(` @ 0(5- @0(1 ) @0(5`-` @0(5-  0( 0`(` @ 0(5- @0(1 ) @ 0(5`-` @Ć0( 5- 0( 0`(` @0( 5- D    D@D@&&&& &> qb( @ > q   "(/`7`!@  @@  > q7 / b(` 1 @)    > q(7`/`@ @6. @1 )   @ @ > q ( 5-  6.@  %> q(7  / @ @5- @ @ 7`/`  7 / @  1 @ ) @ @7`/` @  @6 .  1 ) @  ' 5 -@ @6. @  $7  /   5-@  @(7` /`@ @7 /  @ ' ,1 @)   7`/`@  @06 .@ @@  41 )  '||5-   6.@  87  / @ @5- 'x@ '> q@ |(<7` /`@@ 7 /     5 x't1 @) -  @ @ 7`/`  @4t6 .,  @ @1 ) @ @@  4`5-,`@ @ @ 6.  07  / (  @ @@5-@  47`/` , |z#@ @ @@@ @7 /   3`@1 x) +`@  @ @ @7`/`  06.(  @ @@t1 )  3 + 5- @ @@@ 6.  4 7 / ,   @ @@@@5-@  5`7`/`-`@  @ @@7 /   5@1 ) -  @ @@|7`/`  6`.`@ @'6.@ x  @@@ @1 )   6`5-.`@  @ @@6. t | 67 /  . @ @@5- x@ 0`7`/`(`@  @ @ @7 / ' @t  0`@(`@ 1 ) @' @  @7`/`  5 -  @'ؒ@ 6.  @1 )   5 5--   @ @@@6.  47 / ,  ؒ@  @@@ @5-@  0`7`/`(`@  @ @@7 /   0@1 ) (  @'А @ @7`/`   3`6.+`  @ @@ @1 )   05-'̒ ( В@ @ @6.  7 / @@ @@ 4`̐أ,`@  5-  @47` @/`,#`ܤ @  @7 /  @  @0@1  ) ( @ @ @ 7`/`  3 6 @.+ @   @1 )  @ 4 5-,  @6. Д  @   5` -`@ 7 /  '̔ 5-@   @5`7`/`-`@ 7 /  @ؒ@  @@ @@ 'Đ   ȗ5`1 ) -`   7`/`@@  @6`6..`@  Ē @1 )  @ @ؖ @@  5`5' --`  @ @ 6.  67 / .  5-'p @В@ @  @@4@  , 7`/` '@  7 /  ̬@   @5@1  @) - @   Ȓ@7`/` @ А @ @  5`6ē.-`@ @ ̒@ @ 1 )   5 5--   @ @ 6.  @@ 07 / (@  @  5- @@ 0 ( @p @7`/`@   @7 /  @@0 @ ( 1 )  '@  @ 7`/` ' @ @ @@@ 0`6ȑ.(`@ @   @1 )  @ 05 -(  @ @  Ą6.  07 / (  @  @ @@@@ @5-@  3`7`/`+`'2֚@  @Ē@ @7 /   3 @1 ) +   @@ @p7`/`   4 ,  6.@' @ @@1 )   35-+  @@ @6. ' p7 /  3+ @@'@@ @6`5-.`@ @  7`/` @@@7 /   6@1 ) .  @@@7`/`  36.+  @@ @ @'l1 )   55--  @ @@@@6.  5`7 / -`@  l@@ @5-@  7`/` 5  -  @@@47 / ,   @1 )  @@ @@@@7`/`  4`6.,`@ ' @@@1 )   4 5-,   @@@ 6.  37 l/ +  @@@@ 5-@  07`/`(  @@@ 07 /   ( @1 )  @@@@ @ 7`/`  3`6.+`@  @@ @1 )   3 5-+   @@ @6. > qp b(> qb("@"`"`l "` "`"`"`"`"` "`$"`(27 */   > qb( `,5- `< `0 `4 `8 @  @   @& && & & H;j&. 0㉒`v"" " " " " " 㿘 . &  6  & 2 ? ? @"    ? @ ? @   &|@㿈> #`'      #* 2@, > O` ` !! #> Oa ` !!     @# *`2 .   > O!㿘  > O")  (@g @  > 㿘> O(   22 **2*, @3 3 + + 3 +  @ @  @ '@ Ѻ` ``( @(@1 ) 1 22 ) **@@2*0`0`@(`(`1 0` ` ,  3> O,`+a@ `@/`@3 + 3 + @3 @+  @  @ @@  `?%@ @  @ $$$$$ $$$㿘B `2  > P> P> P!PaX!*2@ `?"2 @" `(! `( M , B> @&$ ( ?  bB > `@?  (0 .B> 㿘` > P> P> P!PaX"+6` *2@ 2`?`(`( *@ 8  ( 8"@ @fp@` ?( @"@ @fg@ܒ@fa 8` @f\ 8 .`(` >``͐ @fN hp> #Т'  > P> P> P!PaXl"j> .  ?`2 @ .`   . .@f  h@f  > Pv!(#> c't2c > P]"㿘  > P  @ P@e   > @> H@'D P'@??`?`?ز` > OD?(8D?`0 D?8 ?Д *2* 2`  ,5 3`  @+,  4`5` /`КȰ, @,@ E@?-` 6 F *@6`ȶ ?F,` 4 , F -`2` а?Ȓ@3`B@ 5`?.@ ?ز@ @ ?઀@?袄@D?>@ ?   '(@?(@ ?Ԟ Г3- .5`6 ,` * 2* 3 , 4`5 -`  , ԫ3 2`* 5 ,`*`4  @,`4 @ - 2`+5`@*`* 5`С32 @@а @  @ ,,@-@?Dȑ4 ?@ @ D @ @ F ,*@> O@) @8C@ ?6B @F4`Ȣ@ ,6F ?*2,?Ȫ@    ع3`+B6`/`?ж@ @ @@?ظ  @?અ@E?袄@D? O$8D @ C ࢄ@ DDB ` @АB@G`(`0`8F@FD@<8<<<<< <(<0㿘p `2  @> P> P> P!PaXa#A*2@ `@2 "  "`P  @,  @  B > @ @8  H2 @ D(@ H`B > H@& P`P  @dB > @ @ 8 2 H D#8 H`B > H` Pw @. @  B > @ @8  H  D H`B > H㿘 @*2@ 2` P *@ p  P p"@ @c HP "@ @c’@c ~  H P@c p . P H @> > 㿘` > P> P> P!PaXP#  @@c~ ЁP> #'  > P> P> P!PaXP#ѐ> . ? ?`2 @ .`   . .@cP А@cM @ > P"p#> c 'Dc > P"㿘  > P  @ P@c   > @> H㿘ٔ㿘` > P> P> P!PaX:# ; 0@b Ё`> #'  > P> P> P!PaX#ѐ> . / ?`2 @ .`   . .@b͒ А@bʒ 0 > P#"#> c 'c > P "㿘&0@@33#3. $(``@7`7`#7`.`$(`33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`$@7`7`#7`.`$(`(33#3. $(`,@7`7`#7`.`$(`033#3. $(`4@7`7`#7`.`$(`833#3. $(`<@7`7`7`.`#((`D`@@&@&`㿘&0`D@33#3. $(`@`@7`7`#7`.`$(`<33#3. $(`8@7`7`#7`.`$(`433#3. $(`0@7`7`#7`.`$(`,33#3. $(`(@7`7`#7`.`$(`$33#3. $(` @7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(`33#3. $(`@7`7`#7`.`$(` 33#3. $(`@7`7`7`.`#((@`@&@&`㿘> Pb|H*`2`  *0 : *0@`( ` 2㿈.7 6ݐ, 2 @ + @2$@  7'' , 2`*`$@ `**`2 $@   , 2   .`2  `* *`+`&@2&  , 2  , 㿈/ 7 7 , 2 @ + @2$@  .67'' v'o', 2`*`& `**`2 &  6 ,  2  O'H', 2   * *`+`&@2&  / 2  נ㿘.;6㿘.6  V *`2 `  㿘.6   *`2 `  㿐 .``(`*`@*`*`@ `+ `+` @ @ ? 000000.@.`.`.`.`.`.`.` ֲ`㿐 .``(`*`@*`*`@ `+ `+` @ @ ?G 000000.@.`.`.`.`.`.`.` ֲ`㿐 :   @  . ( *(*`*@ + +` @ @ ?0.00000....... ʴ㿐 ;*(*`*@ + +` @ @ ?ђ?000000 ........ @ .( ɴ(+ (*`  **    ? 000000........@ .(㿘``) `((`@ #3+3> T3> U/`3 #> V@@` > W`/ +(`@`( @&@D@#@3+33c. 3 @. H#&3+33c. 3 @. L@ #3+33c. 3 @. P#3+33c. 3 @. T@#&3+33c. 3 @. X#3+33c. 3 @. \@#3+33c. 3 @. ` #&3+33c. 3 @. d@$#3+33c. 3 @. h(#3+3. 3@c3 . l@,# 3+33(c@3# (  ^p0#3+33c. 3 @. t@4#3+33c. 3 @. x8#&3+3. 3@c3 . |@<#3+33(c@3# ( 1 1 1 0`0`0`/ // / / / / / 㿘@`) `.``(((``@. `@`@ > T> U!> Vc#> W| <'6.6c66c#@. #c@. x8'&6.666c@. @. t@4'6.6. 6c@6@. p0'.666(c6@#@( @l ,'&6.6#.`66c#@c. @ h('6.666c@(#.@ d@$'6.666c@(#.@ ` ' 6.666c@(#.@ \@'6.666c@(#.@ X'6.666c@(#.@ T@' 6.666c@(#.@ P'6.666c@(#.@ L@ '6.666c@(#.@ H' 6.666c@(#.@ D@'6.6(6c@6#.@ @'.666(c@6#(@ @0`*0`0`1 1 1 *******X   & 'Ȇ ''`   'Ā& (& @?(&? (& &ĸ  `'> Y> Z> ['Ąd„ > Xׅ(#. > Xг7`7`ȳ.`@2 (7 ('؅7 7 ۴. 2 @@'߇6(66@(2 @@ #@@@7`'7`̷.ӱ7` . .`@'''_'%> Xߤ܅(. س7`7`.`@2 (7 ('ȅ7 7 ˴. 2 @@'χ6(66@(2 @@ #@@@7`'Є7`ӆ.۱7` . .`@'''''Ą V    0M  3> X000(c@> X6  #6 /`+6 #> X+`# + 2`2 #2`,` 2**`, *@@ @ @@ @  @ @H `%> X0(. 0* *`67` 7` > Xc7 # 6++ ,`67 .  7 @+`#,  @@ @@ @  @ @ ` ` `    G 'A> Xޱ. .`(($%> Xձ. ˳.`χ((7> X. ڶ޳.`( (> Xϱ. г.`Շ((#@@``@`  @ ` ` ` Ā@` ```  @ ` ` ` Ă`8'Ĵ  '   Ą'ā㿘> \#  !Rx l,``&@  * $ ` $㿀  @ '@  ' @` @' @     ' $@'  @   @ @@@ @@  @ @ @` @  @ @    @  @@  @@ @ @` @@  @@@  ` @@   @   @`      @ @    @  @   @     @ @ @ `       @@`  @       @@ @ @`   @@@  ` @  @@` @` @ @     @ @      ' @ @@`@@`  @  @ @    @@        ` @  @   @ @ @    `   ` @ ` @  @ @ @ @ @@ ` @ `  @ ` .@@.`.`.`.`.`.`.`x    ' '    @  @ ' @@   @$ '   ' @ @  @@@@    @ @  @ @  @ @ @   @ @ @ @ @ @ @  @      @ @  ` @@ ` @ @     @ @   `@  @   @@@@  `  @@  ` @  ` @   @ @@ @` @      @@`  @ @ @@`  @` @ @ @     @ `@ @@ `   @     @ `'  @` @`@ '܄  @ @ ` @ @     `@   @@  @ @    @  `    @@ @@@  @ ܄ `      @@  `   @`.@@.`.`.`.`.`.`.`㿐 *   * +    *`  *  * ''@000000.`.`.`.`.`.`.`.@''㿘0`.@@7`?.@@0` ̄3.@@7`?.@@0`UUU.@0`@(`7`/``@> ]!#%'"$& @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`> ]!#%'"$&`x @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``/ 7  ?7 (`@7  7 @`?. 7`7` 7`@`0`(`1 ) 0`UUU. @1 ?. @0` ̄3. @1 ?. @0`ð. @$$㿘0`(`7`/``@> ]!#%'"$&  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7`` / 7   ?7 (`@7  7 @`?. 7`7` 7`@ `3> ]!#%'"$&`x  @/ 7  ?7 @(`7 @ 7 `?(@7` 7`7``?/ 7 ? ?7 (`@7  7 @`?. 7`7` 7`@`?30`+(`$$> _8 * ``( > _8 ` `(  㿘> .  @WΔ     ` 㿘> . `" א ? " ? *` @  *  @*   *`*@  * 0`#@ @ ,`) 33@ @ @4`(`@ @ 4`@@ 0`UUU@ @ ,`@1 ? @ @,`@ 0`@ @ ,`?@c`c@ *@  > _<!8 3 c 2> .$'!%  @  - `) (`1 0`) (`1 0` @ 1 1  < 1 1  1 1  `1 @ 0@ 8@0`0` `<*(" ?`? * + 0`0` 0#( `0` +`@  &*`  @@ @ ? @,`4 @ &@4 , ` &@  ` 㿘4㿐 + *`   *   **`  *  * 0c@ @*` 0)?#@ @*` 0' ̦3@ @*` 0%?@ @*` 0#UUaU@ @*` ?`?0@ @*` 0@ @*` 0@ @*` 0@ @*` 0@ @*` 000000.`.`.`.`.`.`.@.`㿐> . ̤`?  H /f * ' > . И => .> . `Б+  * `-  2* #` @ * `2 2 ? ,  *`*  `  8    ˑ+ ?, " ? , H 0  ̵* @`€'     @ <̔ "H 0㿘> . ̢` ; > .В@ 3 H /4*`* '*` `̡* @`  ?"``̐ €`̔ `  @O H 0㿘H /f * ' > .`Ѐ   % В l"I > .` " ̑H 0p%  А *@ @O*` а  > . ̖  ` 2   ` 2 ` F    ЀG.  . H 0C?, lI    БH 03?!> .*  ̕* Б*` * @OD@ Г, ̒@ *`* % "`K l$ ̑H 00*"H 00H 0?> .К@`> .̀' H(+`> .̆ ( p   " ̄ ( H 㿘> .Ј `> .̀* H() > .̆@(   &̄@( H 㿘 H /f * ' > . Ѐ > . ̀`  . * @ .`@  . H 00 `"@ `    *`"`* `̒ @Ng ` `̐ `* `̔"H 0 㿘H /f * '  > .И  > .+  ̒@ *`  "> .ؖ & , ,> ." "ؑH 0 l0 > .ܒ ,""ܑH 0  㿘H /f * ' > .耢 & T T> ." "H 0 > .k 0 > . T""H 0  㿘 "G  P > .A  И > . > .  ap "   "  * `И  Ѐ+  & @ > .`̐ * & `B : " & @} 㿐 "b  ( 2 $\  U > . ̀2N > . Д /* *  ` `?`#`# $`  `B ; ` ;  B`;` (?2&   $@  $4 "  $4 "04`24 $`Ŕ 2 #> #& @ߐ 㿘 $H /f * '  $`" > 7!> 7`4& $# $`2`4> 7"H 0㿐H /f * ' '> .Ԁ !> 7> aa8"#\ 8  3 > 7> a#Ԛa@#\ 8  )  $Ԑ"* H 0' H 0 @LҒ 8'> 7  @LŒ 8 $$ 4& $H 0㿘H /f * ' 1> .-> .+> .)> .3> a耢 `  `  ؒ $aP h   ,& ؀  T%耤``,%`H 0`(@H /f* 'TP@% ؝㿘   &  (@0-H /f * '  > . & `& , ,> ." "H 0 > .j- 0 > . ,""H 0 㿘H /f * ' > . & T T> ." "H 0 > .j 0 > . T""H 0 㿘> .- > .Ѐ@( > .> ..(@ p  .`/@``.`." JDLLLLLJ JJ$LLLLJ0J<IIIIIILLLLLIILLLIRRRRRЁ  > #'0#e ( @   #g#i@ #f@ΰ 耦@0#h@ܰ `> x*` €> .!> .!> .!> . "> . "0> ."P> ."p> ."`> <*` €> . "> . "> ."> .#> .#@KB $Ȳ@K> $ &`*`'' @h  @ d &  L EJ: ' R: R`2'`# @* ''` @  &  L E$: ̒'Ԕ,: , > .! `?i ̚  ::;`#\#l#h#p#t@ 2`ذ  & / "F LԀ 'F L#@ @@@ @ @e  > ap!`㿘`?#  /    ! @R !#  X@Jx   p& t&  l&  \& h X& @Jh&` L "D`"@  @&  @ ;@ 2     $ 4 Դ  $ X` h` ʀ  %`% %  %  <%  @* % `    ?$ `$$ $ $$ (* $` X>$ $ $ ( $ <``    ,   (   `  $ $   $"`  $  `$ `" $`   Dd $ 0 > .И  $ > .+ `̐ *  `  " $ € $  $ XH /f4 * '    %> a p e  `H 0! x 2  2`` X`  ``    0 , X@ E< L㿘   x" `# gC  & 㿘g8 㿘    `> *` €        X  LC;  @I X >"H$   4 $4$P$  @ "@ `   " @ 2   L C " 6  @  :  ` .> ap  dט $ " ,@ 2   @     ` % , "Dw L,Dp L   -㿘  (`"`$ "@@ 2DS L& ( > .     㿐0#d@1  L By &@&`&`'֔ D) L0 2` 2 > . ""`(&, ?",`0?"`0`, f!`0   2  " 2 "   񀢀  "@ "`  "  "`"  㿘`  LB  / 7`4`, @ & (\& $h& <l& & p& @t& & > Ғ0 㿘  $ " <C L < "C LC L㿘 `> a!x6> a> a! ` `2 !@ :&@ %> a`2 ِؐ""&  㿘 `> a!6> a> a" ` `2 "0@ :&@ %> a`2 P"@&  `    @   &  `2 ??* ""?㿘`> a"ha > a"[5> a`` @ &L,`  @6&@$ %> a @ &;,`  "@   @ Ҵ& ` eTeTeTeeeeeeeeeeTeTeTiiiiijj j,lLlXimm\mhmimj8jDjPnnnnnnnnnnno\oDoDo\npppppppppppqppppqpppX>  c ' `@Kϒ  2` + `  '  ` (`ϓ ږ`  `HǴ@ѧ " `$~  @T RА'`  6     * &  €#€      * & 2@M o&  @ "' "'\@  D  $   @, &  €(?: €$    @, & 2"' @ 4` Kİ @+2` -`  @V TА`      * &  €$֔є €     * & 2̔"Z -`@`@ I@  $   @, &  €)~y € $   @, & 2`'@` O4` 0L c > ak"㾀> #耢'?` 6  @`` `m` "C?`1>#ܓ*` € `€ `` ``€ `2 ``€ `€ 2  0`` ̓ `   > aj#㿐` l >]   1  t "   ? l 2&`;   />   $ ͣ "@?" ?&?  + @` :"`" "`? l 㿘 z`x> .!`#> .a :` " a  ,`2᠀`a20᠀`a $a * $aa l* =Δ  aa 2 $a$a @JF 7@C*`᠀  a2'*?m l$᠑,@`0&  l=  $@C} @?`> *` €> .!> .!> . !> . "> ."0> ."P> ."`  :` " > ."> . "> . "> .#> .# > .#<  l=` "` `   l=U "` ` #> .'> . @  6*@ ` & : &`  €``* ` 2  `  :  @"`* 2a  @  j*@ ` & : &`  €``* ` 2  `  :  @"`* 2` @  \*@ ` & : &` Z> .#X> .#t  l<ޔ "` ` ` &  l: <ϔ "``  ` & : "` ` :-`  €``` *  2   € > .#> .#  l< "`  "Ӑ  @ " > .#"` @  @"` `Ԡ 㿘> .!@  > .!`.`@O `L   a"`:> h*` €  1 `@ -   @B$` > l  " `   @B` = l  " @B  = l   "= l=ݒ la 2  㿘 2 $f  Z   U> .!    > .!*   K&      ! : `    1  2  * ?`$> *` €    & `4 ]  &  &  & `4`!- @Ӑ #> . $a> a}Ð# @A{ T >>>a'#''''''''''''''''w'㿘: 㿘2 㿘  l;k  @AD&t㿘@A; = l&㿘0 㿘! & 㿘  l;?!&@A!H`D``@a㿘@A!< l&㿘 㿘J 㿘!  l; H H@@&.ؕ6㿘@@ݒ`H< l&㿘 㿘䢔 㿘  l:ߐ  @@&;㿘@@ < l&㿘b㿘n㿘  l: ( (@@&2㿘 ,` " `@@! l<^`` @@x (>b"'''' '̔ : l,` % T "@ .` 9 l,` % T"@  $   PT''> .#ΐ > . ##\?  " 2e,`*     T̀ ؀`2܀`K`I l9  C&'& &`'ܰ  l9  2&m| # @ @@ l@;E&@ $@ l@;9& ` @ 2@&  &;( l` @  / > 㿘L l9S 㿘;  l㿈a"@  o6.   ' "  "`"@"`"`  o6 ?#\  @ `     ' 7  6h \ /'А Ԕ <  Ū  ɐ '̖ "  "`"@!?ض# `` ij '̒` "` "Ԓ#أ ` ! '̒` "` ,@,`$`H /f * ' >  rݒ "H 0'>  2H /f4 * ' > b`$ 2`$H 0 """2 "  "Ԓ V  R`H /f * ' r "'̑H 0̀`!̐ 2`H /f * ' > b`" 2`"H 0 ̐`"`2`"@"`̔  "  ,@,`4`$`̰#̀ > b|  X`H /f * ' rO "H 0 2H /f4 * ' > b`$ 2`$H 0 """2 " "Ԓ ʔ  ƀ` ɐ  ` %` i   < %% @=ƒ <'> . $  && & & & & & & 8& 4  '̒` @`'% % d 沖 Q f'Ԓ   _'> b`{w `CЀ "'̀ !@x'''ȒД̘ؖ Ȱ # N$  ڀ` Հ`@Ѐ` > b {< ǀ`` > b{4 `& <   2   ' 7> b h{``    ? Ȓ̀`'''@`  Ѐ  Rԁ㿘` ? h:   `-H /f * ' > !q) "& $H 0 $ (  & 6 & 0& (& ,& <& 8  2    & \"㿘 ƶ  "    `   ŨL.@&à 㿘 ‡   "  " " " " "㿘  {  2    "  &@.@ .` .` .` 0X!  'P   > bx  2x 6s " @bP@|`   P%` [#%`P Q`@P @  0C@?쌐0;쉐08%`a "PAPP%a@P "@ <`P` `> b<> 8`` "`@ 1  `K' G 1 `a:`  2" @ "  0" 0@$ 0@ "   0 $ 0    `: @ ǖ` ˒   0@  @@ @і "  0"   0 $ 0@ V'$@@8`  "&  /$. l h@@ l $& l @ "o  0 d $ 0 0 > bw!  Z 말 l@ "&, +> 80`"0 $@o "?  0"2  @ 0 $ 0@5  @$" @ 8    x! `" H@K4<``> b xِ! Z  4@8  X  `  !> bw!8  2 <>  "<> bw!H   `  ?`5`@" @b`@{`" `  %` @  ` %` `=   6 װ Ӏ"a @ `B 2a` G@   0h$ 0ޞa "%a@+%a $`5> 8 @`$ "`$ @:<   @ $8 Y:` @ 2<`5`  B` 2 d`( d  B=``   @  d @ `@ 6  H$ , ːV  HJ?  d`@ `8@ $ ` $ d$ `$ d l   ` & d h d@   d$ h $ l8  @ $ h $ l 0` ?$ 0?$ , " 0@  0`$ 0$ ,@t  麐  X 㿘 X! @! 2#>  @YÔ  `+  "    㿘 X! @  >  !*`   '> b 4   XUt   @Y 27  `4   @Yp  ? 4 ?4 W2   r 䀧  ? 4 ?4 W  㿘> 1 `*> 8> >!b   ` 0@2&  0@ & 0&  & "@"#V # ``  0D @ H /d * % 1 H 0 h \ 0` ''@ % % +%  T : <2` H* @ % *`  0?Ѐ@ = > 8`` %  "` @Œy> 8``,'̐ "`,% @k 0@"o T < H% ''% `<  G> bV`< T> 8``: 2*  * #`= @ ` & h < T"@ * $   @8 H @8g@& l <& l`(`@ $T > buɐ!hE ` &`> 84>  "4  = `@Òv(!y 0& 4(& 0s> 8( `:  d2 H* #($% * @ 'ԑ< 0C @=   @'Ѐ`% '̐ ' 0@ & 0@^Ȥ ̀  0  0 ?& 0 0@*@& 0% 0 !H /d * % )H 0 0 Ȁ"  0$& 0" & d 0(& 0%& 4 5& d& ` `& @@kS`XH /d * % ԐH 0H> 8b > #'> א +> b/> b1> 7> b5> !`Ѐ +> b/> b1> 7> b5>   8  2   > bs! u[aؒ   "> bs"0a "> bs" - `7 "> bs"@' "> bs"`?7'u)x@77  / , $ > bsk"o@7" ?'//!&"В@l "> bsV"? 't c > b]`# 㻐> #'@ > b #@j > b#8t͒&ab  > b#Xt@?iO :.` K.  * .  > b]# 㿈  '` "` #a b$$ $  "@  o$ 4?#\b'  >`  }  %'   !>  > 4b$"Ѐ '> "8> a8 'ڒ '> btI# H "S M㿀> "> A"  '@?29 "@5 a#\b  @ ) Y'd '쒒 '#' V耢  '@6   &..> bs# 㿈#ab Ԗ  2@> '( ?#\b   `  H` #   ͒ $ '  b 0 H㿐> a> 8  F> 8"b> 8> c"  ) > #a> 8> c#\"`!  h 㿐>  ! +    > 8b> 8 b*  > 8  X 2T 2 @;o 2    2Z& 2 > 8" " )u 2> >"<  &b )d 0>> 8 i"@5K!$`$ !`L2` @;4 2 `< 2`@ $`<`@ $`@ $" $@$  /I $  $  4 b )( & 㿘 > %> !(  `  D > c    <` `$`   s @): 0˒ ` 4`   㿘 > %a(  ``D > c @ `" `< 2"  "@`<  %> 8 " T 0  T @$! 0 ! "!:t! :nʐ`j$` > #`L``0 `@`8'`,'LE'H  "    'HLH @a\D wD - H`L $`T@<#\#`  H0@Q2@<#\#`  H0@Q% T  L`L  H\ L  H@ "    'HLH @aD 2D~ǔ `L L  H@ "  HL@a  0'HL  H@ "   'HLH @`D D`L, `#\#` (@g "3`L $`T@<#\#` @P0@<#\#` @P0 А @`L  H"ٖ   @e<Җ  (!,@Hך 2 (`<     , @HŚ 2,(`<    ,  @@H 2,P(  ( $`T`L @<#\#` @PB0@<#\#` \@P50 d `L  H<@e&@@    8 `    $ 0@  "@` @G   ?# ?@H /f * ' >  gh "H 0 2H /f * ' > b` 2`H 0 """2@"'@" @ '<@ <`" < '<$ > cYI  > # L  0  @ 8' ,'LE'H  "  ` 'HLH @_D `D@ - H L $ T@<#\#`  H0@Oz`@<#\#`  H0@Om`   L L  H! L  H@ "  ` 'HLH @__D D }  L ,L  H@ "  HL@_̔  b'H L, `#\#` (@en ,P L $ T@<#\#` @O 0`@<#\#` @N0` .   L 2 Hc( ( $ T L @<#\#` @Nؘ0` L  D T@<#\#` @NƘ0`    L  H @w      8  L  D T`    $ 0@  "@@  @G L  ?#@?@H /f * ' >  e "H 0 2H /f * ' > b` 2`H 0 """2@"'@" @ '<@ L <DT#  L < T D'<@dc > cW̐  X> #L0 @ 8 ', ?E  "    ' @^&܀  - HL $Tؒ#\#`  H@M`ؒ#\#`  H@M`   L  Hp   @ "    ' @]܀ ܐ { L P  @ "  @^N  0'P{   @ "    ' @]܀ > >!l   @ "    ' @]܀ m  /7T  @ "    ' @]v܀ T!l@  @ "    ' @]\܀ :'X  @ "    ' @]D܀ "!l@  @ "    ' @]*܀ '\  @ "    ' @]܀ !l@"  @ "    ' @\܀ ְ       ?h  @ "    ' @\ؘ܀   (  @ "    ' @\܀ 't  'x>    *`" *  * 't'x  @ "    ' @\܀ u  (  @ "    ' @\|܀ Z'|  '>    *`" *  * '|'  @ "    ' @\V܀ 4 g  @ "    ' @\=܀ ' M'  @ " $ ' @\$܀ @?# @@> > /7T!`@2'X!`@2'\ !` :?h!`@"'t'x!`@"L'|*`" *  * ''LĐ `#\#` @b 1 L $Tؠ#\#` @K`ؠ#\#` @KȀ` ڐ  L ŀ H"- #\ P E   $耢@ (쀢@ # 9h<L $Tؠ#\#` @Km`   x#\Ԑ #`@K\Ȁ`   L v H"ޖ #\lh?l?2`<Ā &  X`<0`<   Ē @C} В  $TL  ؠ#\#` @K`  D x#\Ԑ #`@JȀ` "  L  H  #\@^j     8 `    $ 0@  "@`C G  ?# C?ؑH /f * ' >  b  "H 0 2H /f * ' > b` 2`H 0 """2"'"  'ؐ` Ԙ D#` ԖD@`E'Ԗ> # > cS  > # L  0  @  8 ' ,'F'  "  ` ' @ZX 2z@ / L H % T#\#`  H@J-#\#`  H@J  O   L ) Hu   @ "  ` ' @Z 24 w”  L   @ "  @Z  "'  @ "  `' @Y *@ 4 ? $ H ) L  % T#\#` @I #\#` @I Ґ "  L L  H  L  ``'#\#`#h''#dh@\͚`  ) - L  % T#\#` @Ib  X#\#`@IT  ] L ^ H" Vnp(S x@,o @ X d%@ h%` X$` ݒ % T L #\#` @I  `D`X2 X#\#`@I 0   L  H  @]N m    8 `    $ 0@  "@` G   ?# ?H /f * ' >  `. "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` " ` '#@vI i    8 `    $ 0@  "@` G  ?# ?H /f * ' >  _Ò "H 0 2H /f * ' > b` 2`H 0 """2"'"  '`   #`  u' @]@] j    8 `    $ 0@  "@`C G  ?# C?H /f * ' >  _L "H 0 2H /f * ' > b` 2`H 0 """2"'"  '`  D#` D@]q'> # > cQ*  `0'@> 8#'L ','L'P''' 'ЬD'  " $ ' @W| _ - HL $T#\#`P  H@GR`#\#`P  H@GE耥` t  L  HŖ   @ " ( ' @W8 ̐ t L >   @ "  @W  ;'> "  7> 'ȑH /f * ' >  ^` "H 0  4 H /f4 * '  6 H 0  $ $$ 4 H /f * ' ^/ "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    0  ܀ $ ''@ $($"$ $ $ #$L `   %=%%#`Ȕ#\ܒ %%%@\ 1L  $TP#\#` @F[ `P#\#` @FP耥`  L  H"і   @[Aʖ `< Ԁ      (  L "$TSЀ $TL P#\#` @F`Ԁ   \P#\#`@F耥` / L  H ` @Z v ` Ш%   $"@ @Y”"    8 `    $ 0@  "@` G   ?# ?H /f * ' >  ]" "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '""> # > cN Ё 㾀`0`'> #`L`@ `8'H''`,'L'P','(E'  "   '(,( @UT$ $ - H`L %`T #\#`H P H@E*` #\#`H P H@E` L  ,`L } H ,  (@ "   '(,( @U$ n$r `L ,  (@ "  (,@U|  0S'(`!,  (@ "   '(,( @Tۘ$ :$     (@ "   '(,( @T$ $ ,  (@ "  '(,( @T$ #$`L  '`<   @4`L .`L H %`T H#\P#`  H@D_ H#\P#`  H@DR` `L  Hݖ `L `#\#`H @Z ,`L  %`TH#\P#` @D' `H#\P#` @D` K  `L } H"  u  <  `     !  @ >  ?# c? H /f * ' >  Zʒ "H 0 2H /f * ' > b` 2`H 0 """2 "' "   ' > >  d" l`d'$'gT    8 `    $ 0@  "@`G  G   ?# G? H /f * ' >  Z` "H 0 2H /f * ' > b` 2`H 0 """2 "' "   '  `H" 'H'D    > "     8 `"   $ 0   @"   ?$  $ [H /f * ' >  Y "H 0  4 H /f4* ' 6H 0  $ $$ 4 H /f * ' > !Y "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ &4 .  z "@  5 2 > ca    8 `"   $ 0   @"   ?$   $   @##    $  ":"""     0L ?' " %`T`L H#\P#` @A`  2 XH#\P#`@A` א `L  H"4  0@V- "`O@W]0%4   "@" @U_% `$ > >!l> >!d$$> # > cJ  00'> @8,'L#'P'L   '''`'" E  "   'Ȗ̒Ȕ @Q@Ā  - HL $T#\#`P  H@A`#\#`P  H@A ` 8  L  H   Ȑ@ "   'Ȗ̒Ȕ @PĀ XĐn L   Ȑ@ "  Ȗ@Qh  0='Ȁ%  Ȑ@ "   'Ȗ̒Ȕ @PȘĀ %    '     Ȑ@ "  'Ȗ̒Ȕ @PĀ OĄ   . `*̀`Ț  "@ " " ` "`" " `" #"@"   2 6-LL   $TP#\#`  @@> `P#\#`  @@3` b  L 瀦 H" #\  `#\#` @Vf ,L  $TP#\#` @@ `P#\#` @?` *  L  H" #\N L' <         @8"L 6L  $TP#\#` @?`  xP#\#`@?` ݐ L b Hd  #\P@S[ 2P . &`&@` "" "2     &`>`&`&`&`R> 8H`"Hy L " $TL P#\#` @?J`  `L``2 P#\#`@?5` d L 逦 H瀦#\@SA ߖ     8 `    $ 0@  "@` G  ?# ?H /f * ' >  Va "H 0 2H /f * ' > b` 2`H 0 """2"'"  '` `"  '    > ##  i     8 `    $ 0@  "@`C G  ?# C?H /f * ' >  U "H 0 2H /f * ' > b` 2`H 0 """2"'"  '`  D#` D@T'> # > cGʐ! 㾀'D'P&D'L`" L 0 @ ,''% (% 4 % H>   :`4`, @,`b2*@ *@ b 2`*  *`> `@> .#C3`+ <`+`<B@ DE=` ` " ' @M  / H`L %`T#\#`P  H@=Θ#\#`P  H@=P P @'`L  H  @ " ' @M T `dkc `L   @ " @N!  0; '$  @ " ' @M $       @ =`%`H  @ "' @M`  |?  =` ` ;`B=`%`P #  "@ " " ` ""  "  # "@"   @ 1> %`T#\#`  @<#\#`  @< #\ 8 @Q  %`4=@%`,H /` * ! `H @   8` @8  %`  ` "`$  $ %` `H` "`$&`H`H%`$`, h `p *  @@  `d d@%  2  ` @ `d`  @`d d@%  ""4@ %``"`$%` L `` `@   @% P 2@  @d @d d@%k  "L0 %`@`"`$@%`H 0> ``: 4`, @,`b2*@ *@ b * >  2`@ *`B2**;@ B H /` * ! `H ! 2 4  4 2 `" $ $"`$ $ "@ `"  "`  "@H 0 , L% ,#\ L  `#`  8 d @R   8Lr <      '쀤 2  H L@3  H    &&& >  `H"6&   2 2  + &ؒ & "" "2 2J> 8H`"Hq 쀢 L> " $ % T#\#` @;@ #\#` x@;5#\8@ON% T  `L``2 #\#` @;x#\8@O/    8 `"   $ 0  @ "  D>   ?# <H /f * ' >  RQ "H 0 2H /f4* ' 5H 0 """2"'"  '>  `"  ' P H 㨄  g     8 `"   $ 0  @ " C D  ?# C<H /f * ' >  Q "H 0 2H /f4* ' 5H 0 """2"'"  '`  D#` D@P ' ,`% 4> cY!H /`* !   =`H% `H "`$&`H% $(   `" $ $"`$ $ "@H 0  H /` * !   <`H$ `H "`$&`H$$H 0> H 0H /`4`H* !`H   4 "  ` $"`$ $ " 4P"@D" 2 4H 0 㿘> #" `> ca0@ސ ``"``"```"@` `"`$`$"`$`$` "@` @4  "` @ ` @`> cX!@$ ,Y`, , (@ `,@@ 2@"@`> `, (`H` &`,`2 ( H 2 (& H ( &`  (` "`$& (&`$`(   `"$$"`$$ " ( "  ( "`$& ("$`(2 㽠> # L  0  @  8 ' , ?8'''''dE  &  ` '8<8 @I&4 4@ /< L H % T0,#\#`  H @80,#\#`  H @8` ` < L m`H <  8@ & ` '8<8 @H4 x4 f  L <  8@ &  <8@IP  <0_ '8<  8@ & ` '8<8 @H4 I4@ 4 ? $ H`". L L % T0,#\#`  @80,#\#`  @8v` `"  L L `H  L `8 'd'h#\#`#h@'p#d@K<` 'o '`?H L % T0,#\#` @80   x0#\, #`@8 `N` L `H #\ @L-0  0 ϸ<  8@ & ` '8<8 @G4 4@ " P    'HT 'H <k <  8@ & ` '8<8 @G֘4 m4> >@!l <  8@ & ` '8<8 @G4 R4` /7L<  8@ & ` '8<8 @G4 :4@!l@<  8@ & ` '8<8 @G4 !4@'P<  8@ & ` '8<8 @Gs4  4@!l@<  8@ & ` '8<8 @GZ4 4@'T<  8@ & ` '8<8 @GC4 4@!l@!<  8@ & ` '8<8 @G*4 4@`      ?`<  8@ & ` '8<8 @G 4 4@  '<  8@ & ` '8<8 @F4 4@'l` 'p>    *`" *  * 'l'p<  8@ & ` '8<8 @F̘4 c4@  G <  8@ & ` '8<8 @F4 H4@'t`,'x>    *`" *  * 't 'x<  8@ & ` '8<8 @F4 "4 d< P  7L @'H  8@ &  '8<8 @Fk4 4> %2 ` <@'H 'HH /` 7L`` P ` P   :?` 'P H`` LHTPd Pt) `Pߐlcה P˖ `H` H  'HH ;ܐ 6Ht TdޣT L % T0,#\#` @5Ԙ 0,#\#` @5ǘ ``n  L 2j`Hi> d'TP&  hHt  L % TՐ0?# @'h@'d'l'p t h@@aPT޺ LPT] L` % T0,#\#`  0,#\#`  ޛ t T=d'T5PޏHtt TPޅTT&d`hd?`  @-  ` ?` ``@` @X d% h%X$ Ζא` ` l@4  2 '-`% T L 0,#\#` @4   `D`T`x0#\, #`@4֘ `` L U`HS`w0    8 `    $ 0@  "@`# 0G> >  ?# #?0H /f * ' >  L  "H 0 2H /f * ' > b` 2`H 0 """20"'0" 0 ',0> >  , $" ,l`$',#@``#@b!  0@IT,#\@Hk0 0    8 `    $ 0@  "@` 0G  ?# ?0H /f * ' >  K "H 0 2H /f * ' > b` 2`H 0 """20"'0" 0 ',0  ,` # ,  a',0    8 `    $ 0@  "@`C 0G  ?# C?0H /f * ' >  K$ "H 0 2H /f4 * ' > b` 2`H 0 """20"'0" 0 ',0` , D#` ,D@II',$ "dܜd TܖHt{ T8dP@܊ P P > # > c<ߐ!X 㽰> #L0 @ 8 ',?@'$E'l  &  ` '@D@ @C8< <@ /DL H $T84#\#`  H(@384#\#`  H(@3`0 ` DL `H D  @@ & ` '@D@ @B< Q< ` L D  @@ &  D@@Cb  D08 '@D  @@ & ` '@D@ @BĘ< "<@ 4 ? $ H`".LL $T84#\#` (@284#\#` (@2` `" LL %`HG L `$ H@'l'p#`#h'x#\#d@ED$` `;DL $T84#\#` @2G(84#\#` x@2:(`i`L ؀`H֐#\ @FH8$  K   @@ & ` '@D @B< }<@> / b@* @?   P%P|   cPؿD` `@ &  ` '@D@ @A< O<> >@!l D  @@ & ` '@D@ @A֘< 4<` /7TD  @@ & ` '@D@ @A< <@al@D  @@ & ` '@D@ @A< <@'XD  @@ & ` '@D@ @A< <@al@D  @@ & ` '@D@ @Au< <@'\D  @@ & ` '@D@ @A^< <@al@!D  @@ & ` '@D@ @AE< <@`      ?hD  @@ & ` '@D@ @A&< <@  'D  @@ & ` '@D@ @A < j<@'t` 'x>    *`" *  * 't'xD  @@ & ` '@D@ @@< E<@  (?D  @@ & ` '@D@ @@̘< *<@'|` '>    *`" *  * '|'? &D  @@ & `'@D@ @@< <6$`?@c *   *` 'X P  'PٟP\XҔl HX|| BX lM Pو|m \*l\.Xl\X psP!X?# @'p'l'tӢ'x|J `2Xp@@ \X X\X`@T @ X d%@ h%` X$` P–ː$ .$`$TL 84#\#` @/(84#\#` @/(```L `H`w8    8 `    $ 0@  "@`# 8G> >  ?# #?8H /f * ' >  G "H 0 2H /f4 * ' > b` 2`H 0 """28"'8" 8 '48> >  4 $" 4l`$'4#@``#@]1  P8@Dd4#\@C{8$ "l}l \wP|\ \lX@k X X > # > c8!h > #L 0@ 8 ',''F'  "   ' @? 2z /L H $T#\#`  H@. #\#`  H@.    L  H   @ "   ' @>Ә 24 \ L   @ "  @?A  "'  @ "  ' @> ǖ 4 ? $ H )L  $T#\#` @.o #\#` @.d   " LL  H L `  ''#\#`#h'#dh@A`  ^ ,x < 2 @ | @    @ |hx|70Ɛ  '& $TL #\#` @-   x#\#`@-ܘ    L  H  #\@A > # > c7N!x 㼸> #L0 @ 8 ', '\'X'4'0','('<'8p'LF'  "   'X\X @=T 2T /\L H $TPL#\#`  H@@-sPL#\#`  H@@-f   \L  H \  X@ "   'X\X @=XT 2cT [ L \  X@ "  X\@=Ɣ  "\I'X\  X@ "   'X\X @='T 22T 4 ? $ H ".LL $TPL#\#` @@,PL#\#` @@,  " LL  H- L`` `X< 'L'P#`#h#\'X#d(@@\<`  n'4 '< FL $TPL#\#` @,@   P#\L #`@,@  4L  Hז  P#\@@ #\  `@@P< Ė ՜ G8\  X@ "   'X\X @P( < "88 " L Ւ L 0\ ̒ <L<ݐ> # > c4<! `> # L  0  @  8 ' ,''''''Fp  "   ' @: 2 / L H $ T#\#`  H@*f#\#`  H@*Y    L 瀦 H   @ "   ' @:K 2 W  L   @ "  @:  " L' L G  @ "   ' @: 2z / L H $ T#\#`  H@)#\#`  H@)ߚ    L m Hn   @ "   ' @9ј 24 W  L   @ "  @:?  "'  @ "  ' @9 # 4 ? $ H ( L  $ T#\#` @)m #\#` @)b   L  H  L `#\#` @? 8 L  $ T#\#` @)8`  X`2 x#\#`@)'耤 V  L  H@>  #\  <`2 L P` L `ܐ  'L'P#\#`#h'X#d(@ # > c1! 㽈> #L 0@ 8 ', ?'''lF  "  ` ' @8G 2@ /L H $T #\#`  H@(` #\#`  H@(` >  L y H   @ "  ` ' @8 2= U L   @ "  @8o  "#'  @ "  ` ' @7И 2 @ 4 ? $ H ".LL $T #\#` @'` #\#` @'`  " LL  H% L ` H'l'p#\#`#h'x#d@:` Ћ '  P'V  @ "  ` ' @7W > >@!l   @ "  ` ' @7; w` /7T  @ "  ` ' @7" ^@!l@  @ "  ` ' @7 D@'X  @ "  ` ' @6 ,@!l@  @ "  ` ' @6֘ @'\  @ "  ` ' @6 @!l@"  @ "  ` ' @6 @`      ?h  @ "  ` ' @6 @  (  @ "  ` ' @6i @'t` 'x>    *`" *  * 't'x  @ "  ` ' @6C @  (  @ "  ` ' @6( d@'|` '>    *`" *  * '|'  @ "  ` ' @6 >@$ \ H 7     ?0'('<' '$'8','@  'D(@4# 2-  @ "  ` ' @5Ƙ &l`7T-X \P| \plX@ XR Xλ >Xl* ίP2*p?# @`'p'l't'x  |@ @XXd%h% X X $  XX|΁P|f a  'o $TL  #\#` @%1`  2 X`x#\  #`@%` H L  H w    8 `    $ 0@  "@`# G> >  ?# #?H /f * ' >   b` 2`H 0 """2"'"  ' > >    $"  l`$' #@``#@Rd  P@9 #\@8* l ͯP|  "\ͦ\KlX@͝ X- X ͓v > # > c-! 㽰> #L0 @ 8 ', ?@'$E  &  ` '@D@ @4F< r<@ /DL H $T84#\#`  H(@$84#\#`  H(@$`> ` DL `H, D  @@ & ` '@D@ @4< -< Q L D  @@ &  D@@4p  D0 '@D  @@ & ` '@D@ @3Ҙ< <@ 4 ? $ H`".LL $T84#\#` (@#84#\#` (@#`Ő `" LL `H L@ `$  'l'p#\#`#h'x#dH@6D$`  ̐ '$`?PL $T84#\#` @#Q(   x8#\4 #`@#@(`o`L E`HC#\ @7N8$ S QO  LD  @@ & ` '@D@ @3 < L<> >@!l D  @@ & ` '@D@ @3< 1<` /7TD  @@ & ` '@D@ @2< <@!l@D  @@ & ` '@D@ @2Ԙ< <@'XD  @@ & ` '@D@ @2< <@!l@D  @@ & ` '@D@ @2< <@'\D  @@ & ` '@D@ @2< <@!l@!D  @@ & ` '@D@ @2t< <@`      ?hD  @@ & ` '@D@ @2U< <@  'D  @@ & ` '@D@ @2;< g<@'t` 'x>    *`" *  * 't'xD  @@ & ` '@D@ @2< B<@  DXD  @@ & ` '@D@ @1< '<@'|`)'>    *`" *  * '|'  @@ & `'@D@ @1֘< <$` /7TX  'P\酒l\א0hҐ# \Xl" $X@̒ @ X d%@ h%` X$` :C$ 0ʥ$`$TL  84#\#` @!g(    2 X `x8#\4 #`@!O(`~` L T`HR `2w#\8    8 `    $ 0@  "@`# 8G> >  ?# #?8H /f * ' >  8 "H 0 2H /f * ' > b` 2`H 0 """28"'8" 8 '48> >  4 $" 4l`$'4#@``#@N  8@5͘4#\@48 8    8 `    $ 0@  "@` 8G  ?# ?8H /f * ' >  8 "H 0 2H /f * ' > b` 2`H 0 """28"'8" 8 '48`  4 #` 4 N#'48    8 `    $ 0@  "@`C 8G  ?# C?8H /f * ' >  7 "H 0 2H /f4 * ' > b` 2`H 0 """28"'8" 8 '48` 4 D#` 4D@5'4 "\\绒lX@  Xȝ X > # > c)b! > #L 0@ 8 ','''F'  "   ' @/ 2z /L H $T#\#`  H@ #\#`  H@    L B HC   @ "   ' @/t 24 M$ L   @ "  @/  "'  @ "  ' @/C ^ 4 ? $ H )L  $T#\#` @ #\#` @  4 " LL ŀ HƖ L `  ''#\#`#h'#d@2/`` P勖 ' :L  $T#\#` @˜ `  x#\#`@   L u Hs#\P @2š k g  <   2 @  2  S@ǥ 06 4 !'ǖ $TL `#\#` @Z `  x#\#`@L  { `L  H ` #\P@2X > # > c'!ȁ h 0 '> # L @  8 ' ,'L'$' 'E'  "   ' $  @.  - H L & T#\#`  H@#\#`  H@ޚ    $ L s Hٖ $   @ "   ' $  @-И UK  L $   @ "   $@.=  0:' "$   @ "   ' $  @- "       @ "  ' $  @-} m:  ' L  > < # ##4܀@4' L `#\#` @3 / L & T#\#` @)#\#` @ K  L  H"  PL'   @ @ML LŴ L & T#\e#`  X#\#`j   1 '(0'' '(?8'D','0'4'@'H'L`' Ԓ 'Lϒ`Жf`8 "  PXL ' L =@  " L  L  & T#\#` @  X#\#`@s   L  H"o P@1dh "蠤ł& T  X``#\#` @EtrP@1<    8 `    $ 0@  "@` G   ?# ?H /f * ' >  3~ "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' " '  f    8 `    $ 0@  "@` G   ?# ?H /f * ' >  3 "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '> >!d> > l t q e '쀥@' @غ'؀@ '` @ "` ` "`쀧@   `'䀥 & T L #\#` @   X @@#\#`@  ;  L  HpP@/    8 `    $ 0@  "@` G   ?# ?H /f * ' >  2= "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' " '  `   `8e9> >` ``$`0 `  " `  ?&@S9> > p@` &@&` H /f * ' >  1̒ "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !1 "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` > >!l&u p@` &@&` H /f * ' >  1U "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !1  "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` & p@` &@&` H /f * ' >  0 "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !0 "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` @& p@` &@&` H /f * ' >  0n "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !09 "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` &``> " m@` &@&` H /f * ' >  / "H 0` 6`H /f4 * '  6 H 0 `&`&@&`6`H /f * ' > !/Ò "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` $E$@``.? p@` &@&` H /f * ' >  /n "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !/9 "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` v& p@` &@&` H /f * ' >  . "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !.Ò "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` @&`ت@ ?''쀧@ @ "` ` ꀥ ` ?" @'`'܀'( p@` &@&` H /f * ' >  .X "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !.# "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $`` !d& o@` &@&` H /f * ' >  - "H 0` 6`H /f * ' > b` 2`H 0 `&`&@&`6`H /f * ' > !- "&`$H 0`$ (` &`6`&`0&`(&`,&`<&`8`  `0  &` $``  > >!l&!d&@  `&&` ` &@&`    >  > c!؁ h0'> #L@ 8','L?8''E'   "   '8<8 @%ژ4 w4 - HL %T0,#\#`  H @`0,#\#`  H @` Ґ  <L L H <  8@ "   '8<8 @%4 24CE L <  8@ "  8<@&  0'8<  8@ "  '8<8 @%e4 ʖ4  L   !' @  >< % %%4耢4'L `#\#` @+n 0'L %T0,#\#` @  `0,#\#` @ ` . 0L  H"p  @@ ۛL   @ @ 1L LL %T0,#\`#`0,#\f#`   '0,'' ''''  ?' '''$`'  ' Lڶ`ԖM GL ܛL ` "  " : "  L  %T#\#` @j  `#\#` X@_ ` ~ 0L  H"Ж @)P,ɖ  n#\#`%T h @8 `~g,@)100    8 `    $ 0@  "@` 0G> >  ?# ?0H /f * ' >  +s "H 0 2H /f * ' > b` 2`H 0 """20"'0" 0 ',0> > > >," ,', # #d#l# ˒ 4  @''ܬ @$   @ " ` ܴ '܀  '`   "  "  h'' %TL #\#` @p  `#\#`@e ` } L  H֖ ,@(V00    8 `    $ 0@  "@` 0G   ?# ?0H /f * ' >  * "H 0 2H /f * ' > b` 2`H 0 """20"'0" 0 ',0 ," ,', ##0  , 8` $0   "   ?& ? <> ";> `( # X  " '` @ޒ X d"h"  X $  GL N`tH'   ' '䀢 '@(C4> >al  ''0''(@ m',0, $@& H /f * ' > )’ "H 0 6H /f4 * '  7 H 0 &&&6H /f * ' a) "&$H 0$ ( &6&0&(&,&<&8  0  & % l$  l0, $@& H /f * ' > `)R "H 0 6H /f4 * '  7 H 0 &&&6H /f * ' a)! "&$H 0$ ( &6&0&(&,&<&8  0  & % $  l0, $@& H /f * ' > `( "H 0 6H /f4 * '  7 H 0 &&&6H /f * ' a( "&$H 0$ ( &6&0&(&,&<&8  0  & % $  l0, $@& H /f * ' > `(s "H 0 6H /f4 * '  7 H 0 &&&6H /f * ' a(B "&$H 0$ ( &6&0&(&,&<&8  0  & % $ > " l0, $@& H /f * ' > `' "H 0 6H /f4`* '` 5`H 0 &&&6H /f * ' a'͒ "&$H 0$ ( &6&0&(&,&<&8  0  & % $@=$쀢 $> ,? > " ( l0, $@& H /f * ' > `'t "H 0 6H /f4`* '` 5`H 0 &&&6H /f * ' a'C "&$H 0$ ( &6&0&(&,&<&8  0  & % $@=m$ 'ܬ ? ' 4 p0, $@& H /f * ' >  & "H 0 6H /f * ' > b` 2`H 0 &&&6H /f * ' > !& "&$H 0$ ( &6&0&(&,&<&8  0  & % > >d$  o0, $@& H /f * ' >  &p "H 0 6H /f * ' > b` 2`H 0 &&&6H /f * ' > !&; "&$H 0$ ( &6&0&(&,&<&8  0  & %  > >!l$> >ad$0    $& , $@&  훒 혒 >  > c! `> #`L``0 `@`8'`,'E'  "  ` ' @j䀢 v@ - H`L $`T#\#`  H@@#\#`  H@3 xb  `L  HC   @ "  ` ' @%䀢 1 ;Ք `L   @ "  @  0'  @ " $ ' @䀢 x`L̐ `#\#` Ȗ@$  5P`L $`T#\#` @ #\#` @ Ѐ w  `L  H"– #\ P@! Ȗ IȖҔ Ȗ <EȀ $`T`L #\#` @ t#\#` @ gЀ w " #\`L  Hx #\@!t m     8 `    $ 0@  "@` G>   ?# ?H /f * ' >  $ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '>  ܒ`" 㨐 '#@ #` > cp" > # L  0  @ 8' ,'E'  "  ` ' @˘ `@ - H L $ T#\#`  H@ #\#`  H@  vÐ   L v Hm   @ "  ` ' @  :6  L   @ "  @  v;' L `#\#` @" 3 L $ T#\#` @ 3#\#` @ & vU  L  H"  @! `X ` ҷ $ T L #\#` @   X  4#\#` @ ٘ v  L  H@ Ș      8   4`    $ 0@  "@@  G  ?#@?H /f * ' >  # "H 0 2H /f * ' > b` 2`H 0 """2"'"  '`  4 "`  4 +'`: ` @/ &@&``: `@% &`&` ``  ;`@; &`&`&``&` &``&`(&`$`&`0 &`,&@`&`` &``&` `&` > c" > # L  0  @ 8' ,'LE'H  "  ` 'HLH @D `D@ - H L & T@<#\#`  H0@ ٚ`@<#\#`  H0@ ̚` t  L L v H L  H@ "  ` 'HLH @D D 8n  L ,L  H@ "  HL@+  tߖ'H L, `#\#` (@ ͘ 3P L & T@<#\#` @ k0`@<#\#` @ ^0` t @ L  H"  P@O< ( (@<#\#`& T  @ 50`td<@.@@    8 `    $ 0@  "@`/ @G   ?# /?@H /f * ' >  !p "H 0 2H /f * ' > b` 2`H 0 """2@"'@" @ '<@ < 0" <``0' c;"  㾰> # L  0  @ 8' ,'LE'H  "  ` 'HLH @D `D@ - H L $ T@<#\#`  H0@ l`@<#\#`  H0@ _` s  L L v H> L  H@ "  ` 'HLH @QD D 7  L ,L  H@ "  HL@  sT 'H L, `#\#` (@` 3( L $ T@<#\#` @0`@<#\#` @0` s  @ L  H"і  P@<ʖ  $ (    (  P( P( r{( $ T L @<#\#` @0`@<#\#` p@0` r̐  L  H@@< u @    8 `    $ 0@  "@` @G> >  ?# ?@H /f * ' >  ͒ "H 0 2H /f * ' > b` 2`H 0 """2@"'@" @ '<@> > > ><`" <$ '<" ""ad!l"" "c > c"0 㿀 L! ,  & T#\#` @ `#\#` @耤` r  L 2 H 㿀 T ,  L & T L  #\#` @ǘ `#\#` @耤` q  L 2 H 8`2 < X <`"  @ <    2 @&  @  @mn  ,`  / @" 㿘`$P P T{X P R $\  2H /f * ' >  Ò "H 0)>  2H /f4 * ' > b`$ 2`$H 0 """2 "  " <  H /f * '   "H 0 "   4 H /f * ' > b`" 2`"H 0  $ $$ 4   $  ** 2 " {ސq  tH /f * '  < "H 0 2H /f4 * ' > b`$ 2`$H 0 """2 " "   5 "`\ M 90+| 'H /` * !  &8`$ #> c>   6*b` `"8 2 ``<@  2 8`>   48H 00H 0 A>  *@ 44z4z4T  ऀ@ ! a !ऀ@ *  a" > c%"h `"C H /f * ' >  { "H 0  4 H /f4 * ' > b`$ 2`$H 0  $ $$ 4   "@ ?$ c  R `2CࠑH /f * ' >  6 "H 0 "   4 H /f4 * ' > b`$ 2`$H 0  $ $$ 4   " $   !a* *p #> `> >x @!L@4@Z4x* $l$$$x$t$p$$$$| $ ?4H 0@/㿘 %> @( #> c?D  b`  ڒ  > >! `" `2@`$ @"`$@`2` 㿘 P & P֒ z㿘$ "oQ D P 2 ? @&$oG : &$\ R    " V` @? ` { !> c bx $$  @  &$> cb $ ? # 2 `>  &"@  T " P@B <   $`@k 00 P`@%> 8  沒  o``$` `   ?? " @F 0  $ @2 @?  s}x ̖А  ''?''''''آȲ @'Ȑ   }R #   # $  #"'Ȁ 耢    " > cb  $  w *@  ! ' > c > cb $  b ' @'Ȑ  } #"'Ȁ "'Ȁ?"'Ȁ L耢H> c  b̘ " # > !'''آĀ !Ā Ȓ 'Ȑ|Ā`n4 #   # $ @ #耦 "Ȁ  > c%#(  " " '̀ J H?G n   & > c c0#  @B 4g " @n + 2. ,    А"@'''̤آ'Ȑ | # $ 倦 #"'" '̀ m&@ 㿀> 8 @F  @l  @d  ? #\ P2 8$` "m  '쀣`' '  @\䀢 mx$> >!X  !(`mk%!($> >! `> 81> /#  ` 2@` 2@> /$` $`耢`^$`> 8c * * " `4* " `4 *`  dl|?* l|`:`@ `  :`* l|`:`@  ` >  `4*` ?*  `4*` ?*    d  h` $ (`$ "`8"@ #`  ?"@$#4`$< @@@䖒 $$`$ ?$`$$`$  `4* `*` l `8: #@  `# `4* `*| :`#@@ " $`2Y` ` @!$`l%!$ $2 $  > c!#X  0> #'D X'H'! \'L`'''X ߰ @H$ <D L   $ $ $ 4` ` @`' $)'Ԑ '̦@l   ̐Ԗ@" ̐#\#`Ԙ@"* 0 lNH> W    *  '̔#\#pH#d#h#`#lА@ LԀ`   T <L```"`8```$"  `?ܐ" 4 `?"  `` ?`$`$`  lL `" `` ` $`` ?` "@L$ ē*`$ '/> >->   eh$ (> / $ ,`$ 8 $ $$ $> 8 a$  "aH /` * !  `$$ ""`P =T  (@0H 0 \ @ 沔  lJ`6P\`@   $ @ !$ $` $ $H 0 ?$ 8  H /` * ! `"  "` "  "H 0  $` $ $?$ 2   $ > c <`@h   ' '   "    ' @ 2> >!D@ !> >a\2 -$> >!p 2 2  PȐk"@ k  j0$   #\ؘ@!    ?@ " 6   @9 0.'  @ " $ ' @  o  @ " $' @ j0[F"& #"Fj @.`)> '> c  Dx  @ > / h0``F2D" X"@"@ " j^j\ 9 > X"@" jN"+   jG +jD ! > # > c #㿈\H /f * ' >  f "H 0`")>  4`H /f * ' > b` 2`H 0 `$ $`4`$@$`$`$` > !  &H /f * ' > !' "$`$H 0`$(` $`4`$`0$`($`,$`<$`8> !@ $ $` `> >`X &X &I > >> >!D&   > >ap.& &` ??$` > >!\ & & &!T&`L @ `@ *  L > >`@2`<     @ ꀦp> >l?'p h'&&& `  `8` ``$`0 `  "  B `  ?$@ 4; H /f * '   "H 0 2H /f * ' > b` 2`H 0 """2 $@$   $  & &&& &J KHst Ljn & &  8` $0   " B   ?$ 4; H /f * '   "H 0 2H /f * ' > b` 2`H 0 """2$ $   $   & &n  k& h&f&  8` $0   " B   ?$ 4; H /f * '   "H 0 2H /f * ' > b` 2`H 0 """2$ $   $  @&&`'@%@` "> 8`a "a 㿘H /` * ! > >! )> > 8    $ 2 <@ " 8 $ $ $ ; $ 8h2"d 4> / *` d *l |@ : :*l |@ :` > / h* -ѐ  8 `4 $`$ $  ,@$  (> c <`@ $` $ $ , (@& T  $  $`r$ $ ` dl$ , di$ ,P`e?$ 8`|`"@``" 4    &W(2   $ 2 @6J 沔 h  "A  `    @     `@  )?' #"&\ "!4`8  $`"` ,  $ $ d$ , d$ ,:  $!$ਐ $$ $!$$ 8 2#    : 4`, @,`b2*@ *@ b 2`* @ *`B*2*> >@ ;tB H`"@8 `8@2HH 0> >!L`"`$" @" 쀢` *@!(  㿘 `  `@`<*  !)  @@!@'> c`͔  & 㸖 !2>   *`@@2`@@& 㿘@@*@> c# & *&k㿘  *`@! '> c  < "  $`ؖf a2>   *`@2  $ 㿘@*@> c# & *&(㿘> /`  "`k > "  "]H /f * ' >  N "H 0` 4`H /f4* ' 4H 0 `$`$@$`4` (+$` H /f * ' > ! "$`$H 0`$ (` $`4`$`0$`($`,$`<$`8$` 2 `> /`  "` g e&P`0`@`,''   & ' ( ' (@ l > >$`XP 0   &    ' @ O $`T$`L> >!H@  I> >!@@  J  K`2 $`L`$`D `8 L`L ` L2 `D> /b`* @$`D!`L> >a< ? $`L   ?@ & 6 @ { 03'  @ &   ' @ ޘ `@ P $`$`$` f  * @ &   '@   6`4*"4 *: `4`@`!2 '  ?@ & &'@  0> >ah   x ?  ``&`&` 'd H   Ж`!?''''Ԁ 'ܔ@   @ &  ' @ = }h  > c>#`  @ & ` ' @  Z  > d  `a'  &a`L`@$`L` &` > d  0v`  @ &  ' @  %h  > d HQ`  @ &  ' @ ˜ cސ0P' @'` *   L``5> `2``< ``    @G` 뀦` >  `h@  `l@ ``pĀ@ `&`h` $`D$`T @``L  $`L  $`D$`T  $`0$`@㿘 " > d``- h`0`V H'`$ 沐`p&`0沒 "'̖А'Ԕؘ r̖ #Ѐ 2` ##`0%   "`8" $&`&`8 "&`  2&` @L :`0 5&`0 2&`0沨"ؤԢР̐ '̒' qƚЀ`Ԁ " `( "&`$" &`("   `#2`0Ѐ ِ  `$ `0 @㿐 0 " > d( x$ 0 < G 8 $ 0    &j   `?& &      *   `?& &   8* ?$ 8$ < 0  0 ?$ 0 < !@ G 0 8   $ $ $ <@$ 89   /  @ "@ c5 $  < "@&  < ""@&  < 0 #  $ <@Ւ 8$ "$ 8$ < 0 ?$ 0 ,  ,@@ 2@"@ 0 "d < (` ,"`$ $ ,$ ,X$ (㿐& 0 "6 7 $`'0 7` & $"`& (R`   @'$@  : Р ($ <$ ,$ 0  $ @e &&a bݒ 㿘 0 #> >!" 0> d  ? `"+ D `& D" 0 2 0> > & 0`"㿘> /`> > 4(바 > >"a0> >!4"!4"`㿈 <  > >w > d,   Ø > > X a(2  > > a0*  p'> 8> >!4 X @2e   D 2`       8@  "T   2ΐ  ` ,  "` "@$$ "@$   > d 2 a,  ($a, a4 $a4#\#`  &    a4 $a4  b & a0  $a0,    ,  , 10 2 X> / 8#> >a,` "8 4 L @& a,  $a,, %> >> >!4  " #> d ,  `  4     ,  `"  "`   "@`"  "`4"  " " `   @"T H /f * '  > R b`*@ ?2@  `  j   `"'  8 ` <"<  8 <"`8> $! ( "4,$0 Պ$   2  "0 > @ ' H 0  , $4$ "@" ,  X$  8  `  ,  $ 沐 @,  8 a+ $  F4  Xa(2  !0 * ` $  X 2  * "`  Xa(2`@!0 @ *`"  X2  * $  ,  , > 㿘 < h X> >a(2  > > a0*  [> /!> /> /ah"#> d X @2M   D 2H       8@   "<    ` ,     X  , `,  D*  `"  L 2  * ` T $ 沒 ` $ `,    ,  , Ԑ0 2 X㿘> >!4"> >!4` "`  "@`"`$`"@ ԛ 4 2> >"!,㿘H /f * ' >    "H 0  6 H /f * ' > b` 2`H 0  & && 6 (& H /f * ' > !  "& $H 0 $ (  & 6 & 0& (& ,& <& 8 & &㿐 'D ?'L'`hpH /f * ' >   | "H 0"5>  4H /f * ' > b` 2`H 0 $ $4$$$$ `( & ۑH /f * ' > ! > "$$H 0$( $4$0$($,$<$8  " ?@$ $$ `  ` `8` `$`0 " ? %@ 4; H /f * '   "H 0  4 H /f * ' > b` 2`H 0  $ $$ 4 $$  > /aТ  $ ` !> /!Ԁ  (b $!'%!!> >-> >('b!> >-> > `&!А %!!a&$@!P`$@H`$@`$@``  $@``L$@L> /"ȓ* $@`$`$@8   8 ` $0   " K   ?$B $@ H /f * '  G "H 0  4 H /f * ' > b` 2`H 0  $ $$ 4  ($> d $  $ $@@`$@D``? $@D`?$@`$@ `,  $@```> "  8`" $0  @   ?2^H /f * '  Ȓ "H 0  4 H /f4 * '  5 H 0  $ $$ 4 `(&$H /f * ' > !  "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8 `" $0  @"   ?$ 8   &@$ @`c &@`$ $ ,? $   8` $0   " B   ?$ 4; H /f * '   "H 0  4 H /f * ' > b` 2`H 0  $ $$ 4 $$   $ `\ $@\``$`> "  8`" $0  @   ?2^H /f * '   "H 0  4 H /f4 * '  5 H 0  $ $$ 4 `(&$H /f * ' > ! } "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$$    8 `" $0  @"   ?$ 8  &@$ `c\ &@ `$,? $ $`$@ d$%`l%`"㿘   @$P%` $] @`2`W @@`*0"L H "@` C``` < B#$@>`&`$`@@`8@``?&`&@"@@`""`&4`&&6 @ܖ&㿘  > d!`? %@̬ > "     8`"   $ 0   @"   ?$w H /f * ' >  j "H 0  4 H /f4* ' 5H 0  $ $$ 4 `"&$ H /f * ' > !5 "$ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8$ %      8 `"   $ 0   @"   ?$       N     $  <`  B#$> & N&"`"8"``$k    ` 8``   $ 0   "@ E   ?$@< $: H /f * ' >   "H 0  4 H /f * ' > b` 2`H 0  $ $$ 4 $ % ` @*@` $ &  &' 㿘 & &@&@'@o l H> dI! H /f * ' >  7 "H 0  4 H /f * ' > b` 2`H 0  $ $$ 4 $ $"$  '@Z&@  " H   G ' @"$ $ @ 40$ & &@   "   H &" "@㿘      8 ` $0   $  ?$ ?@"@ ` $    &$ > "H /f * ' >   "H 0 4H /f4`* '` 5`H 0 $$$4(&H /f * ' > !R "$$H 0$ ( $4$0$($,$<$8  0  $ $  "@ `?$      ?"@ m&$ }&  &@ 㿘> `> >?a > > > > > >!> >"`3> 8%> >'> >)> >+> >-> >/> >1> >#> >$!l#H h#a@&c$P$X%!D%aT%\%p&!<$ad d@N !> > $!L$!L@ ͐ !> q> >! "! "`"h>c~"h㿘> >!> 8 L"? 6"b"b"  㿈 DX@!  b"  T E쀢 `@> /`' ``+@`D*``,`'`H @ %'@> / b * @`< > % 2`  ``4'`8*`" *  * ''􀦠2<" <'ఀ$<> >!$8<? > >"8X$8ϒ > $ $$ $8$$&$$(( /6 & D`& ,& 0X`d-& ` "6 `  & ` & ``     @ > & ``       > H`8& `<& $`@& (`L& 4`P> P& 8.& @` 6 ` & `& ` > `& ` : 2* @* > H`(& `,& $`0*`" *  * & (& (& @`< & 4& 8`@ > P& <  2 @ >  2   8 2   @( >  <@SD> <>  $ `$!"&$&(" &,&0 㿘 > `  X!`#`@" < 2` 2      > 8``  D"```( "` ` 2`( `@ `( 2 `  8 `2  ` @( `<  <``@R`<` ``$!"`&`$`&`(`" `&`,`&`0 㿈\$`  $$ @  @@" $ "{ H "K  /2 m `@$  ,@ @`'@ ?",@& &  2P  $@$ #\$ h0 #`@ 2= `<  3  `$$ # !$ d$  2   @@`  Y  $@d$   2     +" ' (0! , " "   ( #2" 㿘\`@c@    8`   $ 0   " C   ?$ 4< H /f * ' >    "H 0 2H /f * ' > b` 2`H 0 """2$  $  > >ad $ #@r    8`   $ 0   " C   ?$ 4< H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2$  $  > >al $ #@` #@#`,`#@0#`4`#@8#`$@'@@㿘`c    8`   $ 0   " C   ?$ 4< H /f * ' >  @ "H 0 2H /f * ' > b` 2`H 0 """2$  $  > >ad $ "f`    8`   $ 0   "W C   ?$ W4< H /f * ' >  ߒ "H 0 2H /f * ' > b` 2`H 0 """2$  $  > >al X$ "@`X&'㿘V`&`& ` & L 0> /@* &`? /&`&`&`H&`L& `F&$`D 3`  &(&,`&4&0`&8`$&<`(&@`,&D`0&H`4&L`8E&P@> /aؑ* @&@`2> %> %!` *`! ` &`&` &@ ?`D&`H*2 @ & `&$`&(`$&,`(?"&0@˨#&0`,&4`0?"&8@˟#&8`4&<`8?"&@@˖#&@㿐>  \&`  2 a F`0 2X `   O` ` 2`c R`` h`+0"811  d ` &`&R 66     "R   6   $$` T      @  H( ``X2 `p `d00 0`2`XH  L`S D> 0P(R   P?# @ > /0  ( **" **  㿘@ P &@  &` &` 6` V 6 V` `   " V V` `㿘`>  X !`@x" < 2!!!!`     㿘@;  @27@> d!P!   8 ̀@8 Ā 2  2 &  & &  @& &s  i Q & @2= #> d @2 &  &@2# @> `@  Ē!a`\  ?2    2 Җ @  ` "`  "@`"`& "@  32  #" 㾘г i> >a "@ '> >#> d!t`$! ap  !`t@ K N!6`  G D'''''  <@ " X ^a쀦 1 @ @' $ `@ 7`  s  `'s%    0" 0`, 舐`00@ 0" 0`, ဦ x`0݀ ` | @ À   `0 "@@Ғ *  L    @2  <      ْ  逤  > 0!`@ 6 `0 $`@ | 3_ `0   3~@ ` `"  "`   "@` "`$`  "  Q   $  PT $` 4 $ $ l> $ lpx$ p  xt  $ h < "$  `   $ ` $ 沐 $ Ḕ`< Q $ $` $ ` "@$` @ *  L` $ @ *  L "` @ * " L@ *  L@$ Ḑƒ``L @"`L@ " `"` $`@ ? 㿘(` R`   > >!|0`"T@Pڰ T@  !!g7 "T@P}0ɀ 2B` H /f * ' >   "H 0 2H /f4 * ' > b`$ 2`$H 0 """2 "@ ?" cc$ ` `2E`xR 2A`xH /f * ' >  b "H 0 2H /f4 * ' > b`$ 2`$H 0 """2 " "  bܔ `x4`z`  ?4`x4`4`  2!@ߒ!$  $ $> >t$ "@"$ $   $ $ H /` * ! >!p$`$` $ 0H 0 㿐'L'H'   H /`   L Q`?"`* ! L  4²!&@ȋ!L%!%> >% "@"> 0a "aL`  #``, 2 @ L  2  #> >!`!> 0#> d !`% $!!a e ! $!  " 2 > >!`> >!t``0 ` 2@`D  $`0$`D% `2  ?$ `" `0 W  @ ?`4$`0 Z`똔 芐֐%> :`4, ,@c3`+  +` b 2* *> 횃@``C%> 3`+  +`< B " `H`" @8  2 `      %  `0   " á 'H 0` `  `V@`4􀢠E> ` "\``"``< "`"`8  # ?%  8`& &\!&d`  2 h!! 2 H | ޴  췔   ?%  "`D "T > 8 >  H.< 92 ! D`> /> .#` !  D*` ! !`'!  < " N+%> 8 Dd+   $ " , '> /   !@  > d!> dK!$ :$  ``"  8 `  $"   ?ܐ" 4  ?"     " " N)  "    "   $   "@  `0   < cM  @S <`"X ,H /f * ' > <bR `*@ ?2@ <`  W  < `* 8 ` <"<`<8<" 8> $s!( "4,$0K$`< ?2`<" 0> <X H 0 ,  MQ @  ?2! @UH /`* !t > / `@̔ M'`,M$`< >  '> ``: 4,@,b2*@ *@ b 2`* @ *`B`2*`*;@ B H /` * ! `H`" @8  2 `   H 0wH /` * ! ꖔ "Z   % @% R L?"`"  "`> >"! "@H 0 4> 0a&? "a@ѐ 㿘 0  ? & 0 0 $ 0&    _"  `PH /f * '  > R b`*@ ?2@  `  V]   `"'>  8 ` <"<  8 <"`8> $O! ( "4,$0 '$   2  "0>  7 H 0L5 L3 $  ! ` "`   "@` "`&  " L  3`2 H /`4 H* ! H  "$$$ $$ "@ ֒  2 & HH 0㿘 D? & D 0 `"  "`> >"!x "@ 2㿘> >! " > d !p$ጀ #> >+> >/> >)> >-> >at at 0 ` "`$ "@ 2 2 0at$at$ ጐ `$ጐ $⊐a" %aတ ?%န  2!%!|@Ć!!|`"` "` at "at" $ !|at$at" !  2%@m!" "" " "@$ > q* (      2 L@" D@ @ D ` 82 ` `>  \"*  `( ` (`"@ ( ` ` `"   !"㿘> >!`?      ᔓ+  2  > 1 *"  `` " %``, '> 8@'> 8 e c`> >!%> d! $@  `R ! N`"``"`" ``"@`0 :?!`\H o *@ e  p    0 2 qѐ 0 $ 0   0 @$ 0s \`t "`tH 0 2`\`2` ``?%`"&`㿘> X` T 㿘> >!  > 0, `2  ,  )ᴐ  8 " "#>!> da  !? a  > >!, @         , 0ᴀ 6"ᴁ㿘\@ %#> d>  @&*  a) `<> F@"> *@&  *!&!& & &  & &  2 2 ;> d5>  * a `<@ `  *@& P "   *@&' ̐ `$ Z * @ & *@&ૐ 㿈`4`> d! C@Ґ*  耧`> `2``> `h 6@> ``"`& `@"@'@ '` "@&     "`t & &" '`l``   `  `p` ``'`l`'`p`'`p`l '`p'' '' x @'\ '   "  ` ' ܀ ܢI7~@> `'@ '`@, a,n> 0! ܀ 6   & ܐ | 3< `"  "`  "@`"`& "@&`&x&h &l&t &p& & "@& `@ C*  耢` &`@  C*  "` `@ C* " `@ C*  &    " @  ' % H''@p L "' `   5 @> 8@> 8``  "`  D ז '`R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  j "H 0 2H /f * ' > b` 2`H 0 """2 > dA"X"'" '? @" '`R`#  "` R {u W nGِ0,`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '`  #\#` Țఒ "  . #'  @ "  ' *ܖ 9  ؖ ǔ䖒 -؀  F耥   @  " 3 0  4''  4ܖ G 0b&@ࠀ 8 8&`"&`     @ (0  &`      @  0 ( &`     @ aC 3` +  &`c &`$  &`&`&`  &`&`&`&`D@ `T S Z` O ZLa K X `D`@J Fqp> 8  `"   D`R ` ?'`  ` `8  ``$`0 `  " ``  ?$@~`4|`     8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > dV"X"'" '? " `@'R#@` #?` R  S k E0#\#` E䰒 t .'  @ "` ' 멘 $@   ܒF薒 䀦 M  @ "/$0 ' 0뇘 E 08@a >$  $$@a >$ $$@c <$: $$ $Ek> #> '> `;  <"Ȑ@X!(> dbhS? > d"p> d b@!> @$ > d"*> b\&& b\  "\"\" `h  > da"@+> U`x> ap %> d> dT"?> d":d> dc  2*> d> d c@4@ْdd "`<d?"@d$$ `@c > d͐#*2 @> d#8Œt$#H$$$  > d(#` 8> d#p > d#x<@"<@ X    j'''''' C  @$ 4 @ݖ > d#Ԓ㿘H /` * ! ?` ` ` +@ @  @ &H 0` 0 `, +%> >#> L@` y @  & dL@` d@6``@L& dL@* " d*@@* "@*`& d` " ``0  d& h d& h`"`  ` " `  > & "&   @   4&  @ 4& ` " `$  > & "&   @   4&  @ 4& `@" ``(  <# & $` "  &  4& ` " ``4  $& `@" ``8  $& `@" ``@  $& `@" ``H`?#@$`J6!`@" !`L`?#@$`N6!!! 86!`@ `P`?#@$`R6!`@" !`T`?#@$`V6!!! 86! P "   T 2 %> d#>  !> dUА`D # o ѹ  &  &$ &( d&, h&0 &4 &8 &@!&H!&L!&P!&T0> #' j  2o   H_ ? ` K XU * V'> 0a 6 < "a  <@@!쀢` C @ b '!Lr8 @3 ( 2- Y̖ 2$ Z$@0ܒ Y 2$@֐@dW  2 '@  > d#㿘`<@@ B_  Ґ!@!&a$``$`> `> >L@M$`    $`h$`$`$`$`$`$`$`d`$`$`$`    < $`L4a4a4a4a` ` ``@ ` Z`  ZaL X$``  `$`X$`Tп &`L  7 BU㿘!6` @$`%> #> e D` O  `  *@$d @$ÐB' `$   㿐!`Ls`  `&@㿘 ` $ X2` 2 d p `   2t d 2 X -㿘`(7   $ -002!L&* !K!L&$ !> 8 !L  aL   !LG > 0!> ;     - -Dܝ㿀 ے #\#` 谒  .Azp` X`  b<  ` <    ` `> 8``P"`P  Hᢖ R ` ?'`  ` `8  ``$`0 `  "  `  ?$@~ 4|      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  8 "H 0 2H /f * ' > b` 2`H 0 """2 > e 0"'" '? @" ' R`#  "  RI S $ @0    8 `    $ 0@  "@` G`   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '`  "` `  '  <@  2 @2  #2 @2 #` `#\#` Ӆ䰒 I .'  @ " '  @ 0.   ܒ烔薒 䀦   @ "  ' Ę  2 ?0@X'8 `<  ``> e @d    ! "  $!@ "@  " ! " u $!@ "@      ": @;B$ `< 2   <     (#$    " Ā@"$ `< 2   <    ~   @;$ $  㿘   < #    X!@     @Uw   4    ~ $   ? 4  x X!  ` "3  А > 8G ``D  "`D  D d 'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$}S 4{S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eΐ 0"'" '? " 'R"@` #?R u   "n >g0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >  y "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '   #\#` V䰒  .   'm = 0=㿘` `  @? - ? ?2X $?2 X ,?2 X ?#@" X <`y  ? ?"F ,<?`#># *` €e  ,?? $?? ?#@ ??2 ? ??N ?5< X <`F  ` ` ` |  6   <@@94<`?2< $?"`<  ``  |ט  2` `` @  ?2< ?<@9<@pX> 8!H  "Hb  D  < r'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eܐ 0"'" '? " @'R #?Ru  n  醒 "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  ' 8?`#@l    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> > 1> >`" l ' `i     8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  謒 "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  `" d ' `?k    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  A "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  " l`' `g     8 `    $ 0@  "@` G   ?# ?H /f * ' >  ؒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d ` ?k    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  o "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  " l`' ` g     8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d `?`?"o     8 `    $ 0@  "@`  G> >  ?# ?H /f * ' >  晒 "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  # al ' ` `f    8 `    $ 0@  "@` G   ?# ?H /f * ' >  - "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d `$>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  ' `$ `(     8 `    $ 0@  "@` G   ?# ?H /f * ' >  U "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g     8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  ' `,>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >  䂒 "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  ' `, `0     8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g     8 `    $ 0@  "@` G   ?# ?H /f * ' >  㰒 "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '     8 `    $ 0@  "@` G   ?# ?H /f * ' >  K "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d     8 `    $ 0@  "@` G?  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '? c " ` '> >!`<`> %> %!@ *`!  $`?2$ > >!`$ ` ?2$ > >!`$ `$ `$$ `(?"$ @#$ `,$ `0?"$ @#$ #\#` ȏ䰒 "c .Q  @ " '  G> >!l   @ "  ' ٘ .'  @ " ' Ę    ܒa薒    'ؒVؖ 4ɰ 04 X  ! *@    %  " &@X <`"<?  <   ఐ'xb  v 2&@   `o " &@*@%    @ 2&@@s&@sj&@2@    @ Ȱ cx7"    #` @ > 8  `"   (%   @   cV@r&@s&@> 8    L`" " L  ? $ H `'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eʐ 0"'" '? @" 'R`#@` "ఒ Rt  m`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >  u "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  ' 2 ? ?      8  `    $ 0@  "@    ?#| 4z      8  `    $ 0@  "@ P?  ?#G?DH /f * ' >  ے "H 0 2H /f * ' > b` 2`H 0 """2 > e粐 0"'"  '? @# '#@` "  ʒ 2Lq#\#`   Ţ .a ,''|  @ "` '  @   |٠ |27!   @ "` ' ܘ @``@1 H` ?@ "   '׺  x  }R`2 X`@ 2X1 0&ux VxG 't  @ "` ' ׁ @   t t'p  @ "` ' _ o@  p c p 'll Xl&@1b ( %  2 @%  R`^`@? WoǐG'h  @ "` '   @   hح h'd  @ "` '  @   d؋ d '``؀ ` Ɛ +@% XtAx  ` y *@s% xG '\  @ "` ' ֟ @   \< \'X  @ "` ' } @ X   X 'TT vT  [ 0un0 *@r% XsŖx x0b0ȀG 'P  @ "` ' + ;@   PȔ /P'L  @ "` '   @  Lצ  L 'HHכ 0 3H 2  ڔ @%   "  (%  @"&@ x 2 &@x\"^y&@/@` @` `` `T"` ^]`" n@     X`< ?  "&@ (% &@㿘 `< 2    l& 㿘 `< 2    l pX> 8!T "Tb  D ϸ 'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  K "H 0 2H /f * ' > b` 2`H 0 """2 > e" 0"'" '? " ఒ@'R#@` #?ఒ R\u` 8 "n`.0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >  ̒ "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   # ఖ ' `#\#` 䰒 " R . "'  @ "` '   5@   ܒը薒 )䀦 )  @ "` '  @. H0 얒 - 0-pX  `` = B " 2 -0.-԰ H0*-а 0& $> "> 8``X "`X , P 'R`   ?`  ` 8 "$0  @" $S   ?$${S 4yS      8  `    $ 0@  "@ L?  ?#C?@H /f * ' >  ڙ "H 0 2H /f4`* '` 5`H 0 """2 > es 0"'" '? @" 'R`#@` #?ఒ Rs Ӊ l- 0a  8`"$0  @"  E   ?$ =H /f * ' >   "H 0 2H /f4`* '` 5`H 0 """2"'"  '   #  ';     8 `    $ 0@  "@`  D  ?# <H /f * ' >  ٶ "H 0 2H /f4`* '` 5`H 0 """2"'"  ' ` "   '`#@` #`#`` #@`#`#@ఠ#\#`!` 䰒 "| .9'  @ "` '  ;@   ܒӌ薒 0܀ &  @ "` ' ͘  ` 'ؒkؖ   @ "` ' Ѯ @   +% 2      > 8pX !'P P "`` =B'L Ͱ  + L> "5> > 8``\ "`\ࠀ  ? 4 X ˺'R`   ?`  ` 8 "$0  @" $S   ?$$zS 4xS      8  `    $ 0@  "@ K?  ?#B??H /f * ' M "H 0 2H /f4`* '` 5`H 0 """2 > e' 0"'" '? @" 'R`$ #?ఒRas = l*"L  8`"$0  @"  D   ?$ <H /f * ' В "H 0 2H /f4`* '` 5`H 0 """2"'"  '   #  ' n    8 `    $ 0@  "@` C   ?# ;H /f * ' i "H 0 2H /f4`* '` 5`H 0 """2"'"  ' " `' $` $  $L @$ h$    8 `    $ 0@  "@` C   ?# ;H /f * '  "H 0 2H /f4`* '` 5`H 0 """2"'"  '  " ` `'$ $ $ $ ఢ#\#`!` Ӛ䰒 " .   @ "   ' 4 > >!l   @ "  '      @ `?'  @ "  '    ܖ Л薒 ܀  b   @ "  ' ט mg 6@% " "@;` `` b >`&`` `2 " #2 А] %@  P "L   'ؒ5ؖ "؀ `T"`(%!> 8L "&`hX ! ` "D #g   -> >!`> 8  l`" l 0T  < ȷ'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  J "H 0 2H /f * ' > b` 2`H 0 """2 (> e! 0"'" '? @" 'R`#@` " R[s 7 "l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >  ͒ "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '  'L ?  ?      8  `    $ 0@  "@   ?#}4{     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >  2 "H 0 2H /f * ' > b` 2`H 0 """2 > e  0"'"  '? " @'#@` " D   & b    8 `    $ 0@  "@` G> /  ?# ?H /f * ' >  ӱ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> /  " ?*`  '#@ l    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  B "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> > 1> >`" l '#@i#`    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  ؒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  `" d '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  p "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >    "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  Ѥ "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@$>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >  7 "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#@$`#@(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' >  ̒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  e "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#@,>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#@,`#@0#`    8 `    $ 0@  "@` G   ?# ?H /f * ' >  ώ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  ' "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#@?     8 `    $ 0@  "@` G?  ?# ?H /f * ' >  ξ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '?  " F`'#@D 2  #`    8 `    $ 0@  "@` G   ?# ?H /f * ' >  Q "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' ` "  `'> %! > %!*`  > >!`$$ $ $ $$ (?"$ @l#$ ,$ 0?"$ @c#$  #\#`  䰒  .   @ "` ' m @ D!  @ "` ' Q @  @  e Hۀ    ?@ "  @ '. Xc  /  @ "` '  "@@   @ "S  T| T 0~'耦 ؖ 'ؒǒ薒 s؀ "^  @1t  d  @ " ` ' Ž G> >@!l    @ "` ' ţ - ` @ `?'  @ "` ' ń @  В!薒   Ѐ䀦  "^| @N&@V ` 2`" ^d㿐   ^Wh` `X  `' b  ` ` 3X 9> 8(  ``" `  (L  < |'`R  ?     8 ` $0   " $S   ?$$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 (> e 0"'" '? @" '`R`#  "` R s   "l 0  8` $0   " H   ?$ @H /f * ' >  ˒ "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '`   Ű ?  ?      8  `    $ 0@  "@    ?#} 4{      8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eΐ 0"'"  '? @" ' #  "       g f    8 `    $ 0@  "@` G  ?# ?H /f * ' >  v "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  z' #    8 `    $ 0@  "@` G>   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> `  "`  `'`H> t#> t"#  "##?#@l    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  ɒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> > #> >`" l '#i#     8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  ( "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  `" d '#    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  'ad#    8 `    $ 0@  "@` G   ?# ?H /f * ' >  Z "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  'ad#    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  'ad#$>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >  LJ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#$ #(#     8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g#    8 `    $ 0@  "@` G   ?# ?H /f * ' >  Ƶ "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#,>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >  I "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#, #0W#     8 `    $ 0@  "@` G   ?# ?H /f * ' >  ޒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' >  w "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' ` "  '`> %> %! !*`  > >!`$$ $ $ $$ (?"$ @-#$ ,$ 0?"$ @$#$ #\#`   Κ䰒  .   @ "  ' .  `D!  @ "  '    @ & Hۀ    ?@ "  @ ' `XZe  /  @ "  ' Ϙ `"   @ "S  T= T 0~'耤` ؖ 'ؒS薒 s؀`" U    @(5   d  @ "   ' ~ G> >!l    @ "  ' d - `  @ `?'  @ "  ' E   В薒 U  ЀL䀦   # U2     2   @D`"  `` 2``" U 8   `<  `5 `D ฀ $  r| 2W $E   Ul    @$ "    ฀ 2 @'  T$TŐ㿘   @ pX> 8!p ?`"p"  $ H  'R ` ?     `8 ` ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > ef 0"'" '? @" 'R`#@` " RؠtS { l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '- # ? ?      8  `    $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >  w "H 0 2H /f * ' > b` 2`H 0 """2 > eN 0"'"  '? # @'#@` "׊  f {#\#` ?䰒 " 6l . d  @ " ` '  G> >@!l    @ "` '  - ` @ `?'  @ "` ' g @  ܒ薒 w  ܀n` 2`" 㿐   XX @     "!`  X@ 4 "`  D (`   `2`  <  @$n 2` R1 ` #\`#````@6` <`   < BFBDR Q QRR " 㿐` ` #\`#`@`pX> 8! x"``"x  ?  H -'R ` ?     `8 ` ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eǘ 0"'" '? @" 'R`#@` " RuS  m0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >  C "H 0  2H /f * ' > b` 2`H 0 """2"'"  ' `  "`   '^  ?      8  `    $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eƃ 0"'"  '? # @'#@` "Կ   ŀచR   ?      8  `    $ 0@  "@ S`  ?#S`4}S`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eِ 0"'"  '? @" 'R`#@` "ఒ Rt`` m`0    8 `    $ 0@  "@` H   ?# @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  ' `  "`   'ӟ ` ?` ?      8  `    $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > e 0"'"  '? # @'#@` "  ؒ Z`\#\#` 䰒 "6 .  @ " ` '  > >@!l    @ "` '    ` @ `?'  @ "` ' ؘ l@   ܒu薒 `܀   @ " ` '  F@al@   @ "` '  -` ` @ `?'  @ "` ' z @  ؒ薒   ؀`  2` 2`" `" p  `X  X b   > @MQ L    k]> 8``| "`|  D '`R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > e 0"'" '? @" '`R`#  "` R/t   m00`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  ' `  "`   '`м చR   ?      8  `    $ 0@  "@ S`  ?#S`4}S`     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 (> eސ 0"'"  '? @" 'R`#  "ఒ Rt ` "m 0    8 `    $ 0@  "@` H   ?# @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  ' `  "`   'Ϥ    K ?  ?      8  `    $ 0@  "@    ?#} 4{      8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > eĐ 0"'"  '? @" ' #  "     ے  ] #\#`   䰒 "6  .'  @ "  '  n` ܒ薒   $ i   @ "   '  G> >!l    @ "  ' Ԙ -   @ `?'  @ "  '    ؒR薒  Ű   ؀   ఀ`` 2``" " I6 " h> 8Xa h   b"h@   ` `L`(`  < ͖`'R  ?     8 ` $0   " $S   ?$$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  ` "H 0 2H /f * ' > b` 2`H 0 """2 (> e7 0"'" '? @" 'R`#@` "ఒ Rqs  M "l 0E  8` $0   " H   ?$ @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '   1  ?      8  `    $ 0@  "@    ?#} 4{      8  `    $ 0@  "@ P?  ?#G?DH /f * ' >  L "H 0 2H /f * ' > b` 2`H 0 """2 > e# 0"'"  '? @" ' #@` "  ^  ` : 4`?`#@l    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  ʒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> > 1> >`" l '#@`i#`    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >  ` "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  `" d '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  , "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@`$>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#@`$`#@`(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' >  T "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#@`,>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#@`,`#@`0#`    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#@3? ? ?      8  `    $ 0@  "@   ?#|4z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > e 0"'"  '? @# '#@` ",  ` `    8 `    $ 0@  "@` G> %  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> % > >` "  '`!`@$$ $ $ `$$ `(?"$ @z#$ `,$ `0?"$ @z#$ #\#`   ^䰒 "` .`   @ "` '  @`D`!  @ "` '  @  @  Hŀ   ?@ "  @ ' XE  `/  @ "` ' a `"@@   @ "S  Tϔ T 0h'耤`  'ؐؒ薒 ]  @ " ` ' & G> >@!l    @ "` '   -` ` @ `?'  @ "` '  @  Ԓ薒   Ԁ`䀦" @ v̒ ఀ`` 2`" @ڐ " h> 8X  !   d'  ?"db $ H`  <  `'R  ?     8 ` $0   "   ?$~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > ev 0"'" '? @" 'R`#@` "ఒ RİtS  l0  8` $0   " H   ?$ @H /f * ' >  ! "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '= Ȱ ? ?      8  `    $ 0@  "@    ?#| 4z      8  `    $ 0@  "@ P?  ?#G?DH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > e^ 0"'"  '? @# '#@` " Ú  `v ` ?`#@l    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> > 1> >`" l '#@`i#`    8 `    $ 0@  "@` G> >  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> >  `" d '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  0 "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  ʒ "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  d "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '!d#@`$>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#@`$`#@`(#`    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  'g#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >  % "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#@`,>  m    8 `    $ 0@  "@`  G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  ` "  '#@`,`#@`0N#`    8 `    $ 0@  "@` G   ?# ?H /f * ' >  N "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  `"  '#@    8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  ' `"  '#@    8 `    $ 0@  "@` G> %  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '> % > >` "  '`!`@$$ $ $ `$$ `(?"$ @r#$ `,$ `0?"$ @r#$ #\#`   G䰒 6  . `  @ "` '  @ `D`!  @ "` '  @  @  Hఠ   ?@ "  @ 'h X=ޔ  `/  @ "` ' H `"@@   @ "S  T T 0j'耦`  'ؐؒ̔薒 _؀`d  @ " ` '   G> >@!l    @ "` '  - ` @ `?'  @ "` ' Ҙ @  Ԓo薒   Ԁఀ` 2`"  ` " 8    @ :а  <`2  "  8 " n 8p  X   b88 np j > 8  t``" t  $H ˖`'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  ^ "H 0 2H /f * ' > b` 2`H 0 """2 (> e5 0"'" '? @" 'R`#  " Ros  K "l 0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >   "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  '   `$ ?  ?      8  `    $ 0@  "@    ?#} 4{      8  `    $ 0@  "@ P?  ?#G?DH /f * ' >  F "H 0 2H /f * ' > b` 2`H 0 """2 > e 0"'"  '? @" ' #  "  X   4 { #\#`    䰒 "`6l  .`d  @ "   ' n G> >!l    @ "  ' T -   @ `?'  @ "  ' 5   ܒҔ薒 E   ܀< l ` 2`" &U&S6#6! "     'hX!`< `'l   ` 2`` 2`S 2` Ā@2 `> 8``  "``!'d` " Ű  d@wm  .j  "@ "" @b ' $i p'` > ` 'p'$ 't'`'|$'?'x'@ x@;l #@2@*@%@   x@wl #@" ` ˔ ,       @ &``  `p` ?2* `2 @ Ւ  'h` h  l > ֐k0   `"  k'  " "@@""@`"=``2 l > 8`d 2  > 8``  "`  ""`X> "ఐ'`  Ъ  ` "'L'P'' '> 8` "`  D  ̐G 'R`  ` ?`  ` `8 "``$`0` ` @" $S `  ?$@${S 4yS      8  `    $ 0@  "@ L?  ?#C?@H /f * ' >  ْ "H 0 2H /f4 * '  5 H 0 """2 > e 0"'" '? @" 'R`#@` #?ఒ Rt ɒ찒 mK0`  `8`"``$`0` ` @"  E `  ?$@ =H /f * ' >  \ "H 0 2H /f4 * '  5 H 0 """2"'"  ' `  "`   'z y    8 `    $ 0@  "@` D   ?# <H /f * ' >   "H 0 2H /f4 * '  5 H 0 """2"'"  '  " `'#@`#@  ` 2 #@`j#@ #@ `d#@    8 `    $ 0@  "@` D   ?# <H /f * ' >  | "H 0 2H /f4 * '  5 H 0 """2"'"  '  " `'#@`Д` #@`#\#`L Yܰ " .?'  @ "` ' ؖ ]@   ԒY RԀ   @ "` ' ؖ <@' `' 0=  @ "`' ~ؖ  @  @ "@ `  ' gؖ  ` `   @ "` ' Nؖ @`?   "`" (``  5`@@ "@@" "`"@ &``8 3+ @@2 %-`5`-` ` @&` "@`? "`N @$@+@@"@@""`"@&`    "    m 0'  @ " ` '   @ "` ' ؖ b؀ "%@'%`@'%"```@ .   @ "` ' ؖ 4@`?܀ > 8"`"@ 5`@@ "@@" "`"@ &`      ? P " H0 { 0` > ec XX'|'x`'L| # `  'P''''t  'p> 8``"p  \R``  ?'   `8 "``$`0` ` @" `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  2 "H 0 2H /f * ' > b` 2`H 0 """2 > e  0"'" '? @" 'R`#@` #? RC S      8 `    $ 0@  "@` G   ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  " `'#@`#@  ` 2 #@`#@ #@ `#@`x#@x#``#\#`L z < .'  @ "` ' ݘ @   {     @ " `  '  @`' @' `  @ "@ `  '  ` ` І@ t "`" (`'t 6@@ "@@" "`"@ &``8 `:+ @@2 '"`t`'t.6.'t`@&` "@?"@@% % @$@,@@"@@""`"@&`   "     0k'  @ " `  '  V` @'"`@'"``@ `` @"S  T T 05'  @ "` '   @L  @ "` ' Θ  @``@`    "    '  W 2X @n 2X.D '3   ] '?3 '' (> %a*@  2 .|@#  % `@%@  3|``,  @ "` ' O   @ ` "    ’ 0v'.K   @ "` '   [@ `g   @ "` '  ?@`? `> 8t""@  6@@ "@@" "`"@ &``$      ? P " H  ` > eȐ x-̐㿐` ' a m $@-B$``< 2> e - `  4> eϒ  $` ``*`:  z,``@@ ۖ  `@@  "` -`mQ@cf hX> 8!L ?`""L  $ H  'R ` ?     `8 ` ``$`0 `  " $S `  ?$@$~S 4|S      8  `    $ 0@  "@ O?  ?#F?CH /f * ' >  O "H 0 2H /f * ' > b` 2`H 0 """2 > e& 0"'" '? " @'R#@` #? R`s < l0`  `8` ``$`0 `  " H `  ?$@ @H /f * ' >  Ғ "H 0  2H /f * ' > b` 2`H 0 """2"'"  '   #  ' Rw ? ?      8  `    $ 0@  "@   ?#}z     8  `    $ 0@  "@ P?  ?#G?DH /f * ' >  8 "H 0 2H /f * ' > b` 2`H 0 """2 > e 0"'"  '? # @'#@` "K  ' 쩐π`#\#` 䰒 "`` .  !  @ "` ' _ @  @ s H`   ?@ "  @ '< z@`"%U`R` @ '܀ @4 `a+ `R `@ ܀ @ _` "`ܐ͔ 2 2 X`@k 2X* /}ܰ 0P -'  @ "` '  "@  ؖ 薒 ؀ @  0 'ԐԒm薒  `䀧`@  *Ɛ0'@pX!  > 8``"`  DR ` ?'`  ` `8  ``$`0 `  " `  ?$@~4|     8  `    $ 0@  "@ O?  ?#F?CH /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2 > en 0"'" '? " @'R$ #?R S  0    8 `    $ 0@  "@`  G  ?# ?H /f * ' >   "H 0 2H /f * ' > b` 2`H 0 """2"'"  '  #  '$$ $ #\#`! }䰒 z .  @ "$  ' Y R> >!l   @ "  ' @ 9'  @ "  ' + $   ܒȔ薒 䀦 &  @ " '   % 0А@i   !1㿘  "  `X L 2` $ 㿘  0`  > e8  0  >   0 )ǐ * 㿘    @ 8`'`X?!?''L'P*  !@  '  `X!@X V H /d4`p* %`p A > @  0 22Ґ 0- $ 0"@  T:  `3`+ +` ;B  2 ` ( `   ` d"@ @ :`C 8 @      H 0 HP&@!1 `X 7,  0?c $ 0&H /d * % `t`'`t 0$ d$ 0 0? @ $ `$ 0PH 0͓,H /d4`p* %`p Y @ > e 0 * L 2K2H 0  $ 0ؒ`~ H 0 P `a>   *`' 0 > e   0 2  0  0$ 0H 0G40 H 0L `3H /d * % > e-H 0 P a >   *`'`p  _  ?2 㿐   #\  L 㿘 > e !<H8 <`2> eQ> e?!8 㿘 @ 㿘>  0   0 > e!@ 0?! @& 0H /d * %  2  \" \`0 "`0 \`t "`tH 0@  B` T:  `4`,    0,` @ :C d& 0 \ ,3  0@* & 0` 0& d ?& 0& `H /d * % H 0 `!1@` \k`X` ` 0@ & 0F/2  `0 "`0*8   X <`  <        D  2   +z㿘 > ` > %a3 > # `*"@ *`@ *`# * @㿘 > ` > %b3 > # `*"@ *`@ *`# * @8 ` c &> %d4 `D` > %`X <`> %#ڐ !" ' ' ""  ' '  C> %"> *` €㿘 > ` > %a3 > # `*"@ *`@ *`# * @㿘 > ` > %b3 > # `*"@ *`@ *`# * @8 ` c @a > ``$ `*" *  * $  " > ``$ `*" *  * $  $4 `D` > %`X <`> %#R !" ' ' ""  ' '  C2> %"> *` €㿘'@`  0  %@> @  ? `> e!q > eÐ! > e!2  Ā "C   ">  `  ̡, <  (@^ d$ 0>  @Nk " $06 2 `@f @]>!h@  a `@ $`$a'@@N  > e@G> e " 㿐\'` %@ `0 e@> @ 2  ?  @  > e`0"(`> eD"h2`> e?" ".`````̡,`<  `(@] d$ $`.`  `> e`0"`̖ > e" ? ': @M֖ `@]o@a `@ $$`dT,@" > e"g`$6 `2'`<`*`(@]? `̀@#>> ec `$``<`(@]. d`̀@`0> e cH `Ԑ  $`> e#x``> e#>!h@Җ $:`@ X <@ @ 6 `T&?  @ =  `$`$`d,"T^0""0H@^4%@` 2" > e@ @> e"`԰  '@Mt > 1 `' ` %$ }  `@`  P?#> e`, @T d 0@ <: 2 2c&`` d '| 8 -> e, `P " 耤,  |+  T@> f, `T |  T@\f:T@\_:2' Ȥ @E 2  @E{ 2 `*`'x * ? 0?    0'x H @d` *` * ? `@` *` *  2 > f @ |" ?  0 @ H' @[>#P@ '. H ` `T d 0@ x: 2`> fm `T d:@@ "`X> fa  <@ x #\ 0@% $#\@&$ 8 @ x > 1  @ @> 1 ` %`   @ > 1`    l 0 `X <@  ``T d 0@w: ` d,@ "T``T d 0@ : 2> 1> f  `> f  8 @դ @x x    㿘& Ȁ f<@ 2@k,@: @c<@ L @   *@ @ ?*@  >"@ "9 X  @04 `" > f (> fz > f!& &  &f&   &  > f@ .0> f!@԰ 㿘 `,`@Z`@Z`@Z  @`"<`;@d `,`,` cP*  @ 6 `& `&  ` `cP@ 6 `& `&  `  @cI < @: , ``8@ZT & : , `4dd ` `0@Z<% &@Z3 @8  @Z)8 " `,cP*  6& &cL @?  6cP6& &cL @% 6 cP*  6   cP @`5 㿘 `\@`V .? 2J`8`t @  @b``N .?   @b`@Y@Y` `,@`+`@YcP*   6$`  8 cP @ 6``, `X (& * ``*  " `@0 $b`8 `D``|*"@ *`@ @YM*`?@YI`8㿘  "`,. @@6&@  , `,@_   ݲ``,@"   㿐 .`cP@`T'` : /? `8? 4Ȱ `[``V.@ `  `d? , ` d @HbU  > #Ԁ  >      0 $ `@_Z`T>6!`8@"U    :`c `   ?":@ ؘ 璀 `8" # 4@"U   ` :`c `   ?":@ "`T `T> # *`@ ?#@ #*`@  #@ `T>/ @"U.`   ` :`c ` `  ? "(*@* $ $ $`̚`cP?$`̒@` ?"`  ,`X <@ @! 㿐 .`cP  2``02` ``.@ `  `d? , ` @ HbU  " #Ԁ   > `0x>  $ `02 `T@ =0`8>   4. `    `@ " I  L@`@^W`8 .`# 4@"U  ,` :`c `   ?" +@*`8`@`8  $"@ $ $`̗+`cP@ $`̔  " ,`   0W@   B 0L@.` 4!,@"U  ,` :`c `   ?" +*@`*@ $ "$ $`̀cP"$`̒@` ""` ,` ? $*`   `X <@ @ 㿘'H`  `H@W" (8 @]@bU ``@> 2`X ӸP ϰ|g@V@bU| -TT  @"U"X-  E* @@]h@Vϒ95@]]@][/@]V@*@V@,`U` @`@ ,`U`$`@,` @,`U 4 U `@,`U`$`,`U c @]%%`@V. L -`#\ T * T? ?> f!p> f!2T-`#\̐* @T"U`@5 2(`L?2Xe` `:@ $ > f!pv> fȐ!8@Y 6$(w ,`@bU >`@.?@$Ē$ P* "o|@V|i@\@Uc|_@\@\Y@\TP@U* @"U@-  XPC * @?4bU -`TT  ?",) ``X< H@㿐` .`T 6  .@   d?` ,  @ HbU  " h#Ԁ  h.$      `@ @  @ T.``$z"  t" @UW"8  @[`:  l:`*  & *@   p *`    @   A @& @"U)> f # `@  2`!@$ w`*@ @U".> f" @3> f˔"8b0@@A0 㿐 .`cP  2` C``>.@ `  `d? , `L @ HbU " #Ԁ > { 0 $ `@[A  :`b \  ?&:@ X.` 0` ``:"  @"U@: \ @U'  @"U@ " \ @U 2   0> f"P`> f"p@"U@"  \ *  .`  *> f"`> fԐ"$ 0 X <@  `@B @"U@: \  ?  &+@* <?$ `Ȗ cP$`Ȕ?"  ,`  $ `cP`$` "M`_㿐 08 @> @ 2  8T@>  $  > f0"Ȗ> ff"@S̒$@ > f #> f!@)(0&!-@   d? , / n0@HbU`  > cԀ > ` 0 $`@Z(0 u`@`bU >@c``@@  2 ` > f#8> f #`@"U@"``cؒ@@  @:`-` $`ĐP $`"|@SS|@Y@SK|@Y@Y@YҐP@S8* `@"U@,  @`XP@ * @ 4`bU ,`T8?.@  `@"U@:c@``@    " %  : :@ `4?@ RT > >-`@"U> f@,``:`c@``@ ` `: *`#@: " ` 8 > fa#"``c@@ ` ` ?#@  *@ + ʚ``$$`$̀ P@$̔ "  `@"U@:c@``@  8 " %  : :@ @  `@`"U@= c``@@ ] b`$8 " $`$8̐P#@$` #@:#` ``$`P$`"|@RT|@X@RL|@X@X@XӐP@R9* `@"U@,  @`XP@ * @ 4`bU ,T@`T@@ @ "@ ,h㿘 X`< @ @!G 㿐 ``,`@ > f #`@Zǒ`Q``L, `  `d? , `Z 0i@HbU   > #Ԁ >  [  $ `@[8 @bU 6` \ `:   > f#ؔ`L`Ҁ`2 > f3# @"U@6`b \  +@* * 0@*$ 0 , $ `<cP`$`Ȕ     " ?$ `cP$` ?" ,` 㿐 0  @> @ " $> g  > g H@*> g `@QF@Q?*  @@ d? ,@  ?0U@HbU  " #Ԁ " F?@W0  @"U@# ``@>@ .T >@ ! @"U@,   ; # ` ` ` ?#@; 2` ``@ > gr `?㿘 @We    `, &  ` : ``@:bU "@``@@ 8> 1 *  ?"? *@ @[Y *`@"U@ c``@ 8`*  ?"? *@ @[: 2 > g   > g  Ȱ&.  &`,:.@"U> g> gcX#|    `:`c@``@   8 "& &  : : @ @*`@ @ @ + `@ * 8Ӏ > g s > gŐ! 㿘$l h>`.`# (.> . # (.@.$p@8(& .` . @ ` @  '? 8(! .> @ ?@ !$ 4/  ".  ". "$ (T  ? .`.`&㿘> ga  Ԙu (  P'T\'X@Yڒ <0 @ ?'> g !X2%6P  @P ` h @e ` 40`*:  8 <20 @8<0  D L 0 G C w#`#\0T_ m`X <@ .`#\#\ 0@P`+ ;   @.= %   % X`  ,   `P* :  8` ڐ0?d  `"?P <D L   ?H " 0#`T#\ݘ `X <@ V"#\#\@cJ* :  8 D2 0 (0DL T:  ' %X`d*@ " TH@O<" @`X <@  "#\#\ @  %  % @7w  4> g֐!p * @'`E' l 0T $ 'Ģ0 ѐd'.@ <"T@OhH"@`X <@ #\` 0 @˚ Z 2*  % '`%  a` [. 2 0  0T .$@*  0 d'.@ <"TH@O`# @`X <@  0*` *  @J* * *` & `&'X..* ?0  zH* `M0T) `$@0  d.@ '"TX`H@N<" @%`X <@ * #\#\ @ * X*`& 'n j  X 0? 0 ǘ 'd.@ " T%I @  @0`0@ `""@?* * 0j "> gw!@*X H`&  )  < T@=| ! "@ % %!㿈>    *`" *  * '' X`<`  ?$ @   ?$ 2   `@$`$ $$H`B g!@U H* @   X <`@ h 'T h  < `2`   2<V < 'X @:`  ` `! " > go"@M)   !  > & ` @< 2(@ߔ& (& ,& 4& 0X <@ 24 > > @. " !>   T1  "  @   T  % !`&   C   A?e08ݰ e4հ   !T#\`D  T  2°> @x@T`IT T !`&    @]e<2`Pp> @U   !T#\`D  T  2X <@ " 42> e8`L e@`0 B 88    @  !>  T0a  2^ > `P * :  8  2`0 8 `0e<eD `L @ې<`T$H@L+TI`T`0aT`0  : D`P@UB??'`t$ '`t%$'`0 :` 'L  < X'H? @ "@ "@ @,`@"@ `!&    Hq <m <>  (> ֒ >   T ?'`t"@ '`t Ԓܠ "@'`d. @P 2P` $`0\L z? @+  ,!` &`P`* :  8  2`0 8e<`0e<eD `L .< @۶ I- @E 4`0`P * :  8  2`0 8 `0e<eD `L > `P * :  8  2`0 8 `0e<eD `L # > gm"H  `T:  < H > g 0,`@ "`W"``> g  H@"Ip!> " &!&! `& ?@:S 㿐  ''P'X    t?P@I0:  . `0" >  `, ",`0`<@ `8$`0$$`T> g"0 P"Xu"?"`H0 DƔ 05t, "@@J*` X <`@ 1 2'ʐt??&@,  d. ?? 2'0&?@ P @O,  d. ?^ 2'F"  X`0 $`0X"㿐  P @S2 4 0*:  8  2 0 @8  0%<%D L   '?; z0 %< H @ & '㿘 8> 1/  +-.`> g> gX|  '; ) @@2  8&/@/ 8 /`/  8܀ 㿐> U"> ב*" *  < 0*  T:`   ;"5 t 0@20 t \ +  . 2% t` @2  t < " t T4 t: $ t> g/" <> g T;  "Вh?> g# t ʀ㿘 8>> g0#  > g@ `?>@ *  @ *  *@  `?>@ *` @ `?#㿘 8 >  > g0 > g.@>@ *` @ *` * * .@ >@+ * .@[#(㿘 8 >  > g0 > g .@>@ * @ * * @ .@ >@+  .@0#8㿘 8 ">  > g0 > g@`?>@*` @*` *   `?>@>   #Hqqrrr4rLrpr|rrrrrrrrܝ㿐>  > U`x>  /ap  > h> db!>  '  > h!0?> h> h" b( l 7 @   ?" OD^ 0%> \" "\@  #b\ "@b\"`!   Ԕ Y @ْ D * @ni    l V `< @ @@M a L Ҁ   Ӏ  @ y`<* $`<@l  Ӏ `<@2 L Ҁ 2 Ӑ@ $`< Ӏ  `<@ L Ҁ  *@$`< `<@0@` E`<@B ``*ǐ !+P , L р 2 `<@> h> h"` Ұ "8 Ӏ   @@,  , Aْ  ,@G$#L   @T `0 @&(&&$&&,͐ < " > O `&  `"`<`< !!`*] * ,J u`<@@#`  `  2  T  P ( ` Y1 Z`" @GJ@ % Y Z`@@G>$ ` Y`@@G4$ @P 4aL l` `D`&@`<@"&  L Ҁ,  Ӑ  , #LB  `<@   ?, Ӑ@   㿐`D `P ``  I ``   "@> h"`` @N]`@NV`* `` @N@NJ`x``?* `d`0, ` @  x@N  H* @ ; U %  -0 *x< '  `)n   Ɛ +Z  > h"`h ?*D " (< @F?ܰ F HaT%\   0@@܀eg8ư 0m ` #P##P#T##T +  h h#@40 "0 %(@%@D@  4@Dא@ ##P 8 0 47$@  d@*@ ?Eܰ /ܒH 8 Ӏ @ l%$ > ,  #T%$" , '''' p#㿈 ? T >   x (`    * d`<   ?( X `h )s " (<' @EĘ찒 $ F HaT%\  O 0@@eg( , L ѐ ?`, Ӑ , `<@> h> h"8[ %L"`V  %L?    ?|!@EV! h ?u %` H h h#@0 "0'`  ,  4@C %$` ,*  ?P  @$$#P 8@ 0 49$  d@*@ G찒 H' 8@@@%$ Ԁ ``1> B , @ $#T%$`" ,@ &a&`d "`  "` &`h &`h`<%( &`@&`<%`%@%` t %`  d %`$ 8%`(" 6"@z"`" , $#L >  ,@D$#L!ؐ"`Ԓ" @D%0=aH#` 0 4 :    @IY %0B? 8 <%0%4 <%0C Ӏ @    #P@g #L@d  , , `<@   ?, Ӑ@y  #P@N " 쀢   '` ` @8 @5 &a㿘  *   @ &  %L?&  &%P%, 4&$ 0 *` * ?:   t:`>%0<  @Hߒ %0 B >%0 H L8 8   ;`; >%8>%@$ 4$&$$  @&$ 㿘6`<` `@ I@? 9L Ҁ 2` Ӑ` `, @  "#L), ?’ `  ?"`  L Ҁ`   `'.? `#P? ? ? <*@$<$㿘`< a  ` % , `@5\  ,  s &v` '(c 㿘!F aTe\ "`4> h"&``0&``(&` `8``̠ &``(`< :`: @H  @C d$ &``z`,?&``Ȓ D@ &` `T Z ` Z!La l `D`@B  㿘` "  < `  p ``U ` `':` 2&@`'   㿀!  LЀ  '>LҀ " '> h"> hO"''''@ 耢 2< `` @ 2䀢 2'耦` <@ 2  %` & 2 ' @6LЀ`@ђ 2㿐a @+7 & > >#( g > >& v"@@B! > hT  6 > 1" `4$ $$ $@+4$ " ΐ0q@J༠@J *  @J@Jx`?* d , 0 "xI&@J H* @ X <@ "T@0$> >> >#$,@Ce " %& $  2,x `$ $ X`<2, $, $$  &㿘!`  ` *,`@  F@7  2@ "`"`㿘  ` `4?@@ *cP`8`0`4%``d@*@  = Hn`@`8p 2`8&`8 6 `T`d@JŔ"  `h  ,`> `$` `hFHeL?H"Pe, 4H8 H"@"H`:0א04 2㿐> t∀ 2 > #aܔ #\"> >> hc"@!   t @@6㿘`W ?`Q> h*` €> 1"> 1"> 1 > 1  > ?"> 1"V&> @!> A > ?#> ?#> ?#> @ !> @ !> ?#> @!> @"VҔ -㿀   > h> h#@}McP<X  @@ 2 ! 2 > h> h#`}8cP ( > h> h#x}0cP0 а 2 4@(0ǀ 2ð    @ b  '  @IՔ `` '*@ :   20 8 <0P  << D L 0  @ *<@* :  B >> 1"` ?#\#`  $4 $ ) 4' * :  2' @8< ' <D'L  @ '?#\#` ?} )% $`@$6`H`HPx '   b 4VP`8RP "   % x' '  > h> h#@|Kc  2<9 #  > h&> h &  > h`"=  @ ࠀ  ऀ@0  > h> h#|c> h#|c'   @  e0B  2<e4 <  `@ ` D  2   Lx ߰  ` ࠐ` ?耧   `P@H  e<`0 @ "* $ #\ u<  Bࠞ   ऀ @ D   <@* '@` `@`P`* : ࠀ8 2`0ऀ8`0  e8`L @e@@ @ "@&HOs H@?-`"`0  > 1"`$ Y   "   $ `2o  (  "    "  34  䀢`  & @@  ' @ b % =   ` `   㿘 < 2   "   <@" @b   `?H /d * % p  =# 0 $ 0  p _>  c+ 0S  0  > hzː#"  P &G  p  0`     0$ 0)쓐 0$ 0H 0 0 SH /d * % p  "  *> hؒ  2 H 0@2 +H /d4p* %p   l< > h#H 0ఒ     `?@ 㿘  @'' > > s"@$  h $0<HTD $088,@״ٸtt|ttttP XXXXX?" " " " "㿘 `&`2@   Y ` &@H 0  >  ``4 & @H 0  㿘 > i>   `4 > iy А &&[=?& 㿘  " > iy~!> @6 a a&"a& > t> t"`&" "& > @a"⌐ "aȁ㿈>  H /4> A* %> A > 1 T"b`""`"@"ܑH 0 ?` ->#*` €> A" > ?"> >#D> ?#> @"> @!> @ > @ #> ? !> ? 0> ?!> A"r 0> i y H /dА* %Ѐ$""ܑH 0 > #p > ?` ""> Ab  ܰ?"b> ?`,   @e,> @$,!Z1 > A`Ȁ   @`> @$`Ȑ!Z# > `` '' /> @,  `@A,> @$,!Z  `Ȁ  @Ր`> @$`Ȑ!Z  " "'耢'А"@''耢 `"v?H /dWА* %0O`""`"@"ܑH 0 ?` ->#ē*` €> A" > ?"> >#D> ?#> @"> @!> @ > @ #> ? !> ? 0> ?!> A"q 0> i x= H /dА* %Ѐ$""ܑH 0 Ȁ   @> Abb`2`,?`> A> A?bb "Y 㿘 H /> @* %> @> 1a""ܢ `     !`@$    2 2  bܑH 0 T ?*@4 `"  "` "@> @Ȑ?b"ȑH 0   "  " $  2   " @ &" @ A" @ " @` > 1"*` > i!`> i> i!0waX㿘`p  > iwx!hH /d4> 1* %> 1"" p$`p`""` "@`p "`p" &`p " "" ""  p2bܑH 0 㿘> A"` '> A#> i""`$" a V " $"?$&@!#  $@ &@` ֖  $ X㿐     2? "  㿘 > A X <  > @ a* @    @  2  @2  2 &G > @B&> 1 !b܀ > AH /d4$ܐ* %$ܐ n @:S @ 4 $  $ $ $ $ <  8"?H /d4$ܐ* %$@ $ @ "`$@$ Ր!& 㿘> ?b> > A `̑*  @  @2  2 &b > ?]&> ?"Ԁ@    %> 1 @  %> 1٨ %> 1'> @l܀ H /d4"ܐ* %"#> ?`$#Ԓ n"  ??4 $ $ 4 < 04 $ $ ,$ 8$ @$ <$ D D$ H$ L L$ PH /d4$ܐ* %$@ $ @ "`$@$ V& 㿘> @b> > ? `(* @  @2 2 & %> >&0 > A!mĒ $ $ $ @ $@" $@$ 0& 㿐>> >>>> T Xbl!$"`"`"`"` > ?"!> @"a> #>  @@a, @ 8 > ?""@7 > A NJ+ > @"a> @> i !` a> ? OJ > A"`> @> i "` > @ P J  @> ?"`(> >> i#0`  > @>!̒`]& !> #!> A> i#\ Ԛa @  lH > ?> i#\"a X  l> > A> i#\!aȒ   l4 > >> i#\#Daؒ   l* > ?> i#\#a <  l  > @> i#\"a   l > @> i#\!b 4  l  > @> i#\ ̚b   l > @> i#\#b( p  k > ?> i!b8#\   k > ?> i 0bH#\   k > ?> i!bX    k#\> A> i#\"b`   kИ 㿀Ӏ K 0G@8 , @;,@   d, 矘䰒 ,` H` $ '  '  ' @'P  "  " " $" ,@&۔  㿐H /!> 1* %!> 1$"`    bܓH p@> itf"p?" ,  @ @M2  "`$ $"`("" ("ܑH 0 㿐 P > it9"H /d3> 1* %3> 1&b@"  "` "`"" bܑH 0 㿘 p  > 1  4 2 > 1"ܑH 0 > >#Dk  6 6 & & & & & H /d4> 1* %> 1""  @6  p & p"  p$ p& 㿈\> ? kʐ#@7 <  4 $ 4 $ $ $ $ $$ 8@$ 8  Ŗ > is"H /d4> 1* %> 1""ܺ   /$ 4` 2` $ 0 4  $ 0 `" "```"`$ ( ("`,"$ ,`" "`@`"> Am !`2 > isd"9 @4 `p $`p" $`p`p` $ ,> 1"ܑH 0 > isH# <   \쀢  2 `p "@`p"`$`p" L  @"$ 4L$   $  "@ # bܐ @6 bܑH 0 0+ & 2 > 1"ܑH 0 > ir#H$ $ ""bܐ @  bܑH 0 㿘`@ > 1`$ @> 1` > 1"ܑH 0 > i#p` r`&`$&`$8`2`8 `8&`8&8@ 㿘`"  8T@>  $> @> ir# j ̒ 2 ! ?* 2  "  `X"  " " " x ?' ! ` ''  ` * ' ''> @ l㿘> @ j[!@6 4  6 6 & & &  `0& 㿐\H /> 1* %> 1"bܺ  <   p K     2  p "@ p"`$ p"  2 > ir#  6  p`& p" $ p&bܑH 0 @0㿘 H /d> 1* %> 1"   2  p`" p"  p& p"ܑH 0 @㿐 P  > iqƐ# )> 1H /d4%"ܐ* %%" p``` 2@`"܀   4  p`$ p" & p p$ "ܑH 0 ` `  > jq H /d* %%" 2 &0 6  &0`"`  "@ &(("`,"&,`" "` "@> Ak!` &$ `*    !  2  @" > 1"ܑH 0 > jq& @ &   & @" ` & ` "`$`&` H*`" "ܑH 0  $`` +H /d * % > A`Ж`Ѐ $`" "`$H 0 `"> @ h֐"  44 $$ T P@   \  Tl  T  < ` $ H < H0㿐 > jp `> @ h#@4f p 6`! &`,  &`  `0&`   X5> 1&`  >` >`! &`(@? #@```  @ ?"@ "@ `  > &! ฐ@;L༠@;* D @ j@d x@<9  H* @~ H /d4&ܐ* %&  і` " ܓH p@> jp/  `  6` `< &@ <"`"`< <&`@P@f D D`2ܑH 0  H /d4&ܐ* %&ܐ@Œ $ p  p'@8(0 "0ܑH 0 H /d4&ܐ* %&ܐ@w    ^ @ܑH 0 @Z㿘 p?`> ,*` €` !" `> 1"ܑH 0 > jo ؐ!` 4`  @``  P > 1` TP@ > 1"ܑH 0 > jo~!H H} <` ?*@4` @`"``"``@"@`  4` ``p $@`p" `"`p` p$` '> A*`$   @G $ *`<@;`< ` "(`  ` "`  "``$ ` 2    4 `<`$`<" &`<`<$  2 ` ?*@4` @`"``"``@"@` `"``"``` "@H /d4А* %ДЀ $@" $$`H 0 2 p@Ւ- p> 1"ܑH 0 `` *`> 1" > i!`> jn͐!(> 1"ܑH 0 `` *`> 1" > i!`> jn!X p`2`㿘` 2 ` `(`"`,`,"`,`,`("@` ``"`& `` "@` `2`8?*@6` @`"``"``@"@`8   2 `8`4`< "`4`8 <"`8`4"<`4`8`<"  H /d * % > A`Д`Ѐ &@`" "`&`H 0 㿐 > ? fG! 6 6 6 &  &  `X& H /d5> 1* %5> 1&   @( "  bܑH 0 @0  6 `@ & @"`"`@ @& ܑH 0 㿘 `2M  8 2I  < 2E  @ 2A  D 2=  L 29   ` 3 6  $` ("`( ( $"& ,  @ ?*@6 `"  "` "@ -` O& @   > 1"ܑH 0 > jm!    2H  82D  <2@  @2<  D28  L24  20  " * "     H(> AВЀ"  " H > ?Ԑ  ԁ`  ! `  +> A ' ''' `   ,'?x'''t~ ?@ $ 0 : 'Ĭ ` 0 `d,@ @bĀ 20۠Đ'Ĩ? ,`# 40P* : x |20|8<0<D L wē<  'Ĥڑ, (Ā@> jn!> j!@H /d * % `В`Ѐ &`" %`& H 0 㿐     '> 1t}? H /d4$ܐ* %$ ᧒ ['`p"X  > 1 2> 1 a2 ?> 1"ܑH 0 > jl"*@2 `""`"@H /d * % > A`Ж`Ѐ "`" "`"H 0  p` > 1"ܑH 0 > jlZ" H 0 ܑH 0  0?2 "/ H0t? !:` }  , ` d.@ ^ 20ڜ'?(0 "0D㿘 2   (`" , ,"`, , ("@  @ ?*@6 `"  "` "@ `"  "`  "@ `2 ] 0   2 `<`"`<" `<&`<"H /d * % > A`Д`Ѐ &`" "`& H 0 㿐 2` `'o0# P@8m %< > ? c 0@/\   44 $`$ 4 H /d4> 1* %> 1"" 1!> ?4 !c   4 !4$ cv  4 4 $ $H /d4> 1* %> 1""> ?a a$a"`$a$   4 `p`$`p" '`p`p$ܑH 0 H /d4&ܐ* %&`  `ǖ ` $a ?# @4 H /d * % > A`Д`Ѐ $`" "`$ H 0 a $ a "`$a$    4 `< $ <"`"`< <$       2  p "@ p"` p& p" $> @3А*   $` $  @3Ɛ*   $ " @3*  " $ @3*  $@$ @` 2 @  4 `< $ <"`"`< <$ܑH 0 㿐H /d4> 1* %> 1"" e<  `P; X&&  @3h<*  - $`"  "`  "@@3X *   $` &  @3N*   $ " @3E*  " $ @3>*  $@&   2 >` & @3,<@3( 2   <  2 & xhܑH 0 㿐 ?*@6 `"  "` "@ ` "`  " 2  `  f"`  !` w  " 0 `0 P> A> ?!=#  4  *@6  @2 `""`"@`""`"@H /d4А* %ЖЀ " " # "H 0 ` `0  > 1"ܑH 0 > ji"@H /d * %  В Ѐ & " # & H 0 㿐@@ ` " `  "`"`  "> 1bܑH 0 0"" `"  ` "" ` " > 1`"ܑH 0 @ 㿐> ji$"`> ?b!> A2  !: $! @ !> A`$! a "@,ɒ  6  @6 6  X& & 'H /d4> 1* %> 1""` e< ` `P ;    2 `p "@`p"``p$`p" >`& @1ϒ *   $2 2  <2 1 2 > 1"ܑH 0 > jh"x@> 1"ܑH 0 > j"h ?' c 2 "  `}6 㿐`  %<` > ? `v 0@,2   4 4 $ $ A   2  2  "   "` & " "> 1"ܑH 0 0v $  " $ ?# @4 $  "`   `  <` `4 < $ < "`<&<$    4 `8 $ 8"`"`80 8 @1*  $` $  @0*  $ "`@0 * " $@0 *  $$    4 `< $ <"`"`< <$ > 1"ܑH 0 㿐H /d!> 1* %!> 1$"   PV  @  "ܓH p@> jg" "2`"ܑH 0 㿐 >  `    > j@"0 H /d4> 1* %> 1""ܢ    2  bܓH p@> jgq" @C  ?* `:  $  4 bܓH p@> jgZ#  "2`bܑH 0 > Aa?"aH /d * % > A`Д`Ѐ &`" "`& H 0 0 ?* `:  $ 4 > jg #H "2`bܑH 0 !  @ > j@#p $I> Aa?"aH /d * % > A`Д`Ѐ &`" "`& H 0 0@H /d4$bܐ* %$b 6   &  a b  bܑH 0 0   6 `@ &`@" "`@ @& bܑH 0 㽰 !0  ` '`  '$ '0'' > j@#H /d * % > A`Д`Ѐ &`" "`& H 0 㿘 0@" p> jfc#``?` u@> H*` €@x@̒s` !"`> jfD# 23 <`(0 "0k`` ?*@4` @`"``"``@"@H /d * % > A`Ж`Ѐ $@`" "`$`H 0 8 S# $` H /d!> 1* %!> 1$"` ?# @`4`  H <tI` ``H <tD H"ܑH 0 `` *`> 1" > i!`> keې `2z`㿘 ""> kgx 80H6 H /d4> 1* %> 1""܈ *` $)`?#> k> k`H@ @@ > 1"ܑH 0 he` "#@  #@   2  2`H`ґ*`"ܑH 0 㿘 " > ke{ " 6 x@1Z `H*  @  O> kei Д #E & s @) 0` D> 0H /d4> 1* %> 1"" D d `(`X> k @  "ܓH p@> ke4!  *@   "ܑH 0  > k*@aX e( *    "ܑH 0  > k* !x> k eaX  * ` "ܓH p@> k d!?# @ 4   D b  ` _ `( *``("  $`"M0@"Iu  $ : >`   `X*> 1> k@ < 2 "@ܑH 0 da"@ `  > 1> k@ * 2 "@"ܑH 0 db"@`"ܑH 0 0E   ` $  *  0uR `: 0  2 `  `(*   *`" u2: >`  `X ?* "@ 2 "ܑH 0 㿐'?*@4` @``"``@"`` > x*` €@ @  `  4` `$@" '$``"%> A" "`"`"`2`"0 2 (`",,"`,,("@@ʐ `2 `$ 0 4  (`" , ,"`, , ("@@` 2 ` 2 $`"(("`(($"@",`2 H /d4А* %ДЀ $@" $$`H 0 ^ p@ Y p` `@{4` R p` `@4` K p` !" H> kc"(` q <` #) S` ?# @``4` $` %> k@`cyP `   4` `$@" '$` 0 > @a "ah p`` *`> 1" > i!`> kcR"p p`2 ` ` #  p` 4` @`"``"``@"` @ 4`  p $@ p" & p$``2` 㿘` )`0 "`4> kc"  D 0    2 $ `  ` `  DO 2` 㿘 O 0 " $> kb" " ` "`  "&  "`"1& `H  * " `"  "`  "@ =H /d * % > A`Д`Ѐ &`" "`& H 0 㿘 b!?> kb#! @  6 x@.z  * `H@ p۔  "$ O& `0 > ?cА "cօ  D2 #> k!> k> k  > kbm#( 4*`( "#Pcpb^ *`X@ "> k> k#cpbP#@  0 ֢ `"  0`0 2 0> @a "a 0?  4?2`> kb2#` 2 0`  4@? 0 8`??`> 0& D" < <=  ?*@2 `""`"@> * €` > la  @b  < @1 <g  <` *`> 1" > i!`> laސ ( <2 ` & > laА XI   2  D   2 "   < " < <"<"  2 `8"`8 `8"`8"㿘 @" > la  * 02  2  ` 2 `"  `"` " <"  < "` <# <" `"  "`  "@H /d * % > A`Д`Ѐ &`" "`& H 0 㿘 b2?> la< ! @6  `"` " "祐  2  <  <   * $ ,?#> l  a`H   "    ` 3  ` "`  " <#  < "`& < <# `2 ϑ*`"  <`0 > @b "b < 27  $    $`@ "2'  `"  "`  "@H /d * % > A`Д`Ѐ &`" "`& H 0  㿐V & H /d!> 1* %!> 1$"   !  "ܑH 0 0  `" & "ܑH 0 㿐H /d4> 1* %> 1""ܠ    2"ܑH 0  V @> l`R  V "@ "  "ܓH p@> l`A!(?# @2  `  2` `p "@`p"``p&`p" @] D " @%#  2 `""`" @ 2  <`" <"`" <`<" @2 ` 2"܀ `,"ܑH 0 0@ "ܓH p@   9`, > l@!P `> l_ϐ!x㿘" D @6  ` "`& P  "$ $  "" 2 L  DԒ L 2 L` "`& P  "@$  H $  H"& H L 2 㿈>   H /d4> 1* %> 1""ܲ   bܑH 0 ΰ `@ > 1`<  > 1`D > 1`L > 1"ܑH 0 > l_N!0`8b > 1"ܑH 0 > l` !> 1"*` > i!`_.    $` ` `> 1"ܑH 0 > l_!@!o bܑH 0   ` ]  !    4 0 P *@ ࠙:`  2 0ऀ@8  0%< %D  L ` ѳ찒  !H /d4&bܐ* %&b >  82`bܑH 0  㿘  > l^"H /d4> 1* %> 1"" p ? 0 7  0 $ 0 0`2  p> 1"ܑH 0 > l^k"8    0 ?$ 0 KbܑH 0 RH /d4$bܐ* %$b p  @ bܑH 0 㿐`  2 X <@   0    <@H /d4> 1* %> 1""ప@  bܑH 0  p@  2 pbܑH 0 ~ p    ?` > *` € 2 0'@ bܑH 0   0.H /d4%bܐ* %0 2 0'@X bܑH 0   0ѝH /d4%bܐ* %0 `"` 2!` `0'@,  bܑH 0  H /d4%bܐ* %%b܀`2`  @  {bܑH 0 0 $ @  @ bܦ`a '@ XbܑH 0  g 0,H /d4B%bܐ* %0$ '@Ò 4bܑH 0  C 0qH /d4%bܐ* %%b> 1"ܑH 0  ` *`> 1" > i!`> l\"` 2  @b'H 0 ՐH /d4* % %b׬@  2pbܰ H 0 H /d4%bܐ* %%b܀ bܑH 0 . H 0 И$H 0    `U    ``  㿐 %> 1ܑH 0 H /d4$ܐ* %$ܐ  " * DH 0 `F0x  H o4H$ܒ*@ e0@H /d4$ܐ* %$܀  2  0'@Ē 2܀`" , LH 0 `08 H o4$ܒ*@ e$1H /d4$ܐ* %$܀  2  0'@ 2܀`" g܀`d  _   㿈>   a -> 1 1ܑH 0 ఒ ! -> 1 H /d4%ܐ* %%2   H p@> l[" GܑH 0 ``  `:   `2  @* H /d4%ܐ* %%2 "   H p@> l[?"  ͖  > 1"ܑH 0 > l[,"` 2$ܐ`,@ʒ ܓH p@  w`, _H /d4%ܐ* %%2LܑH 0  `@&Bk`@&;`* k`` @&ϐ@&/`x``?* `d`0,  $7찒 H /d4%ܐ* %%2  H p@> lZ"2 H /d4> 1* %> 1""܁㿘> ?" * * @ " > A2: @ > @> ?#Ԁ@ > @ a  "a㿘>  > ?b1> ?b@ > @aȀ$` > 1"ܑH 0  i  f > @a` v"aH /d4> 1* %> 1i""  c  `0> ?> ?#> ?`,` > ?###`,"> A> A > ?`Ȓ` > ?# #`"" > l> 1"ܑH 0 > lZ%#` #> 1H /d4$bܐ* %$b> @> @a  ` "> 1"`& AԐ b> l (8! 9ɘ !$bܒ` $!H 0  㿘> ?#!> @!`";A !  > 1"`& > @A!́㿐H /> A a> l@ؐ#H0R* %> Aa> 1   >""> @> 1a*     * !H   Ζ  a > l@#`@Z 0 2 a  ܑH 0 㿐H /4> ?* %> ?"> 1  "b> A > 1 *   : @ ` **  ' "ܑH 0 0s> l@O#x0o> "\"\\ <@" 2x @@ ?J ⵖ "?B@ ⬖ 9"ܑH 0 ` À@    > l@#0  "> l@#@ 2H /d4%"ܐ* %%"ܢ`@"ܑH 0 㿘 H /d4> 1* %> 1"" p X ?` 6> *` € 2 D`F D >`@;  "7`7 `.  $@ " `( ``2  > 1"ܑH 0  ` *`> 1" > i!`> lXm# 2  > 1"ܑH 0  㿘' #> 1%> l2  0@$ 0bܒ  8 $b "  0 퀦` 0  * 0  $ 0㿘`2 tH /d4> 1* %> 1"" t `#> 1%> l L t`& Lbܒ  7 $b t 2 L` > 1"ܑH 0 㿘 0(2 \> mW `X 4@ > mW 8㿘> m pY㿐>  > U`x> ,ap  > m> db%> $ > mY 0W> m> m! a(i O .  $> A> Ac> A㔒 " 8" " $ $ $`4$ $ Փ  ?"7F C .0%> \" "\@  #b\ "@b\"`!  `Ԕ Ydg ׾ D@AO  㿘\F!T@2& 0@@4! eg8$ >4> d> A"h:##> tb?c ?*`@   > A> d"b#b"d: t @`<@> Aa N`Ҁ ` @  6 iN`Ҁ ``<@2\.`_ #  ސ| W!> t"?c |?# *`# <@ | ߂ ""> mW!8 . $"  $|" |$  $  4$ $ $Β %|a x`Ԕ!cx"`Ԓ" @@`e0 Z` Ycuxx Z`" @@aLe! t ?}$ 㿘!   `?C`#$`@8g` 2 $&   2     쀤  ,(" 'ߐ? *@, &  > 1"> mP 6M `?2` 㿘֬ ``D@ǔ  D@ !Lad t -㿘ؓ㿘  <`> mVX!x  㿐>    V D `D 2`> mVB!` ' ` T 0* @   Hd <0  Hd mWU!` > mWO!D > m` "?> mU!$`7H 㿘  ``" > mU!    㿘  .  $ 㿘 > m`"(   W 㿘> mUg"P㿘 "   ` "      @  ` X  a쀧 > m` > mU="`'@`L@ }@?"Ȁ "Đ@  6'Ę .`$*@ `&`" `` 4 @6 * .`( @ 2  @` ` '@6 ( "@ !0 * @ _   &`L   0"2`> mTѐ" 0$ ,@ $ 0$ T> ` ,`p",  H*Ķ `,`)`( @#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`y   "$Ȧ$,@`&?& 㿘 X!'`&   ` ?` > m"TX_   &@`S  @ >`   2 ( % "& "&&& "  @   @ @ &&:& @ `" `2   > m#S 2' 㿘> a> A  (> A> A"c"> A 㤖> A  㠅(  222㿘>  '> A%> A㤒 @*` "  @2 2  `ܐ 0 2  㿘>       i T> Ac> A @ * @` `2 @`@2 @ T  P  `2`#@ c*   & " " &    2   "" 㿘 > % a(    D > m#߸ "2 V 4$  X <`2 @ 2!?@C !   @? &  `!& 6     !`     `U  㿘> %!(`"   D > m#k  ܬ$ @  h'  < ''*  ''$''@  ` ?{  @ s   X <`? f  _ ' '耥2  X " X  ?' X`L'`|  `:`   2$`` 8$`$`  )'$`ئ@  a:`     > 0$`  `` "`'> a` ' "`` aB 2` * @ `* ' ` "`ƀ` a`:     `2 H?' H@   > 2 `@ ``> n@̐ `"" @$`P`' * 2   ?"@`䀢@``2 耥 '`䀢@2`@ '"` 2`@  2` X @`$  "e $` }$`' @$`    `&s`| '$`  2O`   @ @ 2G "C` >̒ D` `$`taB 2` * @ *  $` $` $`tܐ% $`t$`@$`ta,c` ~ $`$`xԐ(` $Ȓ @$?@@ʴ 2 > a` "`  `  ?`@` ``> n@ `  `  <`$`` ` >$`|@ ;G `!$`t" $`t`` 2 XF'@  `" "'@a" '@!@ "'@4  '@'`0Ѐ+ ( |`` 2 Xu   n '@($f Ȓ P@\$0Ȓ D!@$ X ``  Ȑ<  C*@?$Ԁ`0 -Ȑ+  "0.*@ $`` 2 Xٺ'@  Ԁ  Ȓ @$'@@@ɲ 㿘 > n`X 0  Q D`> nPI X㿘  ""  @ > n ? @ $> nQڐ `     > nQА p @    J@ `@ &J@J   㿘`(2 > nP  &`.``^T  X`@< 2 ..㿈 t  ? `v " X> nO ! <@   #\:`  " "  X <@ Ã":   <@<$"6 Xa`L`H ]@ X <@b`<@6 "`H2 b`<@&`H: I X X`<2  `ݰ : 82 t : <`:      X <@     t @("@`4  `  X ?` <"@  @  䙘t ]nt@   @  : 6> nO 66> nN 4 ]K X <@ " : 2¦` )$x %:  8` ` ]x @:   ``R㿐` !`:    \ "@ * t !"@  :`   F t "  2`X <@ ` `&`Ð 0 ``?``&`&`6``X <`@  t     $ 㿐`a`:  `  /" X`@ * `?&` X`< " `R喒0 ` &`6` X <`@`;` $``   2D ?` ܐ  #\#`#h#d#l  + 20 ܀ 2,     4 M  .`2M  "  M .2    D4 @8  `` ` '= ; 9'܀6  ܀ 21 ?  (  @逢`# ܔ`X 찒 <   #`#\ #d#h#l     2> nO ܀ ֬ 2 㿘  X @`!! @f @  " D D 2 !  D@U    㿘@ܐ`I        @,2`,`  @l 2-``,  *`,` @   #> n 4  aH ,Ø     , @ 4 $ ,`ސ  㿘  `> nLސ!P/?#  * $`*` @   " ,#> n 4  aH ,     , "$ ,$ ,   4 `ؐ  㿘 @.  , $ `" (  2X E! 2S E > 2X  `> nM!C  ( C`"B  , >  . Xa ,@ $ <! 20  > 2X > n> n!`M# >   < $   2 E! 2 E > 2X . `> n> n!M  4  E 㿘@ `    @,2`,`   @j `-``,  *`,` @   #> n 4  b( +՘     8 ` 4 $ 8`ސ  㿘  2?> nK!P#ߒ  * "`*` @   " 8#> n 4  b( +     8 ?$ 8   4 `ڐ  㿘 @.  8 0 `" 4  2X E! 2S E > 2X  `> nLא"0C  4 C`"B  8 >  . Xa 4@ $ @! 20  > 2X > n> n!`L`# >   @ $   2 E! 2 E > 2X . `> n> n!Lx  4  E 㿘  X&a쀢  <> nKP"   > n!> n " @   @ ` ףK9"؀㿘 <  H `    g0 HaѨ 2 @> nK"'أ.''''ܐ g Z` <` @' J @` <  *`< @ &`<@  &@$N" , " 4@#@&&  @ߘ > < 4& @ 4&@ې >Βc   -@㿘 < @`~  ` *@ @" ڐ0 㿐a .> nJ#   <0 @>ϐ ,@''aԺ @  $?$ @ ?,@   .`"`<*@&`<㿐! @[   $W5 @\ p!W#  @?Ԁ   " ,3> n 6  c( )     ,' 8'   <' @'܀ " ,@  ( @ > . ,@   '耢 " 8@  4 @ ؙ. 4> @  '& $& (& ,䀢 & 0& 4& 8& <& @ ?# @6  8 4@? #ߒ @6  4 2  ( 2  0 2   $ 2   6 ?# @6   6 @  p!V \ @Ԁ S  " (3> n 6  c8 )I   2  (`" 4 ,   > . ,@   & < 4` 8  쀢 . 4> @  & @& , ( & 8 ?# @6  8 4@:  ?#ߒ @6   6 @]  㿘>  <` `   ,  @ `"  ` " @a  $ a 㿘! `@   *`">АcF  㿘> a> A  > A"c> A#"#"`p. @>   < `> A' c<> Ac *  !> A# 2 2    ` "` "  "@V' 2 > A#'> A` > 2> !㸓*` (( "((㸀  㰒  v D@ P D㸐 ($㸀 > nH#@' D ?@" > nH#H` "` "  "@` "` " ?$ @`@ $@" $@$  4 $ $ 4 .  .`@  #@  $     $'?''''''' а  @ @@  @    )Ґ 4 `"  "` "@@2.' 4 2  ( 2   0 2   $ 2  4   "' < 2  @>  , $ < @ 2 ' 4> @ $ @' 㿘`` ?6`` @`?* ` 6`> A&`c``&` `""`p>  `> nG#`` 2`Z > nG#p`B` %> n`6`  'c `  # 5 ` `* ` 6`  ?ؚ`$''''''''ݔ ` " ` "`)`?# @6` 㿘   @`"?n&?  㿘  >`#&  `    L``H   ͘ @ #1 %!" 2 &$ )# %sW Ԑo 㿐 `   &@㿘!O`@  `0`4&& 㿘> tb  "b 㿐 `` &` a`@"& & F Q\Q,Q,Q\Q\Q,Q\Q\Q\{D{{{T{`{l{x{x||||||||||㿘 > %a* @  @  "   8  㿘 > %@a* @`  @ v "  " `` "``D?2"`φ " <щ$ `  2   `"` D=5"> " > H @":H> ""> " > H @":H> "" 㿘  `<`>Ӑ"*` €X <` k 2`   @"    ,`! 2 Y!   6"> " > H @":H> ""> " > H @":H> """"22" " "D:"$"(","0"4"8"@"< <( " 2 X@" L" : 0( @( :H < "H:P㿘     T ?2  ?2  ?2  ?ް  D? L? "Ԁ`  @$`  @?c ? $` @ @$`` $` @`  ` @  2X ?" X <`   @ x ?2< ?"! $< "l  " X a "Xa <`] a@  @  R $?2X ,?"5 X <`2E a@" $  " $ X 7 뜖 0 $?" ,` $` ,?"a` $`a` , $  ?#  X <`   @  㿘 !@"   ") "  < b"!  O!  r 2 d"  < o @ @$ 4  @ b2 @m 㿘  a"a a@ @  a   A 2a _ laa a " ^ې{$a $ap 8 1| Ӗ0%Y > nC#2`` $`  ` 74`  ` ;4`<$a $a1 !N="   㿘 `<  ` @2   ` "     ` (  # 0̐̎㾈>   c ' $> oC5 < 2 X느y X@낐q   黔 u0d`#kT ` @aJ `` `$`4`$`X+<"X&X`<a2   Ҕ "``?``$`4`$`X <@"a " 퓒  펒 J  > o,Ȑ 㾈>     c'"`> o0<)> o09X`@ A -? (2X> oB ( @`4'> oB H `/``P̔ /  X @`4`> oBg H*  $`  B[ p`$ ` ` ;$` > o,f 㾀> #  '      ' ' $$2`X> oB+ X  # X  x ʐZ Te˻˹c耢 ` ݰ  ` ג@ , `< ΰ D.,˖˔ ? %> oA֐  %Ǜ䀢`a 飔] ` ఐ#@ఐ I   @ ` @ 8  <  :༐            f  @J`.@       I $` 1    `$4$ X`< w`X< 2`   ǔ`  X  鼔`2%# `" ` a  @2> oA  ؒє v  `2w``@> o@ 97`#T `` `$`4`$`X!<"X X`<a2  "``?``$`4`$`X <@)`%`  ```?`$`4`$`X <@ "aʐa`   `\ ϐ`@> o@> o@{ `@2`> o@s!""`  `" `a@"`a ΰ `<  ` ð B`T  B - < 2 2 `2``?$`X`< "`Y`?%``X < M#X <@ ༀ2 ```?`4`$`` ` 5`%`   !@ b`Ē 7 꼒 / ? %> o?ݐ Ť䀢   > o?ΐ! ɀ a @"> o?!  > 2R 0$ v  ` %`䐂 `x ```M /c耥``` ?$#  ? $4$ X`< פȷcc > o)!@`> #` ' `$`> o?R!P#@  !  ̰ 2   $a $a 2    "` Ò a`  ge4` $`̐ "`<4`$`!X <@" = @"` $` `$4$X <@"X%X`<2  2X @`> 2 ,> 2 D'' '  '"' '`''a#\ N `" <`$`̒ @:"ȐHM X <@ Ȕ"`<6 ̖"`H 2 Ȕ`<&`H̐`X< a2`  "X  <@ Ȱ  i̔Ȑ 2 "`= `!"@!?`$4$X <@"`։`$` $`4` X`<|Ǐ  NJ > o(W!h㿘  ఀ@  " @ې0ljv  j   f B`` 2`] B @X   @"`Q)$` ?$ X`<"`)'`?  ` $` `$ X <@/)誒 X <@```$`4`   ?4 $ X  <! @ @?` @ 胒 㿀 (`  @ /  "j @ B X @@ 6 ఔ Kܒ  <`$ <   #`#\  #d#h#l  ⶚ Ƹ㿘   !o $" "    2N  "J > o > o=H!x "@"  @ D  4@#@ #@<  , "@ " @ "D @42 8$    @  2   @8" "㿘 X @@ 2   2  ݐ   8 㿘    T㿘 ఔ  T `㿘 `~ T㿘` \<? > o<! T P@2* T   TK " T 0$ 4($ 0H /d * % wH 00,?2 T H@B <$ @ T?2 H /d * % XH 0  > '` $ D 8*` € 㿘 ? > o ! 2   =  > o !=V  > o!"! =  <` T> o="0 㿘 > %`> `"c#* @㿘 > %`> `"c#* @㿘 `D A`  `  ":> %  # >  #    >  H`B # ; H  "# ?>  # "> %  # >  #    >  H`B # ; H  " ?>  #   ?# > %"> *` €㿘 > %`> `"c#* @㿘 > %`> `"c#* @㿘 `D A`  `  ":> %  # >  #    >  H`B # ; H  "# ?>  # "> %  # >  #    >  H`B # ; H  " ?>  #   ?# > %"> *` €`>ӄ8(`  `   ` $` "`     㿐   #\ࠐP   㿘< > %`` 2 @`!$ <>Ӑ"X*` €$ 8`à >  &  @*$ @$ 8ĵ$ N$`$ 8` 2`H @ $ @`H>   <`H  *` * " *  * " * <`H&㾀> #`$''<> o:Ґ"8& `  \ 0  $a  `[$a 2  m "`F a`  t#  > %$`4``2 @  " <4`$` X`< "`һ`$"a  2  "` ;4`@` $``X< a2`  2Kc 2@ Ï &ݒ Ç`$` $`4`X <@ "d" <u# > o$B"P P > 2 2 > 2\ 8> 2l 8| 8 < "   <ༀ  `2``"`<`@ 4$ " @  2 `@" "  2   , `@  " "  @  2  㿘' > o9" `"/ "  @"' : 2   (@?& $@&&>"(@ʐ $ & :  `$ $   '> o@> o$:" 㿘& ` L<@ 2@P`(@?`(J7 > H@ "2 X  @0- `"ಀ" > o":d> o99#@ > A>   ""  &> o@8> o#H:Rd 㿘& @_  ?&,    $    㿘` ` ` @& ?# ?*  *2` 2  & `.괆<.` (@?I    㿘  "f. @@6&@  , f@   ݲ`f@"   㿐 .`&,  `R &?*  n&  0q H  $&@ 2 &@Q &: * N& : .&@B2  `2"  @ 6  N "*``@ &N  @ 6 N "*``@ &N @g - :`*N & :   > o#x9ϖ$> o8!# * .  .`&,$ @` ?2` ,& $H  㿐 .`f, `|  ?f*  f " 0m H`(@Β `(: * L& : 5" : 6  @   @   > o#9kd> o7#"@L *` .`  *``> p 9Xd> p7 :*  &+@, `<f,?$`  ?2 ,ff,@ ` 2`I`(H[ 㿐   $@Ð&@ @ > p 9 @> p @֔X0:&,*`?&*  P& 0* H  $@=&@ `:`*L@ &@ :  @  > p h8$> p7C  * +,@  &,`$   2 ,&㿐 @` 8 (> p  7$$@i&,,  ?&* & A 08 `H@ (6`L@ `: 6` > p 8$L&`6`> p6! @ ` +@*@,@  ,&,`$  <  @ 2&,@ `?2`,& 㿘 ``$@&`$2 `$ `6" @ܔ@   @Ԕ   > p! d8\ > p6!@" N@*   *   > p 8Jd> p6!`㿘> pa$6 0 ?'T'P'X'`' ` S .` ?# -?* *@ 2 @2@ #?f?V Q0ђaP  *` +  2 2 % % $ `% f \ 'fX*@ `" TH@<" @  4> p6!!  * ?c '?** @ 2 @?2@ '#?>'   PB l% 'Ė f 'f*@ " TH@<" @E 2' @ @*`* @22` +   %   '`%  S ` M,` Ö P ,`%% *  f ǐf', <"TH@] "`@ `'* @*`@ * ,  2 2` + $ X ,`;,`* f?^ }?# H+` 9? ** @ 2 @2@ @ 5? E UP XX %**` * , @ 2 @ 2 % @+ % `$ ff B f'X, # T H@ <" @ T"@B Xf? 4f  'f, " T Tb#@"@  @ff`@  &D "@* * @f? "> p4Ȑ!@*X H`$ z@,`* ' f Ő' 0`@" 0Ѡ @$4   " `% % 㿘 "   ` "      @  `X ఀa쀧 > p` > p4g"H`'@`L@@?"Ȁ "Đ  L'đ.` ?c ?* *2`  $2 * ?&`ܰ `` @ԑ.`   * *  @3`* @ ( 3  2( @ 2 @ `` '@&  ` *` ?# ?*  *2` 2?   > p"p5> p3"0 k   &`L   0"2`> p3ː" 0$ ,@ $ 0$ T> ` ,`j", ? H+`c *`*?  2Đ 2 `, `)`( `@#@ė.` ?( @ @` '@ @ @ .` H ?( @ "@Đ? 'Ā`g   "$$,@`&?& 㿘$A?#? ** 2` 2 &@  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`   ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &`  ** 2` 2 &` ** 2` 2 &`  $ ** 2` 2 &`$ ( ** 2` 2 &`( , ** 2` 2 &`, 0 **@ 2 @2@ &`0 4 2`*  6`4 6 @ `2 *`@6`6 8 2`*  6`8 : @ `2 *`@6`: < 2`*  6`< > @ `2 *`@6`> @ ** 2` 2 &`@ D ** 2` 2 &`D H ** 2` 2 &`H L **@ 2 @2@ &`L P 2`*  6`P R @ `2 *`@6`R T **@ 2 @2@ &`T X 2`*  6`X Z @ `2 *`@6`Z \ ** 2` 2 &`\ ` ** 2` 2 &`` d **2`  2 &`d Ș @ @ *`+  3` 2` &`ȁ㿘6 @E?5? ?`. (6`0& @. (6`0& (. 6`6 & 0(6  0(6 (06 Ķ 㿘? @ `2 *`@6@ ?  2`*  6` `( @ `2*`@ 6`  (  2* 6`  <+`( 3  0&` +`( 3  0&` +`( 3  0&`  +`( 3  0&` +`( 3  0&` +`( 3  0&` +`( 3  0&`  d+`( 3  0&`d h+`( 3  0&`h l(+`3   0&`l p  + (33  ?&`p㿐 > % a(  ``D > p" "5  21  $ `X <`2      @?>    *`" *  * '' $ $       @  x ` 㿈 X`< 2i >    *`" *  '* ` '` $`"@$  "H`B $ p0C#@  `& B&       `&  7    24&(1&&@&@ߐD  T`T 2B& @v@vl`aT T `&    '2&+& @  TTT 2& &@v_@v;T$H@T`(T&T&  : D&@B??'&2`$ '&2 @X$'D'&: 'L   Ȳ? О? ؆??  ? ?  ? ?'@ 6 "@ ."@ `&    D=ǔ <=Ô <&  (> ֒ >   T \?'&2`" '& 2 @(?"@'  8? @ @ *`* 2 2` &@, @kP 2HP@` 'H&H 'H@ $ն ?# ,+?@ @*` @* 2 2`  &@&H: 'H> p 0 D@".H> p  D@".`2 & `l > p`p > p.ؐ#x&   H "@ & & 㿈  ''X'P    2 ??P@: ' Ř `0" >  `, ",`0`<@ `8$`0$$`T> p.#״= PX" `H ] <ʒ,2" * @̐ 2'2 ??9?)&@?#, ? @ @ *`* 2 2`  . ??| 2'?ݲ@ $P "`@0,  ?c ? + *` 2 3  . ?N 2'`  X`0 $`07X"((((( 㿘 !@?c ?*` * 2 2 &@   .`.`@&``` `6``> #  ' < ` &  2  ??? ?'''''x    4 .o "@ @' ޔ 4?$c* @ f @  E`"@&@`@@: =`  * 2` 2ݠ =   `   2  8#@ #@`  '@ ""@"@> # > p=#h ?` @'` `''@ `'`'    &'& `.ర J @ X <`@?  7   '耥2 X @X`  ?`L ' |`"$  @($ $   'ܤ@   :`   @  ' ?@= '@ ` "   :   @a  ` ??'' H@   > 2 `@͔ ` > q!?  %  $ V `/ ? 2`*  * 2  ?"@`@` 2'  쀢' '耢@2  @& "  `2  `@A  " ? 2` *  @$   * 2` ' @m䀢  | '$ ;2G` @"C` "?`X <`"`A  :`  ?@/<'$  $ t$ t$ @&'@?< $ x`$ `ؐ(` $`̒ [`@$` ?@  ? ? + *2 @ @3 @ $   * 2 $   ?   > q<   ?`$ $  @  $ |? @:`Ң ? @"@$ t$ t  2X&   " "& " & @ "&  &'`0Ԁ+ @(`` |   2Xu   n &`($`f ̒ Ӭ`@\$`@0̒ Ӡ`%@$`X `  ̐ј C`*@?$`؀`0 @-̐ч  "`-0.*@ $`   2X&  ؀ @ ̒ [`@$`&`@ 㿘? #`  `  * 2` ` > q$ 0 > q P` ? > q h > q @? *` * 2 2 > q ?@# ?*  *2` 2 > q Ȓ,> q*i! X> # '(&> q*Z!( ?# ?*  *@2@ 2@ '/ L #` ` < 2 ?` > h*` €           //8ot` = ??> q*!@ :2+    ?Ț'''ؒ 7'''''c`X`H  > q)!X?@,:$`$:   @ ? c 2` *   t?耤@ &" `  *`@ @4 @   2 *  "@@ 7t@  @@@?> q)!x# @ `*`2 @76 ?> q!+-> q)!#@`*2  *`@ @74 7ҝ` $x`"@  :`   > qi!؁㿐  t` :   @ ("" :   @ ?  @ ` *`2@  * 2 3 J `$ 㿐 :   @̘ @`?# ?*  *@2@ 2@ "` `L %``  <` 2 ?` > *` €           * *  `$ `    2U P` ܐ  #\#`#h#d#l   2A ܀ 2=  $ "?  40 L .`L .2& ?c ?*` +  2 3  ?   *2 @   D 4 @8  `` ` 'G E B ?*# 2< ?  3 ? *  *@2@ 2 @ @`$ {ܒX  ܰ 2'< ߒ  #`#\ #d#h#l   Z  2> q)!> q( " N㿀  ` `> q> q"8'bH`<`X @@ 2 ഀ 2 > q> q"X'bH ( > q> q"p'ےbH   @E; B?`  2`` (`0 2  `@  b   _'@z`    `$' <2@(*@@ ?$ ?'#\#`  ?n +%$`@$6`H `Hi '` `  b   ` "`X`X  <@  %㿐 `> q> q"8'6b 2`< "#  > q%> q %> q" <  @  `а  > q> q"'b> q"'b`,   : @f@D B?2`<@  `< `` B    _  `    `_ @   @"* $ ?    D <  B 4       @m%@l@"@@& H`  w 5  "  %`2@       35%@ @ b $ <@ `  g 㿐  f@' f? X0 f H @ & '㿐> U"> ב*" *  < 0*  T:`   ;"5 t 0@20 t \ +  Λ 2% t` @2  t < " t T4 t: $ t> qG" <> q T;  "'?> q%Ґ# t ʀ㿘 㿐>  > U`x> ap  > q> db!>   > q%#> q> q#cC  [ 0J@8  ?"#2 H 07> \" "\@  #b\ "@b\" a "$@6 !2O  L`  @) @  ?2B @W D 0@)  2E l  `<@@"ia N #`@  @ @   :   6:@ǒ  ِ .`<@0@! N +`<@( ``˧ @0! ͓ 0 ͏: .6: 6: . @O @&(&&$&&,ʐ  < "  > O `& ~x `"`<`< !!`V ߖ 0\ ?`<@@2@6  L "aG0A !1("d@A" L  ` ?1V @"@ @22Ŕ Z` Y1  Z`@@"" N  : .>  &0> q#&@  㿐`D `D ``  = ``  3 "`> q$1#@ (?@q,* @@ @i$`?@*@` @  $?@ H* @@ 9N0Kx`< 2a      > r# `h ?p " (:  @ʒ$$?˜ܰ  `< H `@ "a0Y`  k" @$, ? :<` 4 8 `$$$ $@$4 ($ @$$#$($* ?{ܰ ܐ`H4Z, ?@j &>''''c,㿈` ?  >  @    J `<   ?N  `h Ě' $찒  @H 2  ! @L!  &0&0 @C% `H A'  ,: 2 4:4: , " @@$, ? :<` 4 8 `$$ $$@*$4 ( $$@#$ $(3 ഔ  $$,$* ?찒 .`H3, ?@' &` &a&`d`< < &`@&`h&`<% %%  2 %  % (% $`&" ,/ 쀢 "`%  ɜ     &a㿘6` `@C >a` L& 2`@  2 ` : 2` 4 :@ ``< "``" ``L&`   `W?`&,ђ Β ˒ `<*@$`<$a㿘!  ȸ`   ʥ 㿘!; cS`8 "f> r" (f(2Ӓ```L5@`d 1 f  f D/`D    @   +` + *@ " @ 􀢀 񀢀   2݀f f D`D2&`f&``@"&` ` &``"@&`@&`` &` `T/ Z` / Z `@  㿘 <  ` 2` p ` ``g  ` `L` 2&@Đ 㿈! Lf   > r 8#d> r!l H>a''''耢 2` `  2  Lf  > ,f $`0@ 2㿐a j & > B    & H! @ܒ! > r` T ʘ "$ $$ $$h$ "( ϐ0_@G,* @ߐ@?$ ?@*@   "$2B&@ H* @/0  $ > B$$4> B ਐ姖 " !& $  > A>   ""$X <` $ &㿐!`  2) F (1m&( ! F` &`  ` ``@ F&&   2@ "`"` -㿘   $ | `H.$` O㿘` f   + f`$f* *   O f1f, ? Hf`f &f  2㿘 8?c  * 2p cS " Le ? * *` 2 2 ?> r h   *`*   2  2 `> r ! 0A "?  T @*` @* 2 @  2`  > r X  * 2` > r  ` @*` @* 2 @  2` ?> r !^ 0`2  d @ @*`* @ 2 2` ?  㿘 > %a* @  @ 㿘 > %a* @   @r  @`  #  D?c ?*` * 2 2 # @ @" <@$@`฀  `   㿘   ` "` `` ` `  # > #   >  H @# ; H > #  #  ?#` c#` ?3` 3` #` #`    (*` 20 #`D  ;` #`(#`$ #`0#`, #`8#`4 0#`@ 2#`@ #`<`<( #` 2`X@#` L#`   2`*  *` ;`H`<#@ H;`P㿘     T ?2ϰ  ?2˰  ?2ǰ  ?ð  D? L? rI!@< 2XŞK X@ŖC   ϔ ʼn06 #@( ~%  0" v ` 4 $   7   " `   $ 4 `ܙ Ō =`` `  ` `'`'`$``$2`X> rې!XX@  " X@ (؀ z ؀ ki01  `0߰  ` ڀ ( < Ӱ KI` ? %`> r!p %@ܔPܐ\  ఐ#`@ఐ   ` 0     `<  8     ؀   v ܔؒ t ` `J`.`   `  ܔĻ W $`  Ӑب  ```4`$`  6  ܒ ĝf   .ܒ Ē 2%# R " 6  N@2> rߐ! @ب  2;  `@> rȐ! #@  ` 4 $   ݖ   I   `4 $   Ŗ  l` @> r`@> r! `@2 > r!Ȁ""   `"   @"  ԰  <    ư B € A H      $ 4  ?5 ?*` 5 > r:!   ͖   % v` ? %`> r$!p܀   "`> r"ư 0_ > r "JH   4  $  #`#\ #d#h#l   3 1  > r?  > r ʇ  ?#?*  .@2@ 6@ '#`#\ #d#h#l    t 2    ?`5 %   ?%    X`0   ` ?$`ܔ/   `` $`4`08܁`` `$`> rw"@ #@  !  ܰ 2܄       4`` 4`$`4`# <x4``4$  m  y@ `?# ?*  *@2@ 2@ , '7/` `L  .``  / ./? ?* +  2` 3  '   f? * 2 7/` `L  .`` 2/ .  /#`/#\ #d#h#l   / 2 X ! @&H $`> rܐ"X$` $`p "` $4 " ``4` $` "@X 㿘   ` b9  . B  2 % B "  0L `  $ k4 ϐ 4   \ `㿀 (`  @X '@ X @@ 6  ఔ '  $  $   #`#\  #d#h#l   㿘 X @@ 2  ഀ 2  &    㿐 `   #\   P 㿐$`> r"p!<@& @ ߄ ؓ =0N @ > %4  2     4 4 $  " < 4  ,  J  ;4     2_ 2@U  &M  4  $ "`<㿘   b`?    `?罔 㿘> %!(`   D > r" c " /&   H$   N㿘> Bc`c`?@  > r> r> r"Вb(R B6@ & > rW#P* @㿘> B#`#`@   > r> r> r"Вb(3 ^ 6@@  & > r6#x.` &.㿘> B#`#`@   > r> r> r"Вb( 6@ @ @ > r#.` @`> r #``"    > W  €   .`  > r#  "  *`"   $  "㿘> Bc`c`?@  > r> r> r"Вb(Ŕ 6@`@ @ &` > rʐ#.`@ 2"@ > s `` @  *` ?.`# `@ `* "`?#`㿘  &   &  $    " $@ $ ?   @ 0@ 㿘  ?@0' &    ?&  $    " $@j $ ?   @z?0@u?㿐> #a> B> s#\ `X (  = 㿘> B#`#`  > r> s> s"В``$   6> r> s> s"В`` 뀠> B@?2 ` ". Y* 2  * & & & && & $&  b &  b  & ݒ b  &  ֔ b ֑ b`    @*㿘  > r   > r> s> s"В``Ȕ! q b n b k b $ ?"> Bc b> B y㿘> Bc`c` ? $ P"@   L> r> s> s"В`` !7 @ 2 > r> s> s"В``X!86@ ` `$ ?@ 0` `$ ?@ 6`" @ `& `$*  " * ? ""$`ث. 2 `$  ?  b-@  -`$ b?$`$- b 3 b . b) ` & `> r> s> s"В``-!% `*``$*` $``*$~`*  @U`$` `*$q` * @H`$#$``*$b`* @9 `@ $`$" @# `&2* *  $ ?$" b$` Ս$`Պ bՇ b ?Հ b㿘> B#`#` $ "   P> r> s> s"В``!2 L` @ .1> W` , @ "     € &` 0 '> W`,   L@  @6 `` *`  €` &`㿘  #> s ,  *` `@ ?a؀ "@@   & & & 㿘`P 28 "*`$`$> B` ch"2   , @࢒&.@@&'@@* `$`$@@Ӓ`$` &`L"@ &`P`8 > B`8 ?&`8`$ ` `" ? `> r> s> s"В``  "v 2> B@? `  "- N.2  * $ $ $$ $ $$ $  b $  bٔ  $ Ғ b  $  ԉ b Ԇ b  W`P    `8 &`8 $ 0H@6! `L+` @ *`  "  @ `"`@ "@  "   *`"   $ `@&`L +` "   @ٕ* `&    ?&  $  ? c`` `$" `?`L@2 `8&`P ?&`8&`L㿐`P @V?#-> s-`@ - `2> s!u $?`0 2;`(   4`(0". @   #\   @=  `  "> s@> s@D"8@9ϒ- ?$ " `( @@9n6`(`@&㿘> Bc`c`? > r> s> r"В``(#\6 2 > s"H" " 4$> s "p 2 @   &` `" &@㿘  b* ה  & $?& $  @*  $  8"`"@㿘  $@@- .`,``  8 @&@ $  $ "& $ $  @@ڑ,`` -`  8 ? @@> s"S,-@,``  8 @$ $  $ "&  $$&  <> sj"@ @`8  $$ %8 $ $ "`2@@@@,`㿘 6@:  6   *  -* , @& ! *@"@  @  +`  ?+ "    *`"  ?& ` @qˀ㿘> B#p > C: "a> t"@"㿘> B#``|`x@"@ 8$`|> 2cP. @   b> s#> sՐ#8 б " " > t`""`" " @`x `@$`$`x> C $ `""`" > B`|  |> C` > B` "` "" " 㿘    0  @D !  " ( 0  ?> s> s> s#HcXg $ 0$  "> W 4 (  €@=@> C`> B& c``"` "`㿘  @Nے   & > Bc``p?"`p   0    .2 ." 0㿘> t" "!   @6 ,`@  6  @ "   `@&  2  㿘  @b`"$ ``" `> s> s # ` @Ny $`  (> [?X# @4 (> W`€ @6Ð㿘 (>` $ * @ @ >` 2  2 > B !   &" $& > &   @ܔ @㿘`  > tD L > t ` @7 @   `1 > t> t> t ``px!\* @ "@   " ?" `"`"> B!  0` .`@"@㿘  @0  ( &/> B $*@`> B#`+> B `,  " @M˒ p?$p  , @ a  & $ $ʒ c| /> B> B#` , @ " @M `p?$`p  &  Я c| ƒ㿘> B#` `  . 6 > 2 > t> t Ƞ"?$  $ $  "` > 2> t`"> t   "> B"|ޒ  $ $ $ ``*> 2 6` @ : ! 8  ck ( $ $> tĐ!0. Ο c $ > t!X@ `  ?$ > 2"$ $$  $ $ > tԖԀ $ ,Ԑ ,"`0"$ 0㿐> tЀ  "> t""> t!> #!"b> B> t!a X   z#\> B> t#\"|a 4  p 㿘@ " 㿘@㿘 ` 4 1&  ,`" 0 0"`0 0 ,"@   > B#` ( "> W 4 (    €@ @-@;U  2 (`  & А㿘 `  > Bc`    * : : > B`8    +@; 8D ;`  2 (  > t!`` * :  `  :`@ܮd2`*  *`  2 @ `  ` `" @4m ` f   $` ` 2] $` W @ :E4 @3 C` "  49> t 6> t 02> t 0 21 , 2-> W  €@4k$  0 2 , 2 (  4 (> W  €` @0 @\@:e!Р` ``4`` 㿐'Td@h   @Z > B?#`c?H@3 1 @      @  J `* `  .`@ `#\  @8p "@`(`. ` 4`(4`.@`( `! @ > B `4`(& > B#`` :D@T"   @ ?#  2|> B@w> B!> B#` @ۑ `!  `4`(> t" `4`(& @3 2`(#\  @8  2`.> t@? ! 4`. >> B  "  @  `* ` .`@`2@4`(@K~  `( ?'?ƒ@J `(? @ @94`(0> [b@ 4`(€&> B#`` :D@{ 㿘 (   > t> t> t ``p6$> W  €> B#h@ @,`&@@9O  "   "  > t> t> t ``p%     > t> t> t ``p8%  㿘a @J 㿘> t"Ԁ`@ "`,0  㿘  @,  ( &?  $+ @`"? `*6 ` *`@-@ " (&*@`2 ?< $ 6  , @ 6  @  2  &  㿀> B#h'.@  :`  #\'  #`#d= ",  &  (` " > t> t> t ``pX i%˔ @I ?(# @2(> ["X €> W`€ @2E> t > t 㿘 > O* * b" * ` @`Z>*!@U>*"@QO 1> B@?E#` :F #> tb܀`& (`2` ` (`` `&`> t> t"" b`` &``&`` ?,&`  bܰ``2` `̓ b > 2#& &&  & &  & & & bb܀`&  "`$$b& $ " 㿘  ?1&   > t   > t> t> t"b !9    & > t> t8""쀖   ` $"`$ $ " W>  㿘  ( 8'L\  ` >   `  W Y  `> O*` * " *      0&@ @ `B -> W$/> @^~ `< @@      + > t@<Ő#H* > B#` :`@ D @ L> BL,@?   >  `   㿘 +>  & &   2"    )> '> v $   〖    `"ה 2   $  @  2  (  ` #``  þ   $  " *&  `8 " `( ` ``  æ &  `& , `8     Z   8`  > t ` ` ` Ä > t@<#x   `   t 㿐> B#` `"   >  a,@  "@>  a,D "D> B#`    0  ; "1#\ ( `! `ݰ 4 (В`$       4 > t ", <     $ > t" ,     @4        > t`$@;#       `$ @H(  2   $ ` "`> t #X  ߔ   @  Ք  ܢ  $܀ L` ( " (쬐 (?# @` 4 (> W  €Y`     ® ԰  C$Ԁ``2  > t> t> u#cȖ !&@GM ?& @5`     ‹ # > ["@@@/`  "  L :"      n   $> 2#P> B'Lc`c`  `?'D'P# .@ '' ,'ؑH/` /> Ca@H @ H*L:H 0  ' - ؔ'<''` > > t K#X`   @ה쀢  >       $" *'`8  `(>     ' `'耢M`< P  > ֒   ٔ ߰ ` 3 H 'HL`H 'HH`2'P8 P (  > `    > B`` "`P` ( D>      D`1T> 2* c(*  @  > B> t> t> u#cȖ( "ѐ`  @ #2 8 $@ " 2 ?.@ #  @ 'D   `   L% <  T`2N'@`&$ #. @ "   "  ( 2  0 2  , 2  > W  €@.F &. > B#``4` %  .@ `     `.`@> B``.@ '@@R X ?@ > W T `9&@`"6&@ X0&@@" *'@@ `&> B`0 ##``( ! #`@.= > B` > Wؒ`"   `H   0`@4> B#```@@ ` P @#`#\` <LX `s 0r@ 2p'L> B#`X "`  `0%`8B 'PP P #\ @ T#`#d PP`G'L @C> B#` -> t9> t`0/> B`( @> u#Ȗ hq# 'L@- > W $8`H   04`@?`( 2`(> B#``@ɠ @'L@ - @<` ``> u0> u> P  ` 0`@ `2< 9`#\     @1 2 >  `   > u@8 @-> W  € "  `0?"`0 ?"  . 2.$ .(  @ 6.6(&`Y> B U> B` G$   #\   @1B  2,` "D>     ph@ > t> t> u#cȖ$@2̰  "> u`$@8 \@->(?# @6( Lܖ v# @? $@c` `"  HP  0> W @4@܀ >    K > B#``h`p  > t> t> u#cȖa$> u@7֐!L  @+(?# @6(> @,>   % L?'L ? P> t> t> u#cȖ2%.  `8 @ L > ` !,@`"@>  ,bD "bD   > B#`  "'P܄ ` `4" `8  P P #\  T#`#d`LP ` `> t> t> u#cȖ%Wİ > > u D0  泘 > B#``ؐ $`` "> > tِ#X  ` @ > `    `ܠ  $`L (`  `L E"  > ֒   v  -L`( LQ L( > B#` Ԓ`" $  > t> t> u#cȖ@y%€ /@+ L? (c %2 (c`> B#`! $!8`2L0 P`2#\Զ     @/  LL`( L L?(# @2(@+L> `     > u`$ @6!h@+ɒ(!?# > W6(`L€ L`( Lܐ L#( 2(L  $@0  @0'L> u!xm L#\8@?    @/d  =LL> `( 禐 @+*LL? (c 2 (>     > B#``p`h@ > t> t> u#cȖƔ&M@`̰  &`8`> u`&`@6.!m؀?"> B`a"a@+H` > W  €LL`( L] L? (c 2 (L@*ڮ > B#`a  "a  Lܖ f# HP  0> W @4@܀ *L( "(.(?# @6(>    < > B#``h`p  > t> t> u#cȖR&> u2 @5Ő!؀`@)Ґ. ?(# @> B6(` @   6(@*y( "((?c 6(>      㿘%> B   @ 0`  㿘 !> > t#X   Δ @   Ŕ 㿈  > t> t> u#cȖڔ'2 H@ > t L > t> t> u#cȖ˔'@@l @> uѐ"(v> D x%> t'> t> W  > u"X` @:`$> uȖ'N@  (`@> u` ('Ȗ'Q H`> B@TĒ> B#` > 2ch !2 > D d2: + "@ *` @ 2@ @#@    2: 2?? * "@*`*  *  "c`@)'c`@@ > W㿘  > Bcd@8@5> 2P` !> > uC"`    P@P`   > 2cL   > !(@ > Ub* @* 㿘> B#d@ 8  @ 㿘> B#d@ 8  @ 㿘a,&` @> 2@ &` > 2cP Ȗ  "" > u#&`  @   D`2"\@`C㿘!,#> 2 @>% ,cP & ,cP@&!,  :`0  :8 :`  > B:(c```(   :`P㿘> 2P !,|@ > u#0H /m4N 1* .N 1  @/c , & ,H 0> B& c`` "`㿘> !H  J1 2, 2J?* @ "@@ $  2J1` > B> > u"`X  ! > c```2 > u > @3#h> 㿘> !H    . "-> 2 ,  2#  2 L 1   (  4  X@ @@$`(    2 ,`> B`@* 2@   " @㿘H /m * .  ,N 1 ?`& ,@.ΐH 0> Bc`& `> 2 "`!,P”@  @S@㿐> B#``2> C> u#  @ > D("``@(@ @@D3Å@/Z@+, 㿐  @@  =#@{ (> B$ > B#` @  8   e 3> 2cP@   X` U` 4* *K J $@8RcP $ !   /> +> v $   c     `" 2   $ cP@~@cP` >   `   @N   cP㿈>'> C"!@> Cs"a< > t> t> CcȖ"a8""" ""> B#`#!L> t"##"?"" ""!> t#!P"" @6> [#"耢@$"E#'#`&  #\ ?@ j? b> uΐ#b> 2"#P㿐\`@> B#dc'  . #`#\ ?@ I? "@> v (&@D  @@ 2 @> v `@$@@k > v 㿘 > 2"Ԁ@ > B> v> v> v `Жk!K#`&2  *  @G   @% ` ( "` 4 ( M6@ @,u`@@  0+  (      $8 2 $( ( "  4 (@`!@,I 2 㿘 ? > B> v> v> v `Ж8 !#` &2@  *`@0@g!> v#> v'> v%> v   @%S #``( "`. `Ж`!   `Ж!> v `Ж۔!@, #`@@ ۘ 0: `7 #> v%> v'> v` ,` `$@8' 2"`$(`( "`.`Ж`!̀  > v`Ж!> v`Ж!@+ɐ `2` 㿈> [#耢@ > B> v> v> v `Ж!#`  H## @ . '#`#\?@ ? G  > 2C@@> #P`H6" ?#%> v   #\ @)Ú ( 2(2 `@0? > W> [#|4  #` 4 @ #`&@2Ҙ 㿘> B#d@ 8 @@ 㿐 "> B   #> v &   c   >  `"ڔ 2   & > B#` @ 8 @ @O᭐ >      @ 㿈> [#耢@ > B> v> v> v `Ж˔"#` > C` H @ #'.@ '#`#\?@ ]? > 2O #P``HA" ?#+> v  @# " (  > v"2(  "b(k "`#\  @( ( 2(> W> v@/"8` 4 @ `&@   `Ƞ  @£$㿘@ 㿈> [#耢@ > B> v> v> v `ЖM"#d> C H#'a8@ '#`.@ #\?@ ?  㿈> [#耢@ > B> v> v> v `Ж(##d L@  H.@ "@@  #> C`  Hc''#`#\@   > vH   `㿘?Ŗ?㿘H / * ' > B#`O`?H p@㿘H / * ' > B#`H 0p " > v̐"x  '> B#`-> '''''` "`> v"X  } @ B쀢     p   $" *'`8  `(   \ ' `'耢V L ( `6  $   ؒ@M `ؒ@  8`ؒ@ ?  ? > B#` @ Π     ` *@& @    2v' Ԑ": ` @$ @2 㿘".     > W  €  &@+"@ P_   # !?> > v D  ݽ  0 20> W  €0`@"^&0@ "@@ &@㿀 `(` `P`   @& #\#d#`  '  '     Հ  >   `  v   ' `& #\#`#d      ?> > v D  U װ > B# c` ؐ $  ` 7> > vw"X`  >   @  4   ܶ  $  (`   L "    >  `    $`(   `( ` $ > v."€ y @"` ? (c 2 (o `0   > W  € `0 "`0@!@H"@   &@"@`@"4&@`( ? 0;O `( ޜ ? (c 2 ( >   `   (?&"``0 2  > W  € `0 "`0@!@"@ &@(` l? (c 2 ( 㿐Q> B#`4#> ր   `  n > v@-" 2 !  $  ` "`> v"X`  X   @ > ֐  M   ܒ  $ ܀`"q #\     @%К ?(# @6(@"@ `@ &@ W&0#`9%> ր      "I?黐> v@," 2`!  $` ` "`> v<"X     @ > ֐    `ܒ  $`܀`" } Ɛ #\   @%x ?(# @6(@!G@ "@@ &@㿘`@ ? "@g `㿘`-%> v#> v 0  ?$ 0@  0      ( "> Wc(В  €@& ٲ㿘    @&㿘& $ ( & & & @& D& > v& H& Lx& & & &    N & & & H/` /> C@@ "@ "`"@& H 0 㿐 "   #> v &   c 5  >  `"+ 2   & @  >      @ w  " 㿘 ?  &  H L@=I̒ 㿘`@L "` "L$ `2&$` @ $`@" @`$`` &``@@2"`"@&&@$`@` &`@$ $`  $   $ " @$` $ @2"`"@&N$  " @ 2@$ $` $ L2&$` ` $@`" @^`$`` &``@@2"`"@&&`$`@M` &`@G$ $`  $  $" @7$` $ @2"`"@&$$@& `$ @ $```"` "V`" 㿘 2 ` 2'& &` ` &`" @`&`` &`@@2"`"@&&&`@ &@$ `    ` "& `` 2)` 2" &   & " @&` $ @2"`"@&$ &@ $ @&`` & &`  2" ` &`" @`&`` &`@@2"`"@&&`&" &` @ &@" @z`&`` &`@@2"`"@&&&`@i &@c$ @   "&  & Y" 2*`  2$ &  &" @9&` $ @2"`"@&$&@( $ @"&@` & &`  2" @ &@" @`&`` &`@@2"`"@&&&`@ &@$  " 2@2& 㿘@2`K` F @ "` 2``` $" &2$$@$`"@$@`$``$`` $` ``" &@2"`"@`@$ @" ` 2" @$    0`` $" &2$$@$ o㿘@  `  ? @ `  2  &` &`&`  &@`6$ $@V$ $@  " `  @ ?@   2    "  20   " "  `@`8`  8㿐 $ޒ? `@ > w> w 0`8 (!> v'> v)> v` ( `$  L2`$#㠖#&  "@`   L2 #㠖# 䀢" #\#\> w  `” 0Wz $ 2` $?  `< " ` (` ` @ > w x0. D` (@0``@ > w X}0> w u0 !> w @]k?㿐> 2#> C> wD"D!("`"` "`"`> D> w,",!H"" ""> D> w"!`"`"` "`"`> C> w " !"" ""> D@"@> w" ##a" " " > C ?" > tc" h#h"`"h``!> #!> C> w"<a#\   h > C> w!Xa `   ^#\> C> w#4a#\ `  T 㿘 >  T`$> 2H /f * ' > C `h  "`hH 0   > w 2#", X#P > #" `> wa@" > C#4  , X" `> wa@"Ԑ > C!X , X@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P$ $< P `(`&`0@ B >`0&`  P  L⼒`L  ( & `$ ` $ " "      L 2  > v> v> v#c  $"@$ $  $ > v#   L2  > v> v> v#c $"@&B&2 "`8   L2  > v> v> v#c $"@&#&2`8  ? (0 `( €㿘 >  T`$> 2H /f * ' > C `h  "`hH 0   > w G#", X#P > #" `> wa@! > C#43  , X" `> wa@! > C!X$ , X@<`< `< `< ` < `(< (`0< 0`8< 8`@< @`H< H`P< P&`$$ `  (`& 0@ B < 0`P `Lђ L ( $   L2  > v> v> v#c۔ $"@&~&2  & $ `$ &` "     L2  > v> v> v#c  $"@$ $ ݒ > v#   L2  > v> v> v#c $"@&>&2 "`8   L2  > v> v> v#c| $"@&&2`8  ; (0 `( €㿈`4   04 5`      >  `  `?`   &  2+@" Ѱ  2"@    #> v &   c   >  `" 2   & @\#d#`#\@*  > C >    є  aD "aD  ?   > 2> v> v> w#cؔ##P `H@" q (`$@@m@k`(f"`8` `0"@B[@Y`8 T`<P`@L`DH`TD`H @`P > D  8> D`,  "`, `"`P@`P Ғ`$$`$`   L2  > v> v> v#cm `$"@&`&```2` @& 2 `@"  @` @2 > D` "` >  T`$> 2H /f * ' > C `h  "`hH 0   > w 5#", X#P > #" `> wa@ > C#4!  , X" `> wa@א > C!X , X@@$ $< 0$ $ ( $ 8$ 8  8 $ 8 $ 8$ <$ @$ D$ T$ H> B#h *@  ܦ $ P$ L$ L$ P  & $ `$ $` "     L2  > v> v> v#c  $"@$ $  $ߒ > v#`   L2  > v> v> v#c `$"@&`@&```2` " `   L2  > v> v> v#c~ `$"@&`!&```2`  @& `$ @:&  >    <    (  > C   @  "  $  > D@ @/" 4 `  D` $ ("" @*$@   (  @* "#   2$"#  㿐@?\' @F  ?@ @Sߒ'&@ L@     (      > Bcd*㿀`'X'HXd  > v> v> w#cƔ$q@  H> v> v> w#c$rH`H @ 'H`LH@0@`H@ ``(@ $'H> @  $'H@H`L@ـ א`( @"'`` :'`ڰ #\ Hb 2'``$ '  H`$ `"``$:`$`:  `"* `$ * `(`@ `"*'􀢠H$@ *'H#\H 2r @:I`n`$'H#\`H "`\1> v`'> v> w'  :cc@$ꀢ" * '*  $'H#\HК * $'H?@DH H?@'HH`L@ `( @"'`` *ܰ '`H&2#d#`#\㿐 H@* L8@85  @< 2  &    @  ( &  ('& +> v-> v $ $  H"  $ Ht 8 "7 ( `0> [#耢> wc`D%2 > W!€ > 2#P`H $ "  ("@  8 @3 $> 2#P`H $ "  (ﮒ"@  8$ ( ?$ 8 @3 $ 2  &   $&   #   "  `%> v`   L2 c `$"@&`&```2``" #> v`   L2 cc۔ `$"@&`~&```2` "& $ ' *] $&㿘 c> C '> v)> v#> w H " P> w㐒#&  > B ch $ L" 2 2 8  p (  X"  X ( `" X@  X  H /f4h* 'h& $hH 0  > #" ` @=a> C#41 " ` @1a> C!X% 2 H㿐> B#d H@  * ' #` #\ `?㿐 `  `$2 `( 2| `P v   $+ (> w> w @ ($@ (ʖ> w"      > w#  > w #(2 > w#@"`&  @"& ""`      L2  > v> v> v#c̔  $"@$ o$   2     L2  > v> v> v#cﯔ  $"@$ R$   2   &"` ?& `5> v%> v'> v`   L2  `$"@&`&`  > v#    L2 l  $"@$ $   2 `    L2 Q  $"@$ $   2 Z``2`V&  @2 `&  & "`"`      L2  > v> v> v#c  $"@$ $   2 `    L2  > v> v> v#c  $"@$ $   2  X  H /f * ' > C  h$ " hH 0  > #" `> wa@ > C#4臒 " `> wa@ > C!Xz 㿀> B#` @'L `> v> v> w#cX' '耏`" H> v> v> w#c'H'L 3 Lm  @ '   `!'   )> #> v &   c G   `"> 2   &  ` &@ ` @ &   `  `'  (`'/> w` `$ʔ 8`      غ`8 値   "$ ढ`$@>  T`$> 2H /f * ' > C `h  "`hH 0   > w # / X#P > #" ` @> C#4  / X" ` @> C!XҒ / X " ' ' '  $"@ ' $ ' $ (`' (` "€ 0@B   ? 0``8' 8 @ <' < @' @ D' H' D P' P> Bc` L4  ' L   $  " 2 Ԗ ' L쀥`' T' T%``$@: &  "! '`  @`2&Lऀ    >  ` ਀`?` ଐ &ଐ  L @ ݖ ` ऀ >    ޠ `耢  `" ' &  ` *' & ' h  (d`耢U $@/l ' ?&   $ #   "   `   L2  > v> v> v#c `$"@&`d&```2` `   L2  > v> v> v#c줔 `$"@&`G&```2`'  '` @``" ऀ  >   [   >    P 耢` `Q ऀ "L)> ր #> v &ऐऒ c 1ऀ   `"( 2ଐ &L@ ऀ >         >     7`b `L@ 㿐 2" H   #> v &   c   >  `"֔ 2   &  H@* L8@8 ` @`$w'`! ` 2 `$2 `( 2 `P 2 `8 2  "`8 "`( ; 0  >     㿐 !    #> v &   c l  >  `"b 2   &  H@* L8@8  ` @  ' (@` `8 2M `@2H `@ "= ` *`87  `<&`<&`@&`<`<> [ 8 `` `$ ?bh `H 2` 2` `$`  @  2 `@" ` *`$ >    ݔ 㿐4` 6 [  ! (   #> v &   c   >  `" 2   &  H@* L8@8j   @r  R$ D "  * $ >    z  㿐 2" H   #> v &   c c  >  `"Y 2   &  H@* L8@8    @  (  (4 6 $ T >       "  * $ >       㿐  > v> v> w#c)^$  2" H   )> #> v &   c    `"ܔ 2   &  H@* L8@8 2>  >     3 K @ (   $  @ `  " * H􀦀P H "  ' H $  * $2   >   m   (a ] H 2  8 2 "  <  ( 2     @ $ H < ` ' H $# @ ` ( ?' H  $8 H2  >       "  * H   &  #> `     @  H 2  $ < " B   > x  瀊`& ʼ  @> x 8?' H " * H H? ' H ' H $ 2 H2-    # 瀊`& ʂ       > x  瀊`& l  㿘  > v> v> w#c蚔*\"`   )> #> v &   c d   `"[ 2   & `!` D (@`H "`` &`H`$バ`@2`H `& >    5 հ `  & 2  D >    # ð  (@ `< " ``H 2``$` " `@ 2`<> B#`  2  H@ @ (   >      @ %)> `<`"``H  `8 2`H `2` `( 2 `H` `$ қ `H &`H`@2`<   &   Ŕ  D @`H 2`` `$`< "`G   > xݐ  瀊`& Ɉ  @@> xϐ X`< "``H?&`H`@ 2`< D@" `< " ``H? &`H` &`H`$⺐`@2`<   o  瀊`& L   a  㿐` 2  > v> v> x#cxt+G #> > v~#X `  D  H@ L8@8  >   * ɰ   (8 2> $ @> `  >       *8  '1> v7> vP@(> x#㠖+ek` i> 2#T`"f $&@"^ LΦ "R> B` M` "5 4C> x @> x 0<> x 0 ;> B , 8c` . 2    "0c`> x#㠖ڔ+> W> x#㠖є+  €@ > B 4 0 , > B@? $@5> BĐ!> Bc` 4&@$%      2 '  i@>   b 㿐# @  (@" ` @*  `< 2 `$@ ` 㿘> C j"<@ 㿘 @ @ ꩐`@(Ð @(% & & "`  ఄ ఝ㿘 `  @@9@9d& @㿘 @=` 2`` "`V` !`(`` `)> %> v $``  ܘ`   `"Ӕ 2`` $`` `$`>   `” `Hw`L` 2"`@`` `)> %> v $``  Ū`   `" 2`` $``@$`H$`L   `L2  > v> v> v#c婔  $"@$ L$   2 ` >   `r 0 0 @8@8& @㿐 ? @&  "  2"    #> v &   c D  >  `": 2   &    H L  @'n> C"< &㿘 2"    #> v %   c   >  `" 2   %   L  H  r ( D (+> v-> v/> v3> w8`" ` > x!( 2D> x !` " 4 2`   ό  >  T`$> 2H /f * ' > C `h``"`hH 0 ` > w Ғ# ,`X#P > #" ` @a> C#4ܿ  ,`X" ` @va> C!Xܱ ,`X<< < <  < (< (0< 08< 8@< @H< HP< P P  $ H> B ch $ L" 2   (`"  ` " €   ( @ & $` @`$`"`" `    L 2 cY `$"@$`$` $~ > v\#    L2 c?  $"@$ $   2 `/    L2 c$  $"@$ ǐ$   2  >  T`$> 2H /f * ' > C `h``"`hH 0 ` > w # ,`X#P > #" ` @a> C#4  ,`X" ` @a> C!X ,`X<@<`<`<` <` (<`(0<`08<`8@<`@H<`HP<`P`P  > B` ch`$`L" 2  `(`" `8` "`8€ `8$`H` $`8  @ & $` @ ( $`"`" `    L 2 c㆔ `$"@$`$` $꫒ > v㉐#    L2 cl  $"@$ $   2 `"P    L2 cP  $"@$ $   2 P "H  H    ֚ H  P +α( "@8  @ " 8> ["h<  $8 $8 @  > [bh`<`$ ` 28 &  >    є   㿈 H> x Lƀ! > x !  ƀ @5> xƀ!`2 ( D@.> x"8%> x`0`P` `$`(#``L#dƀ#\`8  F T  F T  F T`D#\`H#``T #d`<ƀ`@`@2`0㿘> x " ƀ  ` 8> x> xƀ"`ƀ"`"> xƀ"  #> x3> x ƀb@  2 ƀb   @~  > xƀ#㾐> #'> xƀ#p (!> x> x# #@ .> x##P 8 *> x , 4ƀ# > x # 0 ƀ $> yƀ `g . 0 "    2> yƀ 8 .> yƀ h . > yƀ   2  "> y> yƀ  .ƀ  .  @> C (* `    0 > C  > C > C Ġ > yƀ  2 > y> yƀ!ƀ!( > y!X\( Dp8娝㿘> `@Ē  2> 2> D@ T> 2#X> `2`@:` d 㿘> !H` J`1   2 ` a 8`` 8` ``2J`1> 2#\(  a%@,` \4 $X=#` '\#\ @ ` ` >8!*` €> DT @ 0> B` !T> ""DoĘ k> B#` X'  ^ \ ` _V S*$ X@ d$ LM > B#` \' c @ X `  _8 5*$ \@k d$ P/ > B#` `' E " X \  _ *$ `@M d$ T > 2#XI -"""" """"" "$"(",> H`8> B`,/J`1+>80(> 2 a> 22X`:`2X`:` "22``2`,> B#` ",   l  "  l "  " "(""" "$ N N㿀`` `@@ '_ ` 2+@    R` ('    2 M'  А@  @ `2( > Bd@ * ' #`#d#\8 2 `  `В (& @ > B& ` `0?"`0`, `0㿈> B#` `  *  8   2 '  #> > yԐ!p `   _ +' ( > 3> y5> y8 " > yaߢ!:$> yaߙ! @"i ` c  $8 "!((`  8`> yaw!# $`2(     ! `@ `` `` )'# 2    ?   > B#`  d "@ '@>@@ ɰ  $   Ѐ 'u} 2`0  $`0T` ` `(`<    `  D  ``@``  `0`, $`0_`0= `<2  `  ?    Z`  `@Ò L` @   B` =``7     2 " #`Ą + `  ; b 2 ( #\;` d #h@ `'@` `0`,?`$`0`0㿐`@`   "> B#d @ @ @ $@ .@ @`/ "  '> > y !p   Д ꕔ   $ "@  "    W@㿐> B#d@`  A$S> @: 8M   "   %> v &      >  `"} 2   &    >    f   >    W   췒  㿘`@ `> B#d @    #@  @       㿘> B#d@`  ` #  G@   0   㿘> B#d@` @  ` #@ 8 >9"* €  @    @    @  㿘> B#` @`  $ * @:   2 H  #c "      㿘> B#d@`   $ * @ A "      㿘@` & 2   d  2 #㿘    㿐\` Ң > B ` :  2ϰ 2˰ `2@@ *  &@@  #@ @@ `??C B < `?@ ) %`@"ɐ!``   ?  ` ? ? `  < v t 2/ @/ -`  @#`#\潖 V`"Y  2"    #> v $   c ژ  >  `"Д 2   $  "``` 6`H   >      @@@   " @`@0 >      `@H&(H> Bh> Cഘ  3@X@P(H4(   2  2  $ 2 H,2D,.> B" > C  .? > B2.``"`. 0 2 > C Ѐ" > C  .?2.` " `  ,2,,(2,> C"  "  " > Bc``"`.2.` "` 㿘 . " .`"  "`> C"  "@ .?# > B6 .c``?"` .`6 ,  `0> y> y> y"hbx ր "> C> C& &  &  ""  .> B c`6 .`> [X "` (` > [#@ ? (# @6 (`.!0 @2 ``> C Ѐ"`` > C `@ `.? > B2`.` `,"`.@> C` ` `@ > B2`.`> C "@ "`" 㿘 (?> Wc 2 (㿘`(?> W# 2`(㿘> B> 2 4 ch> Dh2d2: @+ "@ *`  2   2: 2? *> y> y> y"hbx(!; d" * `@㿐> C 'D'H > C> C> C> ;> B+`` "" ` `+`"" "  "`> C" ܒ ""`T"`P""`X#"" > C"a> 2#h`> y#h  > D d "@ c`` c`.@-`H. , @ @ > 2#h @ ]> > D d +`" *   " ,> y$p#> y#Ȕ @ *@c`> D  |( " ` @0&  @"`4" 8@"`<" @@"`D5   8 c` `% '@c``@ ڢ`H> 2ch@+`> "c`> C @*@D "@> b  H*"@> 2cl "P $ 0> C"   "(","`"\"T$ 4$` "X"L㿘> Bc` c`"c`c` "> yC#؀` "    `* 2`# 㿐> B#`#> 2cp . %> !> Ґ@ Ē" $cp"8  @ $$""@"> z"> z @@,$'> z%> [@ |8 #` 㿘> 2#h ("* > B#> D c``d> C 䀢``d> zܐ `` @x> D` @ 7d`  :3  `*& @ `   @ #@ #h 2?> zظ !#h> 2`#h " " """""   @ 27? @ 1 * &@ ? #@ @ i #h 2?> z} ^!#h> 2#h " " """""M ?䄀z#h? C(> D"`d* > B c`  `   :/*&`@"#"#h 2?> z7 !#h> 2#h " " """"" ?䄀ˆ 㿘      㿘> B#`` > z > z *> 2> z!#h > zٔ!(> z  !hٌ > zى!0_ > D`d ` h `@ "h `? > z!@  `d `d   `@:("h* `d + " * ? ?""  "$"(","0"4#@#`#`#` ?#`#`h#` #h@㿘> 2#h `+> C -> 2> D d  "@   `,  &, `> B`T#``P, ,  @ 8 @ Pj  > z!0l ?  "" ` H /f * ' ` " X" PB" T*@9> C> B c`@` "` ` "@ $3XP *  X3 P *@ `"$2@ X P * @"`@2Ñ*H 0> Ґ"@P֪㿈!> 2#h> z"8؂ #h $> D d 1> z  @ ;`   "pa#\ch  `> zX"> zU"> C> zTO"㿘\`   > B> y> y> z"hb#> B#` 8  :   > y> y> z"hb i#  <@ > C @@  D   > C 쀏   ` c``  8` c```,4`(`( >  > C`> #p      !> C`> C3`2> z  *+  @@ )@  %@  `  0  > y> y> z"hb8#̑+   *   ` ̀`> z#h` "`" "@c`?" (a $?"$ (!  "  " * I > 6 (6 *& & & 86 .`4c`   $X2 @ P* H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "6 . ? (# @` 6 (> W!@0Ȑ 㿘  N` (  > B> y> y> y"hbP_ #h> C $`2 `X `P* H /f * '  ` "` "  "H 0  `"  "` "`   "@ (?#  6 (?" *& `6 *`F *>  ( 6 *` & > y> y> y"hb0  > B#h> C $`2 `X@ `P* H /f * ' &  & ""H 0 &    &  "@ "  ( `6 ( "㿘 (`W 0`?# @6 ( (  > B> y> y> y"hbP #h> C $ 2@ X P* @H / * '   " "`  "H 0  `"  "` "`   "@ (?#  6 (`?" *& `6 *0`" . .`?# @6 .z& `"  .> y> y> z"hbf$ %> B`"  "`> C"  "@ .?# > B6 .c` ?" .  0  `2   > C " Ѐ`"  "`> C"  "@ .?# @6 .`?" , `6 ,` ?"`  (?" @f6 (&Ð> C`*  & *  "@* "  6 .```$ "`> 2#l$ 4N㿘 @*?##,` ?"` (   ( "   `$€  ` N4 (`4 (`@ݑ,`㿘> B'> C#` $@6% 4ഒ  ഐ`` @ ` 2% 4 00` "`$` " $> W!@ (!4 (` $`" $` `$`$ $` $$$А >  `)))))))))))))))))))))))))))))))))))))㿐> W > [#  > B> z> z> {#Ȓcؖ < A#h> 2ch !2 > D d2: *"@ *` @ 2 @#@   2: 2??* > D"@d*`+   *   > z> z> {#Ȓcؖ( C㿐!> 2> Ca,#P`#\@ 5 > D"c> D> D"c#P"ӂ@> > "c"> C!$"!$"` > 2#t, @@` @ , 㿈 /> B'> D ``#`'#\.@  ?\? 3> > C` > # > > {> D#8`@#:@  ##@ '> z> {> {#Ȓ`@Ғ > D4  "c> {> D#"_ ` $5> z#> {%> W-> {)> {  Ȓ`@q  ( Ȓ`@ h  4@`` @ 㿐> B#` > cc .@ > "#  '?5> [> D#  -> D !5> [   %> v $       >  `" 2   $ #} #%#` >   ` ` .@ @@  @ 㿈`'X X` @$ > B4 ??耢4 ?> B쀢(?> B `@@b :  2  @ ( & s&`@@b*`&   & ``  <` B C`(U "N . 2 ( "G ( 2 ( 2 (> [#@ ? (# @4 ( ( 4 ( ( ` +> W `4 (€ `2?&* & &D` 4 ``耢4``㿈'XX ` ` ;`#\`  &'@ &    `@   2 M K `D@A 0= `8@5!  `  `. > B` " #h@`  `E   ``@ n`@ i`  '@&@ V㿘 d?> Bc#`c @V T 2@ . !"@  " " @ @v    @`( "@Z @(` % @.  @2(> W`@€ @`& `$€  > z> {> {#Ȓ`@r" 2(> ["X€@> [b@€@@`( 2`(`㿘> #" `> {`@ >I#(& X& > C!$  &  "@" ?ԁ㿘> B#h 8:@ - 2  2 * #> #" ``> {a@  0(  4"  0 2   > B#`` H,ɐ@,$  H .`@@ΒW P/> z 3> {7> { @`. 0@ `"`` `Ȓ`@#F`(( " @@ (`@"@> {Ȓ`@8Ҕ#X`( @2> [ > ["X€ > [b@€@@?( 2(@`( 2`(` >  0  >  \ "> _> #f $>F\*         㿘 H /d * % > C > `  <> {-!> `: / 8> B#p @A"H 0㿘> B#`` @ђ `: $`< : @ $`< `, @$`<$`<`< @, $`@ $`@` @ $`H㿘>  > C"`H > B#` Ƞ> C'> { "ᨖ !` $! @"    @ @$ D `$ D  @@  D@#`@J#`, `2ѐ͐㿘> B#`+> {H o$*@e%> C$ $Ԓ"a $$$$`H 0&)> B#`0@" 8: "@$H /* d % X@ H 0`#``, > CT 0O`0p> B#` @:@ .`6` :@ 2 * *`#2`p`2`'@*`# p'  ' `  ` c`  @ *`   ` ' `c`! > W $! @؟@'耢 "`.!, $!,`2``2+`(`  > {> {> {!Ȓaؖ ,!2`(`0  ?> {> {> {!Ȓaؖ0!`$`04`.`( c`a0 Z"a0a$  "a$  !0 O$!0!( $!(`( #c``. 0 c``p "`p> W  €c`a  3"a 2/% > {> {> {!ȒaؖX"#@ * @4!hp@ $ `.> {> {> {!Ȓaؖp̔"E 0  @ c`   c` h l $ `.> {> {> {!Ȓaؖͳ"X `0  2`(`" `.` "`.@ ; `" `. c` @m`  ``(> W`.` 04`(@  c`` 7"` " `  @  % @K` w. c` @:@ '@   2 `(?# @4`(.  & % c` @*`   `&''  "@@ ؐc`6`' 'c`4 $4   ;`   #\ݘ  `8` $8$`. "W@U@T'G 2`(> {" "`(Ð`(?# @` 4`( r% > W  €@' & `$€ @  '耤 > [!> ["X@ > ["X€> [b@€`(`4`( '耢   . `@'耤`O M`㿘> Bc`a  $a``@6aa m$aa  a`d > C  ̒`> C Ԓ #`#`a 2 `d > C ̖#` @@ D"" lh@ > Cp > C "# > Ci Ā e .`2   2  (   > {> {> {!ȒaؖO$2 ( 0  ?> {> {> {!Ȓaؖ0A$`$ 04 . ( 2=,` .    "  .@Ē  ?"  (c 4 ( . #` @   ~  `@  (?# @4 (` > W  €#`a< "a< `4 (4 (㿐 'L> {> {> {#0c@ f? > {> {> {#0c@ܔ g> B#` #`   . @@%ܱ   8#` ( , @ Ӯ > D xL@ ̢#``> 26@ #h􀢠! > D d2: + "@ *` @ 2 @#@    2: 2?]#`  h4@ > D d2: *"@ *`  2  G2: 2? 2@#`@, "@*` ) * * @ .`!> B#`* * @  4?@  @  '* * @ .` s@à @<'> C *` , @Ɛ (2 @   $ **`  "  "@#`?" (a" *$?"$ *  6 (6 *6 .& & &`& `"@'` @' #`< @  > C@@ D > C (㿘 => C> B c`)> {+> {-> { .  "#0c@ʸ! ` "`&  " 4 .$U*  O$ *  I"@* " $ @$> 2#l$`4 2 .㿘> 2# #> |    `(7  2 㿐> | 8!> B#`> |#`    P > |      \> | P #\ T X L ` 0> | 4! 8 <> | @!0 D H > | !p   > | !  > |! > | ̐! П  > | ܐ"     > | "h   > |!"!!! > |"!$> |!#!! !(!<> |!0#@!!,!4> |!8#x t d> | x# |  l> | h# p > } > C8> }!P (!L㿐> "# > B"c> E> } ؔp   > ap> Cap "!4> U`xR' "> }> }ې x> }  #\ \  > Ҁ "c> }ʐ > D> }#`#\    > E> } `#\ x   @㿘> # ``` $̀ 2$D$@ $D2$` `2`㿘`< ,  \ m&$̔@ >`.`,  \ `&$Д@ &$ԁ㿐> B#`  ,"     2     #\    ,  &  @ 㿘 ,  ^ ,  $("@ ;  $̑* @(@ $̑* @(@ ("@   ( ": ̅( *@ @  㿘> #  #> B  4 "$ $  $  $   "` " $   $   "`" $ u \&  &$D &$H 2 $ "$D$ c``d "`d> *> B"! c`$@2$D`$D $H" H$H $D D d # d" 2$@ 2 㿘> # @  "$  "@  \ 2㿀> c #`#d#\    "> }g &$,&$(> ```"` $(&$D$, $D 2$(` `2` @> #`> E' ؒ  @  > B#İ  &6> #  -`$`!> B#`$  :@L`* 2`  $ $ `$$  $Dd` 2&԰ Z В ``2@>   Pǔ ° @ * > } $Զ " @> }Ր!    $i    D'''''J  @    ( 0 2 `< "` > d ~"` \ } ֒    h0Q`Ē `  \ `$ؠ \ [  @$ؒ $ $$@`< 2?` $`< @$$ȒT \  :$$$$$0 "> }O!(@9 % `< 2$$$ْ \֒ \0r 2     @  Pm ؖ~  > }5!@0> d@ ` @ @n  <  2 4  > N* "@*` `" @?)  @n  X + 3`    D X> >`L&dL<8   &dP&dP> B<  2* &`#`  @T* <     `> 2e cd4 "c> } P{ #\  \   &d0   "> }Ƌ!`(> !`XD U:` c``* ` , <$d0> }s!xx  "> }> }i!!Ȣ$@> }! Op> 2c ’ڐ`c` ? &`&d`h  "`h @m[ 㿘`d( d,&`2 2 `d(d, "d `  ?&`d$@" d@> }> }> }"b` $m <`dOd@> d@    @m# Zd> B#` h d" " h8d@ > }"` > c d(d,qd0 \㿘>T>ݔ!0" ]㿘>T>ݔ!0" Q 㿘 T> B: 2* #` @*   ^ 2d( 0 (& 4& 0H /d * % =H 000$ @ԑ< d@* 2` <  > }"Ő H /d * % d@W"& TH 0n0@㿈H /d * % > D#_ H 0 %`%`%` %@%`>`<4,  ,  `H &`@$L$@: '@/ mݘ씒 ?> }0""$LH /d * % %`< @ `"@4H /d * % > E  H 0`0 @$ 0$ <$ 8$ 4$ H=  $ T`,>U!P#pc!$ ,$ X$ $ \$ p`d > E$ `$ d`<``""@$ ``<`d""@@8$ d`l 2`<$ h$ l`h""@$ h`<`l""@@8$ l T$ t$ @H /d4`* %` ! `  %` U$T@=H 0 <`DSH /d  `D `* % `` ?`%```"> D`0&`4(&`0> D#* #" ` > }b@  < @`@" "@$`@ ?$  4 2$  \ > EUf> E Ғ  "`@`0($`0 $`4  2' 2#> D#; 2 "  > }> }> }"b& 2 > D#;ϐ~$㿀> B#Ā`$\ > # `O``F> B#`  "<$D$ $ 46$D$0   #`#d #\ 4 2'$D$D@$H$`"dH$H@$D"dD$$D`$$H`@2`$`"$D$`$  $$  l % l$( $`` `2``` & 㿘$$@"$$㿘?j> B#` d` `> }> }> }"bU&2 d > }> }> }"b0K&6 d(> }> }> }"b@@&d0&   > }#`d > 2"$d  l"@ /$ l ' "d($: * @dГ*` 2d($: * @dГ*` ` 2@ ߠҖ 㿘@?@+ 㿘> B#` t'D` $ t> }> }> }"b&쀦2 p ?$ pD @    p $ p㿈> B#` @: *22*'H'P# `6'6:`'D@  * 2` @?@ ' 'Dڒ   > 2#` '> 2c 耢  <H b耢_   "| ﬒  3n  <@2> B#` H(" : * @Г*`   2 @ݐ  4 ,` `.@2.`@. `. :  :D@ @ը ْD'  h H /d * %   > > C  ` `> #H 0 / f耢 c  H(" :`*` Б* 2(":* Б*  ` @Hݰ PP 'PP  `> !P `!% 0% ,% % H% T% pH /d * % > !p% \SaH 0> B`` .% 8%% <% ``> 2㘑.`% dHjH /d * % > apt "tH 0> C`>   0 2`@ @@>I"% 0% Xjn 9( 0> 2#2` 5 ` 0@1 0(-  H'<`> B#` H: ($ :* Б* -@ @-@:  @ : D Ӓ 0@耢H /d4 \* % \  Rg  >  \ "> P> #ʒH 0㿐> d"> }®#0JIF  \> }¥#0A ~Ր$آ \ ~А $ؒ @ $`$d@ $@  \ ~$d $d> }d#ͱ !> > }А#   2J d@d] \Z \0  iN㿐`*  > 2   -0 -03> 2c'    &c#> 2#㿘6  #> 2:~ &  c $c㿘@> 2c&  && & & "c㿈> 2c  "c@s > E8 8''7` '' ِ!耧`@ &` &`!ܘ &`  & ` 㿈> 2#`> ~$ (@8 > E8 87`''''!  耧`"@&`&`a&`  & ` @&&&& 㿘!> 2#  > E!܀`> E!ܒ ? $#㿘!> 2#  > E!ܒ @!$#㿈> B c``  @ а ` . &   ('``$87 ` *@ `  *  *' #& #`#\ ?-? > ~&  p `& đ2  @"@`" đ2 "@$ İ 㿘  Ԁ@> B' #` >`*"@: `   :$`04$ B ; @4  @  % Ȱ  p   ( (  D Z=> B#c`8 "<> ~. "H C$>@ 8  Ԁ   ``* "* 2 *` #* @#@ aH ''' #\#`#d#h#ldB  @ D #`#\#d#h#ld1   @ D & (28㿘 > ~ؐ  > B#d@ 8 S@ 㿘> "#> > E> ~"c#Ĕ   vp 0   #> ~!> ~]a( ` & "!P t  < 2  > N *`" * `"  " <  `Gǐ ` q&  "m>  & ( ("`,"& , "_&  `!&  > N c*" * ` @>    `h@  `(  @Ô   >  @e "  > 2  "& & & #& &  & &    & & > `& >  & ( ("`,"& , "& GX Ȑ " 㿘 ? <&  @  ?` & @    @ G0+`&     @  `  & ""   (`" , ,"`, , ("@  " > ~א!` & G㿘  ?  ?&  `H&     @r  `" !> ~  &  "! y `2     & > ~!" &  (`" , ,"`, , ("@&  >㿘 (  > ~!> W  €`&@葐 `"&   " > ~k"  b"   (`" , ,"`, , ("@  " > ~U"H "$ $  h> B#``@:* '2  2 * #p '  '`''#'` 8 ;    ;`D    ; @ߐd2`*  *`'؀ ' @ `'܀`H  `B܀ "& `;?#؀`2`(` 4` `$ 4 `(2 ``$(``( 4`(``' ?`(# @4`(> B` @ :E܀ "  H'`؀`` 4=` `$ 4`23``$ `-`> B` @ :E```(  `) ` & #' `" `(`. > W`€ `(  > [#@ ?`(# @4`(`(`2`  4`(26`(܀ ` ```?`, 2٢> W  €$Т`"͢`(  4`(> W`€ J> W`4`(€ `*;`2`''#\` `"`> ~ "x`  ܀ / `*2 @2 `ܒ?z  .`@q  `*/ 2 @2 `  Q ` ( ?o (?c  4 (+ ;m  `4 (> ["@@`?`, )> W€ z ` (  4 (" > W`> ~` ."> ~+"'> W  €擐``@@ ܀``܀`"   !> ~ &  "#0  ` !"    >& 㿘> @4 > ~ $@> ~/#@@  > BB?`8 : :` @ B   @   `  8 ;  @ 8C  @ ?㿘@ 㿈d @5    '  @?0 '`( !   > B 2`(&@ > B` @ :D ޲`'s q   j ?## @ X> B T`'> ~1> ~`( !  2`( "#x i@2`(&@@ ߔ '#\   'h@@ "> B  @) `(   `( 2`(0> [`( 2`(@€&@> B` @ :D ` p@6  `%> ~&" !&    ` 4 2  $ @? K 2 2 ~  & ;> B#` 'г. @ D 4  $ >  $>  $&@>    ?''쀊`@'''''  `! 8   `a9  `aA   @  ba 耦`&@`` `ʒ@ `  `. "@|ޒ F  ?`&  U `  㿘   "   `& B͐ !>   & b x ``  㿘   4  2>  $( >   $ > 㿘!> #> E cĒ q& > Ґc" "c> ##  "X2( 2(  Bz $## $00"`$c(〦 c#     ٚ 1`" (`,"`,,(" $0  Ē pє 㿘 8> M > "Ԣ  `  p >  `" 1 6 2  $ 2  ( 2  , 2  0 2    `  `` ``` `` ` /@ "` &`  `` 2 ``?#@"r 1` 2`  2 ",` 26`` 2 6`` 26`` ,`6`&`ǐ "R 1 ,`L 1,`2  # 2?> Ec4 {I " ` 8R  2`- 0`& $` & (`& ,`& 0` 2 `` 2 ``?#@ ``<* @ & d`2 6 6 $@  |y 㿘`8  `      `2`` `` > ,> ,!a   # "X   > ,> ,!a- ,`2 2`9 2 2 1@$$@,`2 &4 ݰ 10\?* 2`@45`: 4  w' > Ec `$z ې86`6,`1ź@&@,`2`& 4  10% * 2`@ 45`( 4  v > Ec `$zr ې6`6{А H` > `#耢`''k'` "`  / "  1` `  `?#@ 12+ $` 2' $`?#@! $ 2  ( 2  $ , 2 $ 0 "6 . $ 2ڰ  ( 2ְ  ,?#@"@ΰ  2 @ ( 2 @ ,?#@" @'`'`'` '`'`'`'@D "&`  $ 21  ( 2-  ,?#2'  0 2# @z   //P  8R`  @zƘ @z 7`=  @  @ $@! 2  @ h 1'd  @'@. k $` ` (   $ , 2  0  $  y 6 " $@ 0  (  ` , ` 0 " 6`2 ` ( 2` ,?#@2` 0 2` 6 2 & $ & ( & , & 0`& ` & `& `& `6 4`z& d  > ~#p> `# '`8 ` 2 ` !` 2 `` 2`` 2`ΰ  `  `?#@> ~#> ''' '''!!`'`''`` '`'`''Ԁ `> 3> !!`  `'`'''` >ܦ#> 3# .6`!u`!/ $ / ( / , / 0 / @ " /  4  / L`@  L/   `8 ?d*@ $@m  4`@f  228 ".4 `6 2&؀ $܀  $ $䀢 $@D  26`4 22`  > ~#㿘`  @y)&`  , ,`64 `$`$$ `( $ `, $ `0@$ 㿘`  @y &`  , ,`44 ``$ ` $ ` $ ` @$ 㿘. * !> E $#  s* #*@ *`@> 2"@x*`# ) >e c>e>e a#> ~ c > *c4% & @. <& 6 8& & & ?&K ,   !㿀> #'@x  /H /f * '  ` ` & & "` ?& H 0 `" c 0  0ٔ@  0 > ~א#㾈> #' 8 k'D!` g!d c   D@~P  N  \        DD`E"G  ה  `D <6`,`  ''7',u'D`T "`TD`d "d!` `  " 0D@?D@D> ` "   2 D`X "`Xc > Q 8㿘 !F@N  a2@a1@=a@"a a@ aI@%a@"wx 0aH@"A!d !J@' !F@! g aG0H!H@ "-!d!G@"!`X 0!K@"8!`Q M2K /J !F@, !F@  =  !J@6  `    " @# / @  2  `  "  /      !F@"   !F@> E> E /> E# h'> 2 IJ@]#ad "Za`T ` @Q# L#  `@G# @@B# @} 2 a`@} @ "Ȥ 1      `ad `" 1 ` $#   # #  #  #ad` #`  #` #` " 1#!` " @r @ p  l!d &!`r  p  ]&!dH /f * '  8`@6 8H 0Z !` "!dr &!`!d "Pr K&!d G0!G@0H!G@> 1  47 - 00!H@0H!H@' 1  4  `" 1!d  @!d @& @ 1㿘`2>  H  .@     `.@ `.@㿘` > r p"@  @      .    㿐`2> N 2`/@* * @&@㿐`2@> 6 22` //    * *@ & X> !` !d`c'=; ` 7  3@u"@u  //`<'//`''"7``" 0 (0    27 7 @ , + /`' F  '        ؚ  >  㿐 'L'P'T'X@'H ?А*@;6 > E#> 2cĄ @$ ``"d" ` 2  28  ` @ @" ጀ`& `L`#`L``   C#``0"X> !` !d!lc耤`'IG ` C ?@t"@t  //`<' c` `'`'`/'/' ''''"7``" 0 (0  Ò  2m 7 @ -` a /`' o 2U  'H 2F @ Mq &&!h  @  @z~  @t   - -%  % % % !h`" !h`8 ܐ?"`8&!h!h  !hL!h c  3   @E  >  㿐   , C'> E> 2#  @ )!`!!d`"   `  8  @z   !d  @z  "۠!`# `L `$`L !`` $``6@0 !H> #''@s @s > !!> `'` '`  ' '@'''//'// $N#   > > "Lې ` "@ `0> aȔ N   D@ ` ?"` `  &` "`DV  `8 4  "`8Lp`8?"`8 > "㿘K   4  @ 8` u   8?$ 8㿘> M"Ԣ   0 @yS  2 ``$ `K 4  @ 8`8?"8D  #> *8 > *??#@*` ??? 2  " 2?` "@     "     : 2   8   ?2?  * +   > c0 @ !k '@0!j@@8ђS0l@20 !L@ ",0aU@"aV@!N@W @0HaP@ aO@aM@ ai0J!J@ 1!K@  ai u @[o@ag@ ad@ af@  !0!e@ > b0 U -!@ " !@ 0Ha"0!@0H a" "@ @9@a!@. H! @ - a@'aF@!@ !8 ! !aI@ aG@a%@ aM@  aT@aO@   %  "0H? ?  `"44@" 2 `"4@ "@ 0Ha"@a!@> Ha@"Ұ   !@'a @0HOa%a@אa@0HFa%aI@"# a%@0H;a%aQ@aR@0H2a% " 1?    /#0H  0H 1   >    @ *  >    @ *| 0Ha%@"N | H!@0 !@0]a!@a"@'0UaR@" aI@>aQ@W0HaS@9aT@C0@ (& ,& 0& 4& 8&  <&$ @=&(8 ":  `& d& h& l& p&  t&$ x*&(& & & & &  &$ &( &+@q2 @   @q&!@!  & & & &   #" @ &&  #"  $ & & & & > ` & &  > ` & & d l2° @Ȓ @ @pВ `P ' `/ ''' '$'('P'T'X'\ ''Ė ? @"  d 2 * t* p@'?@np ', @n, 2n, 2  > bp d  ,& ,`\ "`\@p1 Xc@pr ` '0 W `  2/ ('< ,D'@ 0 'D 4 'H 8'L <'P @'T 'X '\ '` 'd ? @" @n   @`\? &`\ @ې` @n   - c > y"㾘> #'' % `"  8 " `H`-  "`H /`H 2 `  `   H@ א`P 4  8 ϒ  8`, `0'`4'`8'`<'`@'`D''р 2`-؀ 2`-ِ 2`-ڀ`" 4 4@"`-W 7`- `h 8   `> 4 `> b< C  > 4 `> c1 8 `h`` 82 > 4 ` !> #H@` 2@`H 2<`H Ȓ i    7@ot &Đ(&  .).(>  && 8  `&&> MԐ|&` & ` `` 2`"`"Ԕ& & "@& `H (| ' > 4 ` !> #x@h0  '`H&|`L&`P&`T&`X&`\&``&р 22`hؒh@u   "+`h  K  > 4 `!> #@70  ?&&`&d&h&l&p&t&x`h&`l&`p&`t&> ` &&> ` &&`@d \'`d&`d`> & & ? &@\ "V 8 &V 8 @0 9p@n `$< 4 ' x  /p7x'/q7z/'|@x  > 4Ā "Đ"`&Đ" `!>  @  0GT:  @nr> !h!h`` '`  '' '/@n`/> !8/!8' /   4'7''F  `@n    8 Ȑ?$ 8 2 88@n7 4(!'P'\'@'<'D Hޔ ' G ?$ 8 '@ > 4Ā "Đ"`&Đ"> "> b@ O 2% 8@ߒ > 4Ā "Đ"`&"Fʐ/  ` !>  @ r  8 \> !(!('` `'`''F0  `@n    8 Ӑ?$ 8 2 8@m 4(!''$'''  H_ C' F ?$ 8@~  > 4Ā "Đ"`&" `$!>  @  0 "@ `d @c{   @F@  >  X㿘 @c   `  IÔ  "  @} 0> `h Ԗ`0 ?& Ԑ  Ā`""`"@@*  Ā2@㿘H /f * '  ` "`&`  "@> MbԀ@2 `"b 2  > `&  ` "`@` @"` ``2 `\> ` y0 E0?"`\`&` &`@l` ?&` H 0㿘   `g 2@ p> #'2 > !(!@ "!@"/ -0!@2* - @" 2!  2  `  2  @  " 8   !@ \h!@"  -0!@Ph - @ @i " 1@ڤ ` Ԣ ` xܰ  x@lI xܔ ؒ' '  ʒ ' ' /@L *@' a@l  @$0@8 H Hh L P'HTlp t 'L'P@q'T 2  !@  @  H   `x XhH @ \ `'Xdlp t  '\'`@q'd   ` 2۠X0F 1!@ ((H8 ` `A@k! & *&@k x-  (()8   ` ` @k || H'4a# > ΐ!P㿘  H /f * ' ` `@ "`  "``2@&`(&`,&`0 &`4&`8&`<&`@` a   H 00*H 0`D`&`$  `a   G  ` &`>Ő"@&`T`8 @@c㿘  ,>  "   2  !>  J  ` C  ?"`   $ &  & " $ & `2 0.     2  > !h   ` Cǐ & ?"` &  & " $ & `2 >  2 ` "` @"  "@ " "`2"`" 2㿘>     2   6d @jh $ $ `` $`" $`$ 㿘>   2 @ `"  "` "@f 60 2 p> c'H /` * ! &` ` @ "`  2`` `   @p  2  ,  &  6d%  2 @H 0% 7 & `& `& ` & & & `   "   2  2& e 6H 0 1&Q  `$  & " $  & А@i ` `  @`/`/`''''  B0 a1@& `"  "` "@ew 6 ?$ H 0  @IېH 0# > ې!p> c'H /`   B~ "А* !  ? /& @I`"  "` "@ `` ?"` А@iE      / /  '''' a2e 6H 0 > !㿘  6c=   7 &ܔ &d 6 㿘 "dޒ 6  ?? " 2  2  2 㿘 `"  ` 2 `@nƔ  2 > 2> ҆(@  *` > 2@ "ܚȘ   :  2 23 *@(2  0 2  0*@`*@` *@`*@` 0 @*@ ` @*@ `0 @*@ ` @ *@`*@`$ŀ #܆c (* *㿘      0%>    "    0 0  !@nD  2   ``   㿘̐ "  4   ? 㿘> M"Ԁ "  0 @n  2  "    0    @ `  (0  㿘> a   : . "@mޔ 2  @  "@ : `?㿈> #'        ///////` /> aT #@g ``: * @ &@ . `@ &.  ?. # > "㿘& ? > "00> !``{/> JGC2n`` "j` ` `?` 2Z  2W  2T  D#6@ `6F   > 3#d`"?  ";  ") # " *  4&  4  $ 42 `  0  2`` 2 8蒂`B &:耥8,),*p B; 88p `B ; 8 `B ;㿐k ? ' 5' ` 2-  2)  2&  2#  > 3#d`2' I`2  2 0 $   2 ' > 3#d `2  2  2   2  2'  2  " 㿐@,  ' `2   @\o  2 82  <AA`? > ``4 a@,`82)` `@   8 ` (`    :```2a@> 2 㿘  `1 @f    `*  @f&  `"!!@e& @IU& 㿘@Iq`@aВ `a͒ aʒ (%> ' X@e@fA> "> b@fJ@fu`g `   .`耢@> $"h 㿘 `"?@  2 `"` 2 <``2@{?  ` `G` 8  `%" ``" `#` ]?; Y?" G``G P? 2L?> 2c@kj 6> 2c@kc /  ` $`2"` .`  .`  .` .` .`  .`  .` .`2 ?N `@eI `  .`.``  ?  .`> 2` c@k)  ? 㿀l `> 4 `N> bx  H`Y  > > 4 `;> b> !``!> @C 2`  > 4 `""Ж`  ```耦@ >  Ґ#8"?> 4 `> c j ` > c`#l     #\ #`#h#dU  㾸> #x'@d x  @dL 8< 4  b//77' ''n  > 4 `-> c# ?> ܐaxax    ?  /'/''''''b / > 4 `> c  X?j >     8 2 ?ߐ $ @dN ` '4> Ȇax/p'@'D'H'L'$','4,'('0'8'<   @"d   ?'d'T'P@a    @b    > j 0> #x'@c x  @c> !!> aa ''  ܢ?  ''//''''''ܐ////'''''  > 4 `> `HW ? c >  > #'`"Z?N@  ." "J  ."&" ?H?? /G@c(G,H<`#  ` * 2  X@cs@cԐG@cߔ G@cې@d@cc   ..6 4 .6    >  㿀>  < c耢'"]#5 >  @4 @#0O Ȓ @lv  2  @N  / 9C# @$> 4 `:> `V 8   8> 4 `,> a  '#耊> !!'` `'`'' > 2 #> 2#䀢`  #+# > A!Hp> #'@*7/> @H `@ ``o 2@ `q@ `h``? ? 2b`Ā+> M`""`"@ `Ā2` `(: " `;s6, <   `|< ```"`& ``"@`  ?$` bԀ@ 2 ``%b;b` 2``  > 4`"`;z `> aX  ` ?$` `2@@H@bL 88  '    4/7/''': c@   0 <4;c > !㿐 @ > !Z@b  ?/'?   ? ? "```?`` `  `  ?` `   ?? "``` `` ` ``       8 &   " `&  * 2`3 ?# 4#  * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"5* 2`3 ?# 4# `@`` * 2 3 ? 4# +   @     ? @ * @ ?    @  ` *`&  * 2 3 4# @ * @+ `  %@`` ` ``  `  `` ` `` ` `` ` ߚ` ,@`` ` ` `"3* 2 3 4# `@`` * 2`3 ?# 4#+   @     ? @ * @ 2i > ֐! ?#  * 2`3 ?# 4#* 㿘  `'@`           2  2  2  " ` > *#@*` 00? ? " $` > *#8@ } > *#@* `  ? ?@ > !lΐ ```   @F3 ŀ`@e "`D08֐ $@`I 1@ ` @e  " @@`8 ?"`8$@@ ` @ 2@`@_ؒ  .` ,`&` &`  &` &`&` `8% $@8@   D  0@ D0 A 1'@  `  `2a@> 3@`#`  # `# `# `"? ?? ?9 '`` `> *@(` 3 ` ` `` 4 3  > *8  > *@+`3 2" @# `?# `?# ` # # @ @ ? @?  > *8 "# 4"#  3  ? @?? @?2 㿐@  퓖   @:> ;!   2 X!   ,  n   @:> !   4? +> J"8 @  $  `  ` `B =  `  " `   $@ @?" ! $ ۢ@&@ 噐!㿘> E> 3c"l"`8"`<㿐'D'H@'       @:> "    >  !7? > Ӡ ? %>  4   @dH   ?`8 ?"`8> Ӥ"  @^A   , , $  $  $  $$ 6 "  D 2  * @2  @~ !@`B:` "@   @j !@`B:`> J"8`B:`@`xB:`x H /f * ' > `Ā   H 0    '`đH 0    > > "b8 >  "> 3#P> F H@ @> E# 8"$#  *  *`@*   28 @c  2 8 (@c  "#8#2 #2@ > 3#L5> F `'D  D H`&D W  @]{ H@$ $  x *  * *`@  $,, ?$ $ $  $$ $( $, $0 $$@$4$D ? *@ #@2 ?$@ , ? * @@&@ # 5? @ H /f4'`Đ* ''`đH 0 ư!# ? @w H /f4'`Đ* ''`đH 0 !1 $,?#@  @ Xϐ      $ ( , 0 4@7 $2@ $ V  P@\̒ $ ` *  * *`@  $@  *` 4` ,` ,`  4` $`$`$`$`F 2 2  ` ` 4  #2`+" ` 4  "  $ @ ```@" " `` " $ XJ ꀦ @T> F HD`" H $D> "H /f4"Đ* '"đH 0 !  `"H /f4'`Đ* ''`đH 0 ɰ!5> F``@$"`@ 2$W 2`W ?ؑ* 2 2 - - % %  % $% (% ,% 0% 4% $     %%   @HD " W%HD?I&Dm D@[*@HD " W%HD?` &D   @%> J"8h`B :h@`B:`D"@H"H /f4'`Đ* ''`đH 0 % > J@`B:`> Jb8 `B : pH /f4'`Đ* ''`đH 0 !㿘>  Ā` > > "b8@"w> " '> F@*)> F`@J``           $  (  ,  0  4@ $(W @2`@PH D " V$H D?% D㿘>  Ā` > > b8""> I"& `& `"` &`㿘>  Ā` > > b8""> 3"  "`  " 㿘>  Ā` > > b8"˔"> "& <`8& 8`8"`<&`8㿘>  Ā` > > b8""> " 8 <"`8 < 8" <㿘H /` * ! H /f * ' > `Ā   H 0    %`đH 0    > > b8"u"> ǐ"> E#`8)> F '> 3 > J"8 ?,  8 < ` `(`B <`(  <2  DL@`< > J"8 `0 <B<`0 DL@ < 2`0H /f4%`Đ* '%`đH 0 H 0㿘H /f * ' > `Ā   H 0    $đH 0   $> E#8@ > J"8 `  8B<`  82` H /f4$Đ* '$đH 0 $8LpxKL8LdLN|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|N|LLMM@MlMMMNNH```b|b|ab|a8aTapab|aaaabb4b\b\㿘@9x> 36dcx> 3"c> 36_> 3"c`6 `` `"+(\`;`"SXV`R>*@L:@G:@B:@=: @8: @4:(" 8*`0@(:0@$:8"H"@`" P`@:@@:H@ :P@:X`@:`㿘> 3#` `@`2`  Rؔ  2"`> "## "@#" $#"`㿐> F`P B:`P> J h '⌒ (   #    2  ``  2  2   2     ߐ?' ) @ 5 :23  @     @:> "   `2 J@`P `B :    @`2  `P`B :  @ `P`B : $$В"@ `` 0 8 0`  $"  ?ܐ?" 0  0    ?В`0& &  0A       0&   0ْ 0 2  > 4 `L> b e!t0F? ?#  #  #  #  #  #  #  $# $  @ ? @? 2 , ,  ? ? ? ? 2+ (, , + ( (6* 6* 6`P* * * .`&  `B ;@  (0ތ㿐`'"`  !@ @B:@ > FP `B : P  @     @:> "  '`2 `> F P( B:( ` !!@ `B:` : "> 4 ` #> @cb > F P((B:((` "x!@ `Bp:`> F @ P(@*` B; @ "v " "U  +> 4 [ o> 4 4\ .!"  "r  > 4 "C S 4> 4 > 4%   !@ `B:`  >#Г,  €    !@ `B:`     !@ `0B:`0 `P۠    !@ ` B:`  `PǠ Š    !@ `(B:`( "   `P`P    !@ `8B:`8 `P沔    "s   :m H /f * ' >   H 0 O 4 H /f * ' V > b*`@  2@ H 0  $ $ 4 $$ $ $ ) #V @4   $$  $   $   ($  &  6 $  L   0 ("$ $ ߑ$  ('  , ,`P(8$ B`B ;$ ;(8@ Ԓ '   1 !@ `@B):`@    "!@ `pB :`p  " !@ `xB:`x沔 T  @6?'@6;   !@ `B:`ؔ`P> 3c Ք  ɐ  沔 $  ˜`P@ à  `PH /f * ' >   H 0 ' 4 H /f * ' > R b*`@  2@ H 0  $ $ 4 $$ $ $ / 4 - H /f * ' > !R $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8   ۫ "J $   $ "  82 `"   0 $  $@  ̢$`̢?> "Ѐ@4 e ( ( ` 0@Tƒ > " 4X #V @4   $  $  $  $ $  $$ `4$ $  . (, `P(8$xB`B ;$x;(8@ ( `P   !@ `HB:`H є`P沔 2  @L'@L~   !@ `PB:`P `P沔   @M'@M    !@ `XB:`X `P沔   @B'@B   !@ ``B:`` f`Pi沔 ǖ  @F^d'@FY[   !@ `hB:`h B`P'E沔 ۣ  @ ֒A'@ Ғ9+0`P3 `> #8 @  `" `4X M@  @ "!`P`B :`P0`B :0@!ڤ!> #'/ > FP `B :   `0@ 0   0@:> "   2`> F Ҵ )> 33<+"< ,"  "   2  `@ ٖ   @:"   `$3 ` *  * @ @  <`@ ᰖ|  | @:Y"   > F  *,  2' @@ה጖x  x @:5"   `> F ` 2 2  * ?@t@ `@ bt  t @: "   ?  * @@ 2 LB 0?p  p 0@:> "   @R   / /`'`'` ' `$''' 'Ġ ='Ȑ ߖ 2> 4А@Rp   //`'` '`'`'  ' –  > 4 `H> cp 0C@?`* `*`*`@  * 'Ԭ`'''''/'l** *  @'l'> J!8 > 2* * c * `@  > FP ?`B :  ?c > xc#p> c > 3 '   * *`@ *   /{#` > 3# @z> 3# `> 3# @oА@QҒ   //?' ?' ' ' ` 47@  D> 3 4 8  P 4  T .  @!@` @  0@ `` @@ 0*i > 3 > FP @`B ;@# T > 3 8 ?# 8> 3#   @ 2  > wÐ#`> '`  8'Ĵ  ``   ܖ̔   @:> "   ϰ @Q2   ؖ /Ѭ /   ؀ ِ    * `@ " ?|-     s-  ` "9>      c ` ؀``ِ  `ِ   `  ` " 47ڐ@VÔ  <0Z``*@"Д > @d" O K G ` @@`?Ȕ   @:> "   ,  @Z %ד - 2   2 > 3#`> 3#`2 " <      <@ē* @*` 8h4(0 <H /f * ' >   H 0 &`6 H /f * ' T`> b*`@  2@ H 0  $ & 6 && & & 2` #V @6 `& `& `& ` & 2&  $`,& hH /f * ' > !7 & $H 0 $ (  & 6 & 0& (& ,& <& 8  n& & ` (o  `(i  "     S, - M,, , G, , , , '`8L > ,  > , , * 8 8* * * > "@F 1&@ -`   "& ,   8`&  & `  82Ā  $ 0  8"?8&Đ@ 8& &  ,t #p " k # > uÐ#Ё㿘(`H /f * ' >   H 0  4 H /f * ' > b` 2`H 0  $ $$ 4  +* H /f * ' > !S $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    $ $ * ` $       8 ``! $ 0@`  J ." *J  hd   J@K@  .2`  a >_ +    S   ) %А C0 ?   А `-3   ` * + 4  J ."*  +   #$  C 㿘@ @T, c `_\@J?`2Y J? 2T GE& 4H & 4B N`&> N9`?48 ?45 `ˀ`ŀ`%#@ 2" 4 4  @Sڒ &&&& &  㿘   * @ `    B ?> !`: .  `2& `  0`@S  " 2 " `  ` `   "   `@"    22&˨㿐2 > !`   * @  f` dx [ `2R    `"GF ` 0 2@  0ۦ "    3  / "-   @"' (6` `> ? '@$'"@' `  0? ? "4```  2 2 2 `* @`*`2`2`.`.`h>  ' 'Ȓ`   r̔   @:> "   @LȒ   //ђ   z> Ub@ b@ ~ `!"u  j :2q  $  $ (   $ ,  $ 0  $ @R  2[             @Rz  2E  ̀   2`*  `* "8 3沔 #  +`@Ȕ@ |8Ȑ L 2 8UȀ "'O ' L8 "'  'Ȥ @2 `,`@@ JՐ8Ȑ L 2 8#Ȁ 鳒 L8     > J8PB?:P > r`#!> #' ''P> 4 `> > ` @  (z'0(آx  (ݖՁ 0Β 0 # d ( $ ` 0ջ 0 #  : `(.` `?`('` '`  '`$ '` ``&``&` `&`@K&`$//`'`'` '`$'L   @K //'''' 4 ܖ > MbԀ``0@Q`  2`` 2```? ? `  @2`2'@X@KO    ˚TX``8 w?"`8`2@> 4 `!>  iȔT 0 `&`` :&` `&`` .@&`.`.`.`.`  "> 3!@  `.` #C.` : (--* 2 2 --  |6     @_P  P #!@ `B:`P #!@ `B:``>#*` €P  !@ `B:`P #!@ `B:`P #!@ `B:`P #!@ `B}:`P z#!@ `Br:`P o#!@ `Bg:`P d#!@ `ȖB\:`P Y#!@ `BQ:`P N#!@ aBF:aP C#!@ aB;:aP 8#!@ `ЖB0:`P -#!@ `ؖB%:`P "#!@ `B:`P #!@ `薂B:`P  #!@ `B:`8# > p 㿘@+㿘[XU1> Ӛ>  Ȕ5$ ȁ㾐> #'  ` `*  `'` '`'`'> 3#8`> 3#`@ @}   @:> %"   `2 `> FP `B |:  ?'` '`?'` '`'`'` '`$'47 47  > 4 `H!> !ܐ ` > 4 `;!> !Xϐ `( 2> F @I  // ! >> 40`" ` > 4 ` !> !H 8 !?`@OS  '> 4 `!> !)ސ 8 ?$8 `!> "84"8 ?$8  > 4 `!> "x? ? Р`?@O `? `> 4 `!> " > F`(?@,@, > 4 `!> #Ɛ| 0{   . = ?> 4 `s!> #8 =X b> F@3 `? )> 3#&E'> 3# @W#@H `@H @@H   //A/a/h/@/`, ( H$   ! #>&;`8!Y  @Hy  /!/ ( y l#!D> F!@> FP `B ;Y# > n#p> #'> J   > 3#8` ```4 ``@  @H/   //``'` '`'`''@.Ӓ ` `  @ `H /f * ' >  |@ H 0`" 4`H /f * ' > b`  2` H 0 `$ $`4`$@$`$`$` `N`H /f * ' > !| $`$H 0`$ (` $`4`$`0$`($`,$`<$`8`(`$`  $`  `8  `"``$`0` " ?$@8% = ? 0 ޏ  ``0  0`4 ? ?  ` :  `,, , ,,,`  ,((,,,,,`4  ѐ0 `@   `0 @ܔ  @-n %( =&@ ?&@`4 $$&@`0  &@"$`    ,(< .` *  =@&@$` ,$`% ? ? ``$ в ` ?@ Ч  @F <  .@.``&@$`$`   $`n "``? ? 2`-` -` ` 2-`-` 2, ,  2`,,` :?ؑ* 2 2 ,,,,  ( * 䙐* 2 2 ,,    @   !@ `B:`  !@ `B:`  > F!@ `B:`> FP``B  :`` ̓ ~ > lא#㿘 `   : @  =9   242 * "  ( "  `̀` ߔ  A2 *`̀   # ' $ `̔  㿘> 3#> 3> Ԑ iՒc`?㿐w  "3  4 $> 3 0    Z " P"P T"T X"X \"\ `"` d"d h"h l"l p"p t"t> 3#>c#  㿘 2 4> #  2  P     ! 00 "& T㿘 2 4> #        0㿘`"| ?`w>"*` €> 3_#> 3X#> FP\7 [> 4G > 4@ > 49 > 42 > 4+ > 3$#> 3#> 4 > 3#> 3#> 4 Z @2 *4Ld|,Dd㿘  ɩ  > 2> E #@ *"@ *`" *  *  * " * "> Ja8: `*@@ 6*@> 3#  @/> 2#+`" + " **" "@ * *`  @ * *` @ * *`" "@ * #@*`"@ > J!8 ``2 `4S```:+ `4@ > 3c> M"@'" > E"c@ 㿘!> U @D!>Ð!В`h >  h!Ё㿘H /f * ' > M` ` """`?"H 0 `@ 0܁p> #' (?'''D    > J8Ȩ `B 3:Ȕ8 `B ,: !@> !l> J`4"8 * 4  > J"8*  @ `B ;@> J8 `B  :> J8 `B :D  " "8!@@B:@"8`B ="8D` '"8`  ( 'D``B <`!@`B:`D` `"8`B :` !@`B:`  ' D' ' $'Oo` D    @I "8*` @ `B : "`    2  2  $ 2  ``B ;`D<      ?#@("8     ?#@         D  D D $ DD``8  4 "8`B :` `8)? ? ? ?  ?  * @"8? ? ? ? ?  * @"8`B :? ? ? ? 2  D`4* 2 2 . .  ? ? ? ?  DD`4* 2 2 . . D 8`?  ? 2    D  W c    ?> MD  " D!@`B:`D ` ` @ "`  2`` `    @H  2 2 > 3#耢`2D"8  @B`DB ; @; x`D "ܠ"4 `  @H   "ܔ"8p`B ':px $""܀ "8x`B :x8 ?"8$"> M"@B "ܐ  **  "  " " $""܀,> 34  '> 3@ <`"> 3Dऀ D 2ऀ > 4 '  `;!>  (ى ن ~ߐ 0.#8`2 "8 @B: @D` !!@`8B:`8  * @'  dܒؔD@Ԁ  cD   *` 2*` ܀ 2&` "8`B :` " D!@`8B:`8D  " D!@`B:`D  W c` ( )   (~Д   @:> ~& X  'Dؔ"8`B :? > 3#8`2 DD`ܘ؀ `( ( ` "@ #` D ("`\   > 3#耢`D@ q  "8`@DBȠ:`@c耤 DșD~cD@xc  `2   2   ?#@"8  ""8  2P ?#@2P"8 B: D` N!@` BG:` `B B:P`B :P@`@B:`@!5 > J> 3!8`> 3#X D`@"8`  * @*`@*` DԠ!> 3c"8`B :` !@`0B:`0Dc > gu p㿐` )  (Ϙ   @:> }@ X   2 &> J` (` ( ,  (`  (s   @:> } X     > J8?`B :?@  && ?㿐Q?# @ "  06 01: w> J `5 q> J ` 4`*  '&c> J ` .   *` . `  4(?> J 'H֔$@ @O?H &@C Ր$@  缔 ;?$@  絔 4?> J"8 ֚`C : $@  秔 &?> J"8 Ԛ`C : $@  癔 ?"8 Ԛ`C : $@  猔  ?> J8`B :$?㿘 @/ "- 0( > J0#> J8`B : c ?8`B :`   ` #  N ??p> # 8'`  `@    u ) &@ `@@*ؒa ؀``ِ  ` ِ  7ڀ  "  4'  I ) &@ `@ 'Ԓ  : ) &@ `@.- `2' ` (@x > J   `*`@ 0y> J8`B X:    ) &@h `@I (  3  <  +#0<;#@@ ր 3` .  . ` ƀ 3" <  + 0  ɖ ) &@$ # 3# > eu 㿐3 <+>  | 3 ,  , H /f * ' >  s) H 0  6 H /f * ' > b` 2`H 0  & && 6  . - H /f * ' > !r & $H 0 $ (  & 6 & 0& (& ,& <& 8   H 2 '  &  8`"   $ 0  "    ?&* $ j& `(   (   ,3 ((    X> #' 2 > z| "i? d3"< <,$ Z2) (+B Q?> M?: HlF;@ C ( Ȁ&@ 7 ?#@.?&(@ $ & *  @c?@  ؖ"& * ?c > d' ȁ㿐?'t ?㿘`t ?`(n>"*` €> 3_#8> 3Y#<> 3S#@> 3M#L> 3G#H> 3A#p> 3;#T> 35#X> 3/#\> 3)#`> 3##D> S > 3#d> 3#h> !R > 3#PR -ܝ`> #' #'D    > 3 2/  2+  2'  2# > 3#T> J8@> 3t> 풂`B  :@ tD`> ``y@ 0Ҁ  DK ?,H /f * ' D ͜ D `$" > ! xΔ $  ( D?'Dj #\  (̘ W DH 0̀ ? /> M@+> M" '0 H 05 4 O%b͝! /> M+> M   D  @  !@ D @B0  D́ 2 Ɣ  !H 0D$  4  Ӗ +?``4 b܀``8 ?"`8%bVbb܀ KD> J8`B ":  T 0ϐ %b?` @Aޔ  "/D?` `8 ?"`8%bܐ@;ڒ   .. b& &  & $& b܀ D> J8`B :   0bܒu`@q;> J"8 @ B`B ; ; @`@ " > 3!@`8B:`8> 3#T> 3> #t  ##tҿD> `@aP #\`x    Ԗ 0 2H /f * ' а DH 0 ADV'倥  2 v '̑H 0C#`@a@ D  ` @  9`4!@ ``  @@  ,`4(  !@`B:` ;`@!@@ @ !@ `" @ @  @ X 0`42`0`2 82 8> 3#<`0 8 @!    9 D#`@  8 D  ? ? ? ? 2, , ? ? ? ? 2`@,,`@ FFD DD8 4`@@&ޘ '`@  > J!@`XB:`X> J8@`B :@> J8 8`B ; 8`@  `!@`HB:`H`  H`B ; H ̀`A>"*` €`  #  Ṗ #W# > `!㿘 l> 3#耦@ ?* ?`%>"(*` €@Β@@@X@ @Y@ -㿘> 3#耦@      k& -0@㿘0 !k 0!j  @ @\㿘H /` * !  > T > T    $  ( ,  0 ``  ȕ*` B ;``    @?  2  $ $@?  2  2 ```B :H 0`2``  < 8`h< @`p< H> 3* > N`@*`  (: 0: 8 : :  >  ( "@ > (  㿘V 27 - R `:`0 -". *` 2* *``> 3# *耢 > 3 0"c> T" @9<$> U @98!> "!(1> >c(!,]= >  耢`&`!,]::` p> c'H /` * ! > 3#< `)> N*#> !! `,`2 * @*`@  ` `   / ''''   a2А`* 2`@ ޢ `@8> "!(> 4])!,> T Ȓ *````   4 8 2 `4 8`2``*`> T @8$> 32#> 3> 3"c"#H 0 > _" 㿐> 3#`7 > N `*2 * @*`@`@ * c2`@ 7> U> T Ȓ`Ȕ @ *@ " ""22 $ @ p> #耢?' * > N* `` `w 0> *#8 > *m #@*   %> 3?#@!> M> M> b @A##8 28244.#T8 @K -H /` * ! > !!` `/` '''' a1аH 0 %#H /` * !   <`8,@$`<` <`(<`0H 0> 3 `2 # > ^."(p> #'> 3> N*  #* ``    C H /`4* !  > !!` /''` ` ''  a2А@7 `c?* @ `*`2    ?* @*`@ ` 4cH 0  > ]ː"8㿐> T > T `    $  ( ,  0  ` `*B ; `     @=9  2  $ $@=2  2  2 ```B :`'H /` * !  84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X$`XH 0E H /` * !  `     $  ( ,  0  ,`} > U Ȩ 7> 5> `@<є  2n` $`$@<ɔ  2f`` "b``*`2   ` 8#\ HsMp $@  $` $` $`  $` $` $` $` $`  $$`$ ($`( ,$`, 0$`0 4$`4 84`8 <$`< @$`@ D$`D H$`H L$`L P$`P T$`T X<`p$`X<``<`h$`x ?-` "$` ` @˔v2S 82 $````-` ,` `Q > U Ȩ  ` @  '؂  @ $@ (@ ,@  0@  4@ '`c' ' ' ' '''''''''đH /`* ! > T(` Ȱ@ ؒ @;x  2  $@;q  2  2 2  H 0  1&1G 8H 0  > ["㿘  L      =?㿘 ''H ? ?@@  ?@ `..  *  &  "> 3#T> J8@> 3t> 풂`B  :@ > t; >  b`q  H /` * ! > T > T `        # '  ` *` B ; `     @:Ô  2  $ @:  2  2 ` ``B :` `H 0H@`B :  8.Ŕ   沑H 0 7 G     8 'y (2  0X 8H 0c 7` *` *  *  * +` @  +  ( *`   @  *   ,   (  *  -  * @  !+`@  ,+ "  *` *  $  %,  +  &(* #@* '@      ,` `@:  2` `$@9  2`` "``2`  8.  /Ւ 8H 0ް 7  (  > 3/ 8ߐ/ 8H 0ǰ 7 #"  > 3"   "    d" l0   +`+`  ((/ 8/ 8H 0 > 3> N#`` > 3*`2  `H2`쀢dl +`0 /#  `> bp  ```B :`/T 8r/O 8H 0Z 7`B :@3`   ,`,@  $` > U$`  $` <,`,`$`# `$`$ ,$`( $`, $$`x$`0  *4`8 $`# !$` 8 8B: 8/0H 0   `4 ` ` "H&@&`&`H 0 㿘H /` * ! > T Ȩ 5> U7> Ԓ @ 1 - ,> T ` `"!x ? $x@`. 8 2@@ @B=@?-@$. 82 ˒ȑH 0>c(,VƔ >  耢`&`,VÓ:`㿘> 38#   (> N* ``" > T ` 0B: 0p`C >p(> N* `  " > !(`"   @2    (,        8   ' ^ ( > 3 7# d l" 0   +` +` **I ְ > 3> N ` `> 4> 3## *`2  `  #2#쀢 d l`` `+`"` " `" `2" " ""``  B<    ` 7`B < ` 08( @< B`:C :h` B#> 3c`C > N>`>h`^ > J"8<  .`2 2 * @  * E* * > N ` ` =`8* @*` 2$8 2 8h`d2 ਐ^`Z" 8਒`B >਒@ϔ`( B`C <(<8 @`> 3* 2`@ `  㿈`H /` * ! 沔        8 'E ( 2  H 00}"4 `>   //> 'В  @ H 00c ` ` @ "`  2`` ``` ` @7  2@`  ,, $ $   $ $@$a@`  `@ :   `@ *     ,, $ $   $ $$` 0ʐH 0㿘> Ԕ0`B :0H /f * ' >  d H 0 " 4 H /f * ' > b`  2` H 0  $ $ 4 $$ $ $ > ! ( $  $ 沐 (  $nU 7 ``"  82 ܀  $ "  "`  ?ܒ ܐ?""@@4E ܐ($  > 40> N"`` &@ *`"   *  "*   * "   :  > T``2**`> 3`cC <`͒  `` 7`B <``㿐>  `B @: @" '`!`B ;` 0 /  0 @@   @:> l'#  ' 2 !`B :<   `!B:`0p !  g͟  `!B:`0\ /!T '> 3> 3B# 48 ?#/ @2@/4 !(`C B8(804 ` ( ; `  !(Bz8(0" `0)  n!0`> N*@  `*`@`> 4Ln '@3!tttttt\ttttt(ttHt8@0H`x܌ܠܴ     $۸(((ݐ(d<T(> #'t''@. 'd`0 ``" ` `@<* !'``" ` `@0* '``  `@%*  '`<`  `@* 'H /f * ' t ^ t `$" > #8j $ x ( t?'t, #\  (  tH 0 J?"'0o!  t  @  !@ t @4  'tV 2 x  !H 0  A   A  A   A'H 0     "  "  ( 'h  `  t tt@ $ ' 'tt?c? "t @  ';'t 'tt`@ 0',`,`, 2 2 ,`,`` t2@> iȐ#h <"#@ ``*,` 2 > i#h *@+@"@`#@ 2 > i#h < *@+@"@`#@ 2 > i#h + *@+@"#@ ",` `'`'` '`$'   '  $`  $` $`  $`$ w* * "?"?"?"?` 2 `` 2 `` 2 `` 2 `2 `> J"8  -B: ' > J> J"8  -B: 'ǐ /&8X`B :XА@,ޒ `'d` 2`  4 " ` 2  `@2  " `8 Ӑ?"`8& @,   -`-@`%``%` ` %``$%`"L `H /f4 `* ' `   > 3 ,` #G,`` `?`,`vْ  H 0 Atv'Ѐ  M t 2  'H 0 Vt 2`2 `t> Jb8  AB: ' "`t4 `@0t` < 2`!@`PB:`P`` ` `` 8 ` 4 > J"8`B :!@`XB:`X A'`Ҥ`?π``,` ` >" 2` ,` 2`> 3 #G,``"```" ```> *#@*` `? ?@ ` >  8 > > Jb8 3`B :'!@X`B i:X!l` `? `,` 2 &`2 `t> J8  AB: H'`@ "`t  "V 8!@`PB:`P " V 8!@`B:`V 8 @2 > J"8`B :!@`XB:`X 3'Ѐ` @ "`  2`` `   `@1W  2  t  > 3@ z `> 3#耢` 2 `t  `  8 `2'@d@ '%%' 8 )?` @?  'l? ? 2` ` > * ` @  @  l `> * `*` @* 'll`?'l`'l? ? ? ? 2`,` ,` `? ? ? ? ,`,``t|  `@3 #  `x*` t I'`"` ?2` 6Zt  At':t`5`  `l @)' ( ` `* @> 3#l?c "#l'h" `  ( /'!@`hB(:`h  ` 2  " `  , *> J"8``B :`> Jb8 ` 7B: `' ,,`htH /f * ' >  ^ 'tH 0t`& 2`H /f> * '>   2 H 0 t "t"`t $" t2t" t"` t #V @2t> %t   ( # t (tt"` tp@h 'h& ?* p2 2 *@* %p  *`  * 2 2 **h @ ?* 2 2 .`.` "k> JVtt "`t4"p4*`p4* * * * p> J"8*x`B :x!@`pB:`pT "  !@``B:`` 't' t t`"`  t@l't 't  > Jb8p`B :p dЀ` `8T Ѐ`> `8 ? "`8geca^t܀> # > O#㿘4o 7H /f * ' >  ] H 0  4 H /f * ' > b` 2`H 0  $ $$ 4  --`H /f * ' > !]E $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  `  7$  sy& 㿐 ?H /f * ' >  ]  H 0  3 H /f * ' > b` 2`H 0  # ## 3    # ,`&      8 `"     $@  0 "     ?# y (4 7H /f * ' >  \ H 0  4 H /f * ' > b` 2`H 0  $ $$ 4  -H /f * ' > !\p $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8    ' 7$  r @& $ @ ,@,`  ` *` ,` ,``'`r `  "`㿘( ؒ (  ] 7&@ 2   &  &  & ``@&`H /f * ' >  [ H 0 2H /f * ' > b` 2`H 0 """22 7 " && 㿘 ,    4  @-d  " `8 +?"`8& 2@'_   .`.@&`&` &` &` ("@@ @` @@:  T &   *T  (!'P  "T" A@ @`@@:      *''h> #> ``` ' `  8)  ` ' 2 8>#ē* € @'԰`  2 `>#\* €!8 $  ` ?$ ` ` ?$ ` ` ?$ `@ ` ` `  ` ` `*@$ `€`  @`" `" ` "  `  ?$ ` ?ߐ $ ` ? $ `H /``* !` ` $"`   p  |4 H 0y``"v ` 2q `8l 6"> -7509<)04> -! 6/,  +Ԓ 2) ', ! 6#,  +Ȓ 2 , > -! 6,  + 2 , > -!Ā 6 ,  + ",  *`{ <*@ *  $  $ ` $ ` $ ` `@ `  `  ` ` ` $ ` *`Ű`;>"l*` € 沔 t '  '" ` `6>"*` €/  `,  `2 ( `2 $ `! `2  `2  `2  `2  `2  > !䀠 @  `  2   f '` $` `"@ @`ZH /`4 * !  !   '  !'! '!'!'!'!'! ' 2/' $$` `oҔ $H 0$ 6$` 75"  `<" ` ` "  *  `Ɛ > Kj#㿘`   ) 9 6 2 2( *  2$  2  2 ` R `:2"Ȁ  ` R` : Ȓ  ' " "@ v 㿘>     " $f$ @ {ϔ $``  `  {` O *> " @̒ $ : c {`> #> @` '`'  5 2&@W 7$@> 3 #G ,`,`$`?`3> *` €,  "& n > *#8@  > *#@*  V 8@2$@ 1     nʔ Ȑ`! > 3 #G,`,`   n Ā  ,`  ސ  2 2 2 2 )  '  > *#8@  (> *? ?@ > !!l @#'А /Ԓ , $ $ $  $ Ѐ  1 @ #@*  V 8@2 1? ? 2`6` `2 `@)  2  l 0x "g@` $ ` "`$``[$ W  S  2 2 2 2 ) > *: 7 > *#8@ 1 > *#@*? @?@ 6`  `2 `@)9  2  2  1`"  "`  "@-@ -'@ > 3#D `@  `  ` @ 5&@ > Iq#㿘    &&   -0! ``"` @`2`4" `` "`  ` ``"` > 3#D"`"  -㿘   `""`"@ǐ  2 5p> #'  ` @" @?&``"&@̰ &` "ư  @`"  @8 ` )2@`?퀢`> *` €@ $ߖ`&`  ?` ? 2`2`> *#8@ 8      "y@@"h `  //''' i'䖒 "r 1`   4@ 2h 1ऀ 2d 1 2R@^ 1@ ``lҔ ` !(D@P "M @`"I  ` @*D `2&` @ q` &`@ (7 ` i`&`< @*`` " ) @ Y`&` @*  @2   2   2@  *@   ?@& @   ?"@`?&   > H?#㿘沔   7   ' ’ ( * '8 0"??  ? ? 2* * ? ? ? ?  **  㿘 (a H /f * ' >  UȒ H 0" 0H /f * ' > b`  2` H 0 $  0   2 Y$ 7#V @0    (     (  &  6    ؖ(& &   k& &@  2   ("("<(<(㿐@      @: > ]9#   2 )> J   2/  `,` i   @: > ]#    > J8!`B  :@ !0 > J"8 `C : $    ! `,`@&@ 㿀> # '2°  > J"8 `C : &  ?2  " > J"8 `C : &  Д ?*  . b  2  2   2 "S> J      ?#@"E> J2`  2 `  2 `  24> J` 0> J` `  ` `$ " > J ` ` ?#@2`` 2`` 2``$  " `> J8`B .:`?#`  ? # '` ' # '`$'# 3  耢 &`&` &`$ &`  4*`2`2`.`.` ?Ӑ?# > F+#㿐> !> Ԡ!H"!   , , , 7 , , jM > Ԑ!P?" " 㿘H /` * !  > 4 4`h2` @%  "& $  & $& ( @~ @' 2  & (& $> "!H 0㿘 > 4 4`h3  > 44 x4  $   @%]     @O 㿐 `       @:> [    `2  > FP `B : ?? @@ "@,0ˀ  " 0`8 ` ` 2 `` 2`` ?` ? @? 2 ` `4* 2 2 .` .` `   "   2  ``* @``*@2 > 4`4 h2  `r ` h@$˔  3 `  (/@` ``  `` `` `@$  2@2 `( @ $`($`$ ( @@&В $`(> "!@`Ơ`4` @9` 5?` ? 2 ` `4* 2 2 .` .` ` ` @ "`  2`` ``` ``@$h  2@`"`$`$$`(`? ? .` .` a㿐> a H H /` * ! $> M"'' ` `` '' #  (  ? $ ( @ $ $$ 2 ` `` '' 2 (H 0㿈   )ऀ 2 H /f * ' >  R7 H 0`#>  4`H /f * ' > b`  2` H 0 `$ $`4`$@$`$`$` `H /f * ' Q H 0 0H /f * ' > b` 2`H 0   02`D0 @ ($`$` $@$`$`*+`+`+`  :  `* +`0#`4#` 8#`< #`> !!` #``#``#` #`"  #`#`#`  #` #` #`  #`$  ........ ?& &  ?&  &. .  (  :* 2 2 ..@. > 3> F#P.`  @ `B 8 //'耤@ `B:``"``$>  > Ԁ@ `B:`@ aB :a @ aB:a> ԐaP`? B 8  p   㿘> 4`  > `Y_ 0$> Ԑ * * > U!> U +  (+a"a"  #`>ɒc<!@ >  *"@ *`@ !@*`㿘  |Đ 8@ 8  @!0, , $  #2 * * @$$ # $ $ @㿘` |㿘!@@㿘 <  ` #2 @ @; @ @!v@8&`&` > 2`> `H X > 2`# 㿘@I (&`& & &㿘 2 > X| 2 > Xv `"  2 `   `*  @ & @ ( 2  & &  㿘  > XO   2 > XH e > FP `B ;@ (W?   뀢0> 4 `!>#ܓ*` € *  > 4 `> aX` > 4& * `"& & $> 4 `> a@XL > 4   > F P@ `B :> 4  > axX6    㿘H /``* !`  $& ?& 0>  @0> `@ & &@ & ? $0 $?& H 0㿘H /`* !  # " "  0 "  H 00 2 @> W!`2a@> W}! L ` @ > Wr!Ѐ2V > !Wk`j>#*` €> 4   6  > & h,@#vJ   &  @"  ] @ 0@  =>    7@ 03 >   &  6 >  >  > 4 g6 ?0> 4   6 > & g@u#- @ \ 0@ƒ H 0㿘H /` * ! !> U>Ô !>`>  > 4g>!> U!Ȁ`> M#> `" @`:@@@[ `2`> M"Ԁ !> 4%>     " (  "   "    ?$ `2 > 4 耢#> 8" `H" (@ 28H 0㿘> U!Ȥ`#> 4`$ @` 2@ `2`$Ȁ`> 4`$ @` 2@ `2`$> 4 耢` > U@`@b 2@> U" 4 > 3@ > 3#8` `> 3#H``@b``!`@`@0` `  ` 4@ @  `2`h> #'@̒     / /ђ''''䒒 '`4$ ̀` `8 ?"`8'̀ (̀` aޒ 2 J v '> $᠘ > ̀ 2: ̀ "6  L`?2` 8" 84 $$`0 ``L  "D @"̀`> 4 `> "> "HU   > ?"P㿘 ? ? > 4 `4@>> 4 耢+> 32#P " ( 2 , 2 0 2   4 " 2> 3#8` > U!Ȁ`  > U"`4   ) @ 㿀> L#> 3' ' ''8 R'H /` * !  @@  "*V  `"&V V  2"V `3> !>  e`耤@ ` e$@"0> 4eH 0!V  2@ @@? @V6 @H 0    ޚ # > >"`㿘   4  / 4 $$* L`& 0 "  V` 2 ``> 4`  &`` ` 6` @> a@ ee x> `4`@#'`0O`L@]  `4 F  @R " `4`   `4 ;5&`4"ހ` #0-"!8*#`4!2` $`28` > 4`0` <,44f `4!2#8  `  > 8 <bpT| #,44`# <   &`L> bTi #> > !ᘒ`#!"@ɒ <>’a$``$;Д  ?4` $`ϐ ; 4` `4> 4$&`4``$@"`@$`" ` `@Œ` ")`4@ f? 4`  $` ` =b) =,> 4 `> !l`D &`@ ǐ?"   $ &`D@ޒ? 4`$`T8 @<` #'  ' ''747'/'"܀ g> 4 `d#!> "ܔSِ X#U`4@7'> T8 @2<` #` '`  '`'`7'4'7/' ` @ "`  2`` `   @  2 ᘐ`@$"`?@"d$``4&`L ;&`4` "ϒ # > =H"㿀> #0l' + 0 !L "` 0aUaV!NW20HaPl aM+aO.0J!J1!KN@!(H /`4> U* !> U!Ȁ 2 /,"*  #>  ?&` &` ?&`  &`6` Sb .`  6`" &`$ `46`( ` $ H 0|@X'H /`4> 4* !> 4 耦_ \,* +@ "`$"`(" `,"L * X*!8 <#@  420@ T +` 4$ ,`-  @ 4  8  < ? @4?  06$@8 > c0R  ڢ`* * @2 2* "` ,H 0@ 8@ @`" @@* $ @ ` @  $ @ `$ @ `$ @ ` $ @ `$ @ `$ $@ `$ (@  `, ,@ &`&`&` &`&` &`$&`(&`, &`0$&`4(&`8,&`<0&`@4&`D@`$ "`@@H /`4> 4* !> 4 耤 !  ? ?  > M"Ԁ`` @``2 `2`@`2 H 0qH /`* !@ > U!Ȁ @ @H 0R`?` @`?` ''''? @? • 47H /` * ! 6 "  L2 R H 0&`(&` R&`$&`,H 0 > U"&`@` > ;:#p㿘  > Q#`2@> Q# `  ` `   2  4 ޔ (2  "  4 $$" L   0`` `@   `` =@y@ @    =`.`` =_@ `2 2  `    ?` 4 >  > 4am  @$ 2   "` `0 ```4 ``4  `  24 ` 4 `T   > 3#8`> 3#H`@r㿘H /` * ! !> U>ɒc<!8 >  *"@ *`@ !7*`> !``a@  `"` 1 $ > 4 $  #2 * * @\$ ``2a@H 0㿘  @ߐ  A 4     8 @?@$ 8 4 &  0W ` " x 8   A "  0 4  c 0 $ x " A 4$2 L.     L 2 8 8 ] !@ `W > cȖO n  T  >  > 4 `^4T 2T>  > 4 4`O$T ) ?"4 "& $  2?  $!@> ` `/@#y @ *     8  `" `    "   2 i`   <5" " # 0 0  G 0  㿘"` <"  3# 30-"/0*/ / / / / "/   `0` > P 0`` ]#@  >  Pr0 㿘`9 3  `     %     *@@g  `[! 㿘   H /` * !  @> U!Ȁ +  `(@ (  ,`,@ `$` $`  $` $` ,` 4` $`   44`$`(`( ڀ &@ &@H 0㿘   H /` * !  @> 4 耤` 5> k8h@ʒ 8` $`$`$`$ `$` $`$$r@ " `L NA` `L, `X,`8$ `<$$@ 444`8 $(`H#" @ $($(`\$0`P,$,`T % ,2 * "@*`  * -    " "  " " ` '` , 46`T   ,2`*`" *  8@  `` @&@ &@H 0> > 3'    ' ''''`'' '$#8'ܒ@   d  d @:> MT    `2  > FP `B :  `'` '`'`' > 4 `U!>    Mt F (䀢 $耢  쀢 ?#@> 4Ԁ  > 4؀ > 4܀  > 4 `> N`  > 4 `> Ba? ? ??  h 47 h`M  l> 4 `> a8M 0뀢 "  -`    Ѐ > 4 `Ү> ahL ਒ `? ~ 0@X  Ē //''''誒  4@  0 ` @    0 '` ` `@' '''`    " = ?> 4 `w!> !B =L lਠ@   0> aL 0V Q䀢 N耢 K쀢 H@0D +䀢 (耢 %쀢 !> !8!8` '`'`'' 4` 7‧`". `@И0 ܚ ` `".0`@/> ਀  !> "ʐL$ ਀  !> "(ДL ਀  !> "@L > FP `B ;p> # > 5Ȑ"X> #'@\  >  = a ?  @g  > "hM8(> K"H /f * ' >  Cx H 0" 4H /f * ' > b` 2`H 0 $ $4$$$$ T`ᐐ -H /f * ' > !C8 $$H 0$ ( $4$0$($,$<$8  "`$@   "4/'/ᐐ @$@ $ $*@ ,,, @  :  `*@  , @,@   ///р` /` @'`'`' ' < 4c'Ē 77'/' $$$ D$$   ` (`  @'`'`'` *'Y    | 2> 4 `!> "|J ''' '@G ؖ $ܲ($ ?$?$,(.`.`.`.`.`&` &`  &` &`? ?  .` .` , @ ` =  ?@$$ @ .`< ,` = X`, 2 2 ,, :.`.`ڔ (* 2 2 .`.`@  L > F!@ `B:`  > F!@ `B:`> FPP`B :P8 ?"8楐 桐 0 ``8 ?"`8 > 4#@> #'    ' ' ' $'  > 4 `!> # Ȑ Ő J > F  @@    @@:> I   `2 `> FP `B p: ?'` '`?'`'``* `**``@  2 2 2   `? ? 47Ѐ > 4 `9!> #XhДI 1> F  `> 4 `%> cI !> F`Δ  > 4 `> cI 0   ,`!  ` `@ 0 ) > cI 0 = ?> 4 `!>    =Il > F   L`0 T` 4 =  , ` = WN> ` 4``$`@> a@ Y    > 4 Y4`4`@ N42    ` =@z @  ```T` v>  > 4 Y4`֐0k` `2.T`  = , ` =V  `4``$`@>  Yd T` ` >  > 4 YT4`T` %2$4`  H o *@ a @@ "> 3@#8`@@ H 04`4 ?$4` $` B$` #> FPȘ `B ;# > 2M P> #'@   =>  a ?  @g   >  `I(> H H /f * ' >  ? H 0" 4H /f * ' > b` 2`H 0 $ $4$$$$ Nᐐ -H /f * ' > !? $$H 0$ ( $4$0$($,$<$8  $@` "4/'/ᐐ @$ $ $* ,,,   `*  :,,@ ? @ ; `  ` `/@/`//''''Ā < 4c 77'Ķ. ''$$ $ U$$|   2@> 4 `!>  .|G  '`('`?'` '$?$ $,($.`&` &`  &` &`? ?  .` .` `2`@   ` =@ ` @  ` =  ?@$$ @  .`< ,` = U4`, ., 2 2 ,,666.`.`.`.` :.`.`g (* 2 2 .`.`  ښ > F!@ `B:`  > F!@ `薂B:`> FPX`B :X8 ?"83 / 0 ``8 ?"`8G > 0! <5"!`"!`#!` !` " !`G!` 2 !`> "  22 㿘 >԰ b..㿘.I 㿘> 4 2  > Ԓ!"!"` " `` 0 ``> !X> aFn 0} '> 3\ 2 t& 2 8> F!` k f 8 |   0 ``> !X> aFA 0P@  8 @  $> Ԓa`$""`> 4 ` #>  a ̐ 0F%  `\$ & $ $$$$@6 > a@ V@'#o0@  > @ > 2`@ @:`@@&@V㿘> 4!` ; S`"  "`> "! "@  | ?N0& 㿘H /` * !  >  a  2 > bE 0~K 0 ``> !X> b8> 4< 0 ``> !X> bpE 0]! @ > 4 `>  bE `2== @6@ > a@ U@#ʐ04@ `2   @20(א0%& > 4`  #>  bؠ  0EE `""`> "!"@ | ܐ?& H 0㿐z   0> cE 0;ᝐ08#\ > c8E   `y&   > cD  > cD `""`> "!"@6 | ɐ?& 㿘 `  & 8  @   `& `0  ٘ 㿘  0> Dw#> 4!` > 4 `!> #X D 0"     {0 "㿘 > DE 8 ` "`cP> #' > 3   ' ''cH '> 3#8` > 4 `}!>  X DY o> F &`2  2  2 [ @@=   @@:> C    > FP `B H:  D}  > 4 `+> `D 0& `  ,`` = ?> 4 `!>   =C > F  Z> FPИ `B ;M > -!> #' > 3 a@ ' ''H '   > 4 `!> !(TQ`C > F? ? > 4 `!> !`;C > F  @@,  , @@:> C-   ` 0> FP `B t: `ꌔŐ 6 `> 4 `W> aC] 0R` *` * ` *`@  @ (> ' '''` /``*@  '7' "8`  "` %  #2 * * @> 4`% % ` ` *`*`@ * ` 2% ` 2- @<`T D%> 45> 3> 2   ~>  a ` v> bB q   ?  ?   "b {  BՒXZ  2X`@ "Q j  BÒbH X@* `  /e/d  'l 'p 't 'x 'X 2`* *` ' * 2` `*` ' /  +  *  * @ '  +  *  * @ '@W' 2 @ T*  (u DB4  >4  * *`@ *   d> 4 `,!> "BT #4  `@  @ > 4%_4 ` !> #ڐB2 4   ,` `= ?> 4 `!> #` `=B > F  @2v> FPؘ `B ;i > +#`@Z 4`@` `0'`'' `D''`4} ('> ''@; @7 @3      / /''''////'H / +!  c` `8?"`8  & $H 0 > +V#> #> 4a ' 't@ZА@ @ޒ   ////M 2 > 4 `7> cȔ A\ 2x!@’ 4'|'' ''it > 4 `> `  A? t`"  `8t`"  C t`8?"`8 %a $  > * pH> #> 4a '' -А@ @{   ////  ޿`"  `8 4 "`8:`  ?"` $  > * a $㿘> U!Ȁ "  2  @ /  2 2  㿘> 3#8`  > 3#H`" $ @  $ "@*`"  "`> U"! "> 4耤  @ " @  @`@`Ւ |(> #' '> @, А@ @ @ܒ      / /''''////'  `"& $a `8 4& $ "`8ܑ& $ > *  㿘> U!Ȁ  㿘H /` * ! > 3#8  > 3#H`> U> 4 `> 3#H> `@  H 00zaȀ  > !Ā v(> 4 `> a ? H 00^aȀ ()> 2 $  v "  $ L " $R  4 $ `` `` ?!h ݀ ` a@ a`` H @ L @R   @@@$@`H 0 㿘H /` * !   5 0& . 6 & 2 H 00o`)> U "`> U "   "@:H 0X   (H 0M  |Ĕ   H 0? @ ()> U$@$`$` $` $`$`$`$` $` $$`$! "$@ " $@ $@$` "& ! $` "" H 0 T   2㿘  |k  @C $  T $"  T$ @& T㿘`"  "` "@  |㿘> 4 耤 @2  X X2    " 㿘 ` |.  U @ `L `2&$`T`( `X> 4`   ? @" H /` * ! ``耢 $``"`#`$`H 0 `L `@` `> 4 ` !> !  X >L `i 㿘 P& 8 & <@ > 4 ` !> !Ԑ  X >*  \ +H /` * !  `"  "`  "@ T X | 2H 0L |@$x H /` * !    *@`?) G  L L &L L " LL &L L "  L 8&8 <&< D&D @&@ H&H L `P `@ > 4 ` !> "0QX = `; 27 L2 L 8 ' L0@䤒 > 4䀢`2`L> 4 `" > b X #\ =u0| "`8" <@@ L@o` [ `2R  2N    X2F  0  ?" @":  ' ' ' '?#> >   "@ @  `" " 8 @  " <'' <'@$ $ $ $ `$   2 8  @K " 1\ &\@ "`H 0㿘 T    悐  " L "R  $㿘> 4 +> M    L 6 ܐ  `> U!Ȁ`- "B` ? ? "  L 6  P    P $ P P "   "  P ?$ P  2 `"`??   "   L "  P  ?$ P  2 `耤 @) '> 4%>  ? ? "4  L"0  P  2 P@  ਀ "  P  X   bԀ $ @"  "  ,   ? $  2 0   @ ?$  2 X>  P'#耊'> 4 ` !> #  X;  > 4 耤 "  P "  X X2   C  2s   퀤=  2 `@ `2``> 4 `7!> #@U  X ; M @  ,  (/ 0' 4'''`+  @  M̦ > 4̀`" P  P & P!  ` @` X> #\#`c #d;g ̀``8?"`8c > %& @>  P'#耊'> 4 ` !>    X;> | @  آ  //Д I3@  (//I)    ݚ @> 4 P ?`& P# > 4 耤 B)> "*  P 2&  2#  X X2  i "  > 4 `"  X`#\  P:`  Հ ` !>  x X` :Ϛ` `8 4 "`8  > $  > hX#'> n   x> 4 ` > # a : Z @ x  @  //H  hl @ pt  @''''0* @ '4*'8*'<*@'/H]/ܒ8 @<''' > 4 `!> !@:>  Œ > #!x㿘 < 8  > 4 `> a:!  > & D` & D 8> & @` & @ `?> "@"@` ?> "`"`㿘> #H /` * ! ? ? " `4H 00>6  ( bxH 0㿘 0`" ` 2 `@   2  4(2       o 0 㿘 > *#8@> U b  "b> *#@.  > "!> "!e <htttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttttDp Lx,p㿘> U"@ؒ h> #> U'  `B ':   2 ?#@    ?#@,@'   //ђ  ِ> Ub@ b@@ ``!"` `j 2~``$ `$`(  `$`, `$`0 `$@  2h`` ``  `` `` `@ؔ  2R``Ȁ?" `B < @  "  `B ;< 7沔 x  /`@̔і@\8̐ LH 28̀ ""(`B  :(6 L8 "'  '̦`@@2y``0`@@&8̐ L 28t̀ "n"(`B ;:( L8 5  0"`B : ; `B : ;2@J> J  "  !@`(B:`( #   > J8PB?:P > !!!㿐`>܀`C#@ ? =?     > 3# `/>  !  ? )> U 2#\"@`  ;  j `?#\#`"@  (> #'T'X' 'H'L'P @ '  ' '` R `:2    A 7    ``' 8# `  $" ' (  ܐ" '  " '  ؐ (& &  (ɔ        (& 2 7F' &` `&` &`  &`$`$` H `@` $``$Қ 2  %  1"'&`&` &` &``@ > * @`4@* '`d<*2 2  ```2 .`.`.`.@ `j.`{.` R `: `Ȁ?`:2`Ȑ( '7= ` (7 2` X 'R` :> U "> F!@ `B:``>#t*` €  `!@ `B:`` "> F!@ `B:` "> F!@ `B:` "> F!@ `Bz:` "w> F!@ `Bo:` "l> F!@ `Bd:` "a> F!@ `ȖBY:` "V> F!@ `BN:` "K> F!@ aBC:a "@> F!@ aB8:a "5> F!@ `ЖB-:` "*> F!@ `ؖB":` "> F!@ `B:` "> F!@ `薂B :` " > F!@ `B:`> F P,  B;0`B  :0  @!@`  ```8 ?"`8  > d!㿘):- 00i le 0k   " 0  ɔ )͖ ĘW :   sh >  @ c '`  '̖̐R`F.`>! €`> 4ސ" :'̑H /` * ! > 3> 3#|:  '̑H 0> Ub@,  '̑H 0H 0 ?$`,`j    $`4 '̒  * ``(* 񀦠  > !!$``` $``$` $`  ?6 Ȑ`2> 3> 4w"#耦 2` `̀  $`ǀ  > !``S 1 O 1    ?#@A 1    ?q - 1"ऀ ' 1$`$ $`($`,$`0 Q> !`` 1 ^ /``@``$R̖ 2 ̀ m 1i'̐$`$$`($`, $`0$` $`$`$` WS   8J'̠А@   //А`B1 #2  97'̀ " 1'̠''' '''р`' /'̐'   -'̐~9 ~P> 3" ~Y > "0(> # ' 8> ` `@    ' u '& "T     2 /  1   8  ݐ 8  ِ 8 Ր 8'''  ''''e     @ $v 2 6  1' 2`z '` 2 4  2  4  2 4 2 4 9 $ ``  ` 0`8 0```$" `?ܐ?" 0  0  `` ?В`0&`&`  0} `_ 7` `` 0&`V 7`? 6 (2 (c 4 4 4 `F4 `H d<+2 `2  ```2  ..... @   @Đ.@&`& ` &`  (&&&&  7&$* `4 <c4 > 6,`",  @  ǣ ' /'}=& }7 > "@㿘@` +> 4!*`   0@+$ 2@ * $㿘@ 2> 4!*`"  㿘 沔 }  2 H /` * !  L> 4a(~  |H 0 7H 0j    㿘 & ` 2` `@ (  Jה  2`  ~` > 4Ra* @ ``|㿘  ﵔ  $ 8 @ H /f * '   ̶ H 0 2  > 4!("`  > 4`@ 4 R* @ 2  7 㿘` > 4Ra* @@H /f * '    t H 0 " 㿘  *`2`  > 4!:` `& +`0 | H /f * ' 9H p@㿘> 4!  . `2  . ** *  *  J  '> 4!)> 4  @  !l?d 4@ 4  4?`> 4!8` "$` J$`$` 4 Jڔ  > 4 !l?E 4> 4!8  "$  J$ $  㿘 > "> 4a8""@ "`ŰŸʼʼʼʼʼd$$Œ,㿘   &   㿘  J  " @\ > 4>  $ $4 "$ 㿘> 4!!" @@@ "@ 2@@"@> 4a?"a> 4a?"a  J 㿐  ,   *  ,   J5   > 5 4`     2 >*@* @  | `"6> 4``0s0 א@ؒ   5,,4$[ m> 4!`` " @` @`2`0B!``  `  @`*  `@`2`z@   5,,4$ '!``  2@` s@`2`zq> 4!` ` b@`2`z`@[8 Jh> #'@M  "  "  $  $  //  h  //  JU  ' &@*`&`T&`Xр  0 ( 2' 7 ( ,' 0' 4' J'7Ґ@`&`D&`Hр  0 X b' 7 X \' `' d' z'7Ґ@x`&`X&`Tр  0 , 4' 7 8 <' @' D' L'7Ґ@Y`&`H&`Dр  0 \ d' 7 h l' p' t' |'7Ғ@:̐ &`P 2@р  "  x  ` " $ 0*` $ *` " $ H*` $*  > "ȁ㿐  0  @2  P  @2 P  Ԁ@"  P 2   @2    @2   ܀@"!% !% "! !$   ?! "!A!   ?!A "!|!@   ?!| "!R    ?! "!tR    ?!t "!xR    ?!x "!R    ?! "!R    ?! "!\R    ?!\ "!`    ?!`     ? J  ' &@&`@ ]&`@     @   Ԁ@  @&`@ q    @   ܀@  @&` @ Y &`@ :!$&`@ 5!!@ &`@ -!@!| &`(@ ! &`,@ !t &`h@  !x &`l@  ! &`p@ Ҕ ! &`t@ ɔ !\ &` @# !` &`$@  @ `x! 2! x |@H@'xt x" `   t J  㿘@`! A > -   -00  -0+> -$ 3#*@  " 2*@ " *@ "> - l*@ " - > #'H''h'X'd@֒ |> 4! 'P `> 4`2@`a ?  J  'X @ X - - >  45 4HX% ;=`X0l {'ha      l 2 ~lwlX@Xf J'XH@ Z'h ?`R>!P*` €P@n" R /TL A'ht@ אX@ Ӑؔ  h:'R .'H  Jq  'X$ @G X'd''@ dh ` 䀢 耢   ܀  䀢 耢  ܀   H /`4 * !       l 2 3`:L  `$ kB'X@ X` ! ,! 'h@ @ M!$@ J!@ G!@@ ” @  @  @ r @ n @  Đ@  @  @ ~ @ N  @ J !#`#\!@ ''' b$ BW 'h`@$ >)X)'X        Ā  Ȁ  @ @ \ @ X @ T H 04h ` 䀢 耢   ܀  䀢 耢    ܀   H /`4 * !       l 2 3`9e /  ` + Ax'X@  ! ,!ޔ\ 'h@,@ f!$@ c!@ `!@@۔ @ה @Ӕ @  @  @ Ք Đ@ є @  @  @ g  @ c !#`#\ܒ!@ ''' ^$ Ap 'h X?6'h'X=@XH 0s'X H /`4 * !       l 2 3`8ϒ  ?H 0IhLN` ? X ;'h 8'P H /`4 * !       l 2 3`8 ]X 'h 'PH 0h`> 4 $``" 8 JC  'X @ 8X 2@X> `"X8 0X 8'Ԓ J-  'X H ` * @$`X@ 8X> 2@X"`8 0X 'В J  'XĐ @ X 2@X> "`8u X''h ` >!(*` €H /`4> -* !> -"`  ` `Gs 2 `H 0H /` * ! >":5 H 0yh>'p"'t:'p 'h  7khh'h H /`4 * !       l 2 3`7Ē  ` 􀢠   l 2 3`7 w "u    `" ` ""`  `"$ ` ""`$ " H 0h  ?    -       #\#`ܐ@`@  0@ 47 0H `0 Ր * ?  0 8 ?"8@Ք 0 2  `0@Δ 0 2  `` ` `   `H 0h` Ft'hH 0hH 0 7> -c  #> 7 "c> bؐ`#\ ؔ  ՘ ` ؒ 2 H 0g @슒 ؐ $`$``$` 0  /`/a7b 07'd`07  0 `>!*` €",` ,` ,` ,` ,` ,``> 7 "N0FH 0$    ` ,``|6Ԕ `|@8 ``6ɔ  ``@-       l 2 3` ,`B$`` B$`"- n, *  $``"> 7E0 !H 0ΐ 7 2@` n2``"`"``R`6{` Ā+ n,   $``"> 7E0 !ȒH 0 7 2@` n2``"`"``R`6N` `G  ( ('h`" ``Ā``"`" ``"@` "`B` "> 7B> 7 !H 0ah> -""`$``"`А`""$`> -b "b <`,`H 0Ah"HT 7'ha " `" ` @2  ET rCTh  `2`@  ᬒ`$`  $ᬒ $`?$ᬐ 'hh  7 5 73 *"@h &  -     *`+@ *> 4b0(@  X> 4"p @  XP ɘ 'hX "HŒ JH’ J h 'hH 0h> # > ."> 4$> 4!`"  @  ?`  ? P h଀ "R    ?ఀ "R    ? J伔  x @꒒ |@ꎒ'x  7 /`7`/@'`ࢀ 2` /` 3 l  /`"@'2 2@   4`@'2 2@   4`଀ 'R   ? 2 3ଠ3  R4ג`ఀ 'R   ? 2 3ఠ3  R4’`ഀ 'R   ? 2 2ഠ   ഐ 2 R4`฀ 'R   ? 2 2ภ  22 R4`''tt  *2 'p5> > -l 6` 6`ࢀ 2J l>  > b@  >   @8!c@z  >    c@p  >  @ c@f >   (!c @[ >  P .`6` (6`c0@N  "+>   ( .`6`6` +> !> > c8#@<  >   #c@@3  +>  .`6`6` +> cH@' >  3 cX@  >  ) ch@ >   cx@   > ! c@  > !  c@  > -" .@6`6`> -a|> -> -> -!x> -a> -!;= > -p=`+> -at> ==&`&`>`>` >`(>`0>`8>`@t`Hp `@ ,'p`x   `@ J! 3 26 !  l"!O - J!$  ?` p @   't? x@ߒ |t@ېt `'t'x *@*`!> 4*`!4`t"`2` #!'|@9ttt'@e t.`2 $t@] tt'@>!$t!'@9t    @衐~ J㿘!> Ԓ @藐!Ȓ >>>!$!ȔĖ#" " `" 㿘> r!ȁ xxx׀׀׀جج<<ٔ\\׀׀hh׀׀׀p\㿈> #'@\ |` & * 2h     >   `4 2W   `Q O  K> 4!*`& `(D * @ * @ *``ݨ >!T*` €2#  8 "  8  8  瀢   2  `` ? 2  `  !( `   4` ` 2 @Ȓ `@ [ `2Ӱ ` + 2    4` 6`E ( `k`?: *  2 5 (  8 + (  8 ! (  8  CgJ?`=@g  ?(   *  "Tz (w  $@ H @ H @ = 8b   8^   `@ * -(R  + 2    +`2 ? 6 @ 4< `  ` 20 @8+ &@* &`ߤ`2!  > 4!*` 2       `    `    >  F#PXphxހހހހހ``8"0 ` ` * ` * ` *`" `*!` "`  $" $` "`  $@" $`  $" $`  $" $`  $" $ `  $" $ 2`" a*`$2* al2`` "` `* * `"`>(           * `"`$ >Ї(        * `$"`$ " `$@"`$ " `$"`$ " `$"`$ " `$" " "㿐`Ho o>    ''H 0 "N`"`0"`0 &  $  $ ?& $` >  $  $ ?& $` >  $ :` B   & $2 (#  ' (f ː` $ ?& $` >  $ P& $ $ ?L& $ &  $" $ =& $` >  $! $ >& $` >  $ :` B  & $2 (#  ' X# ` $ ?& $` >  $$ & $ $ ; & $& `> `> `> ȁ@  $3"$=@"39@"$# $"$; $"$; $ "$@ $# $"$; $"$; $" @# ; ; ; @ #@㿘\ ``z @ 0@ 0`2 `  @l@h`@dB> .`.  0.@.    0O 6   .  &  . &  6  6 6`.`&``&` 6``66`4.`6   .  &  &  &  &  &  &  &  . (& $ 6 * 6 ,6`.`&` &` &`&``&`` &``&` `&`$6`*`6`,.`(㿘```  `` 0 /.㿘@  ? 2 2@`&.@`*@  ?@&㿘`(!!@ n*  s &@`*`2 22  n & "` n"`R`.ʒ` 㿘`.!t!x@ n*  G &@`*`2 "   2@ 2@ n & "` n"`R`.` 㿘`/!!|@ n*  ?&@`*` 2 022߻ n & "` n"`R`.e` 㿘ataxR ` `2`2  "  2`&R .D R`  ?@&㿘aaR ` `2`2  22`&R . R`  ?@&㿘aa|R ` `2`2 "2  " 2 22`&R - R`  ?@&` ``0"2 `0" 2 㿘`  ? 2 2`*`2`&a`-```  ? 2 2`*`2`&a\-``  ?@&㿘`>   # 㿘> #` `@}`?@`> U""X` >  #0 40@O1 &`0> `@@(&`D> `"&`D`D> U!> B#`""T> ` @?`0&`4@ 2 *@&`8 <- '' @#\#` ?S  > 2cP@ >  0 4 &`@%> [ 4|` c` @>`<  c``T    Ңc`@`@* @ `8@* ? 5 >#?`@`0&c`/:  0$ Є&`@ :`@>`< `T  ?&`8&`< H `0" `0@* ?  "@`0 "`0" H 0 `0> @ `82`4 `2 !3 4  > @槒c 2'4 ''@> %> #>@>Đ@; 'c  @> > B`> UT> U2@ X* <c`#@0 @("@ 0 p > UX`> B`< "0@("0 4@㿘> #   `@<`?㿘  >  & " 4>    4>  > c  > ! 㿘`>    P> #`` 4> > u!`>N!@# ` > > c!P0`!`4  > @` 2'4 '''> @=h @ &`< w  &`8> !ph@=Ö@>> !N`%!)> @: !$w@:  @ j >'h N 4'> N)> @=!a@划 2@:w > @xa 2㌐ $㌐@ 4 >'hr @= Ґ㿘` > > #`> >  `@  > > !P0!`1> U"` >$   &"`> !@༒$>"@#㿘` > > #`> >  `@  > > !P0!`1> U"` >$ ڵ  &"`> А!@$>R" @P> #`` $`> c!P0P0`4 @L &`0`@< @L &`45> @=h $`0@ &`< |  &`8> "h@<Ȗ`0> U> "\"85 `a4  > @仒`Ѐ 2'a4 ''>  Ƞ#>'` '> `'`' 㿘 < 2`4> ^"H? ? -   =" @ <  8@  &`0  * * @ 2 &`0P> # ` q> `<2| > `<@"s `  '''#  > 4 $#. '䀢  ?@> B#`@K  ` '`'?'` '8` !'> @`Ȁ  8> @ `  2'8> @` 2'8 ''@'   "'耢`">@'>h 㿘l 㿘d 㿘\ 㿘> 4#. > c* 8@L*  > > U"\`4 o"`> U> "x "`*`  `" @  2㿘> U"``?> K"2. > F"@ 2"@> U.`!> > U .`!>  2 &   >"@  2    2> "@Ӓ "@&@E& 㿘> #`+> B#`@ %#`?    2 #+`? ҃@ @ 2  @ 2   @Jܔ 㿘> B#`?@> [#@]F 㿘> U"|`P> U"`)Ho o > #`> U ?8` **H 0 02> U "?8`**"> U "?8`**"Ho o > #`> U ?8` **H 0 > D`T> +T(2 > U"dH 㿘> # "   > 0> 0 > #> # @`?Z#(㿘?80 @JS > c ?8 > U  > U > U*b"|> #8> U>"da4 > U"`f 㿘> U"|`> '#@H > U ‐*"|**@H 0 > U "㿘> #` >`? > 5`0@8   ' 8@ 㿘 > 5"    @I0> U#X > U *`* @ *#b@ @ > " < ) > 5"  *   *   +#  ℀`* `> `#p`> #> #@[ 0 Ԁ` > `&Q#㿘> #` V` >`? > 5`l@   ' 8@ 㿘> .#В  0@I%> 5> 5"`@"L㿘> #`2>`? > 5`@ "   'c 8@ > @ᒐ#X`?㿘> #` > #ؐ  > @9cࠒ 2> > ?##> @o`  0 @I2!> W#> [ c   &c @ 0 @I(> W`> [#   > > U`X> 5> 5 "`L"@ > *  *`  *  > U# <"b㿘> #  >`? > @#h   &ޒ 8@  >  " >  @`?㿐!> #   ?* *   @H ?   @H0? ?> U> U"""" `#  ?0 @H ?` ` > U> 5"b" Ԡ'>  $ '$@) d@`>  > :` @ d@  #8㿘H/` /  > aؚ    "a > aؐ?"aؚ`?H 0 `> B#`> U> W  > [#  > U> 㜀g> UX `* `*  `*  `*  `*  `* 㿘> 5 `!!>  耢`d> ϐ P d> "`pВ d$ @څ"@!> U> "`" *'ې " *`'Ԑ " h*`%> "@@  >   d$@c> "`#> `t `t$`t`t@ >   d$`t`t> " p@I> 53  ` :  d@!>  :`@4:`" #  >  > Ub> U"* "+ "@#  >  ?`*`  "* " ` > U: ##"b'r# 'j 㿐H/` /> 5`  > U"  ''U'Q 0> #> U"@'? 'H 0[ 㿐> 5 `> > i c  > U"> Ub ' #> U" ""  "`0"# ? '> 5 ([> U"# @ > U"* "# * ?"`  㿘8`(< ;`; :9 (`/`+* *`*@  ( .  `.` . . `D@`E   43  F,  ?+  +`2aman> . P @ 4`.`(&@& (.`& ' . ((㿘>  Ta@- @߿ @$* @߶ &  E& &    >  `?   ,R  4  6>  *`R $ `& & 4& Ta@߂@.& @z.@ <& @r <&@ؒ * @j & @ϐ*  @a&  @Ɛ*  @X &  @ؼ* @N  &  @ز* @D  &  @ا* @9 & 㿘> UY`?!b  > Ґ! ư!@ > 5 `@>    `@- `-Ԛ> "`   > !@$ `#> @%>  , " 6> > !!Ta@D > !h> ~!x> 5 ` >  -> U"`)@2>  `!> U" ?  ' `,',',',',',',',' ' `,'(㿈@@㿈@J'@&> U℅H> U№  *  @( `" (H > U℅H> U№  * *@ `" (H 㿘!T!@ץ!@7@מ..`@0.@ח <.`@) <.` @% .`'> 52>>!m!lP`.` ؐ "` @   &  ؒ "  .`.` 9 5  1 '    2mn 8  > 5؆@ * (@* (* ("@㿘> 5 `%0=H >   & & H 0 > !܄  !   > 54> 5ܔ & "? & ?/a `&&   "㿘> #` >  : %"@8@s /1> 5 @  ! %3 `  @ , @>   @  ϒ @`㿘> 5 @ 6 - > 5 L` "L!> @N* :  .@> `@t 2`@  #XϘ @N* :  ٴ` L  㿘> 5 D` #> 5 %> $`H D!X  $`H D 2$`H % D㿘> 5H> 5 D`" D"Hz 㿘> #` > @!`?㿘  0@C > U"b> 5 > *<U!㿘> 5J!<`"> U" `*$"@㿘  > @Ɛ!Ѐ`?  `@۽  > # `?㿘>&`0b`<>> #` > U80 @Cl &`4> U"> 5"a@>  !؁㿘 H  8@; > U`& 8& 8> c  H  8> 5!p ?c 4  2H 0 c Ho o> 5 8!p ֪@H 0   > D`T> #(2  <㿘`@C`?> #' &`0> a@3n  &`LX:   @2`H &`H`H  >!: 0>!6!x> #  0 > !> "> 5"a@j`H> `"a0`@@[> U#T``8`< (@~a`@/``4>  d> U"(> U> > W0 "ЖX{> UJb b> "8C > @"@``"`H@6`H > ۔!xH/ /aD@T&H 0c > "H㾐'p!p:   &!> U "cT㿘> bX>   "` `   > "p> "h $ >  ,": > b <->  D"ޕ: %>   `&c>  :` ѐ"> `&c l :` > # > #(   s h>  "> b T>  \#0: `> #H㿘>  D#P 8 < @  ""`l0= . 08" >&"`"`"` "`"` "!X"!H"!L"!P+"!T "`l"   "` "`"`"`  ("`l"   "` "`"`"`  ("`!"!"`l"   "` "`"`"`  ("`㿘!> U#X #X  "" 6y # !?00 $}0+!@  d !& & & & \!& d!0  "_^ @ !,! & & & & d& \b@ !$ @! & l& & & d& \& `& 㿘@.s> c@1ؔ & h& d> c @1ѐ& \> c@1˔ & 㿘`? > c@@1$`& > cА@1 > c@1 > c $`@1$` `  * & * "@> $  * $`l$`$`> $``@1 ! &!㿘!  > cȔ @c > U> "(ܒ (㿘`  > `P@1& > ``@1f  2&  & !> & @1 h >  @1ޒ`x {>  v h@1K & 4> ` @1E& , `> !> %>  )> `   * `2 * `"& 0>  & 0 @1!` 4& 8!~!| 8& $x@1 & L  @1& D`  `   *@ `2 * `"& H>  & H @0& P L!N!L P 0& < H 8  ,&  D@ 8  $& 5 > a@0Ք & > a( @0ϐ&  `>  )> `   * `2 * `"& >  >&  @0a8 ! !&@1,!P 3!P@0 & d> a` @0& \ ` > `   * `2 * `"& `> !x& ` @0va& h d Ӑ  h& T > !㿘@ Ā( Ƣ㿘@@㿘 ւ>A!  @ & T&!> r!  T &!>A"PbX&!H&!\ T   & 㿘 >`T  #@2 > R!@, 㿘 &   Ң @|㿘 H H:  < @&!\& 4& \& &! &!0&!,&!D&!4&!H&!L&!P&!T@Z&!X&ƀƠ㿘 H @> H` > c(@/Д?`4 ` > c@@/Ĕ?> <  > #` ` > cP@/?`4 ` > ?c`@/)> 6< % ?"?c(@/?> > 8c@@/?> > <cP@/?> ?c`@/|)> > 6 #@2  ?2  ?2  ?2   ?2 & 8& <& @& D ` 4 2 \ & 4 \ 2   & \ 2!  & ! 2   &!  ` €`"!0 2!0# #> c@/ & @+c@/ & !0 2!,  &!0!, 2!D  &!,!D 2!4  &!D!4 2!8  &!4!8 2!H  $&!8!H 2!L  (&!H!L 2!P  ,&!L!P 2!T  0&!P!T 2!X  4&!T!X 2!\  8&!X!\ 2!`  <&!\!` 2!d  @&!`!d 2!t  D&!d!t   H&!t㿘> 6#D`#D`2``?2`` 2` `@ 2`> H㿘> 7a  "aHo o> 7   `  W"` H 0 > U""ȁ㿘> #`2    `>  `@`?㿘> #` > U#x 2">  Ґ p`2 > U 0 @=ʖ > U"#x> n 㿘 >  >  > > ] > > !V> Ucx`> > @!8LX>  !㿘> E!> > >!> > !7`>  "8㿐>!8€` `> "P2`> 7a<> 7!@ " > 7 ?"D#a<#!@㿘 + #`!> "> 7aD "aD> "> 7D + > 7a< "D"a<Ђ$ Т@  㿐>!8€ ''|㿘 4 > U#. @  `@,L$ ` " 㿘``@/ "$ > #`2  > B> #` > B > c@-R?V`  `?#`  & 48@ 㿈`> U,#`@,$ 2 a0`@"a0>  #`> ]# 0`> #@V `0> 7` ```P,> cX '耤  > #`'2> U> #p'> U> 7'' ,&&&& m&!h &!hȔ  > 7@&!P&> 7aH  &.G.J.H .K @^ > 2   @ H /k * , @C H 0 \`\ \ > a䀢 2> Ԑ > "> > 7a @6"> 7a @6  > a耥"> >  #xcHo o> 7h @  @ H 0㿘`" >  # >  # 㿘> 7     ,@ @ "L |   $ L |L آ@@   `> U㬀  > # "㬀  0x 㿘> Uc + "cH /e * & > 7a   . @ " @  H 0 㿘@j @f   * 2 :@ؒ 㿘`2  >  a#.`@ǐ 4 @: 2 <`. =. <  H( @ *I@*G *I *G@@   *H*J*K@  *H*K*J *J*H*KH  㿘*3> c "d c `" \  㿘*3> c "O *c`G 㿘>  `" ;  㿘> *@#`. 㿘 >  `" "  㿘 > *@#` 㿘> U#|%>  @    > W `@j@,㿘H/` /#> c    c   H 0㿘H/` /#> c  ɐ  c. Ð H 0> U> 7? O @( `(  " " 㿘> Uc|㿘> Uc|ǒ`> U㐄 㐄 " " 㿐>  ` Ho o   `    `H 0% H/` /1> #`> N#`$ *``P#`> N#`$*H 0 " 㿐`/Ho o>    `   0 T@H 0> c>   '> 7``"`@&'>  € ??`>  U -%> p @ " > `@ 2 >  = @%> > c`€ >   ``@)> @ѸcX Op%> '> 77>  %> '> 77> `J@ 2`J@ :J` ` z$?@&l €p >   K@p p@ " > @ 2%> >   0ݒ`@)> @q` `> W" H& @)> @ecX ?Op `J@ 2`J@ :?J` ` z$ ? @`L'> 7`H7> JJ@@`>   `  `$ >   @*n   > U> 7"c Ģ -` ג ,`>  !,  > U# " > U"|@&bb @ > !(㿘` 5 % ` % `. 5. % % 㿘  ސ p ̒ 0`` 㿘 0  0@̞  S 0&  4 <& $ 8& ,& (     ~  y   t  p  l   g  c _ [ W  S q n  I  E  A 㿘`0$  8  R 8   @  `€   @ `7 8   @  `€ "  @ 㿘 0  N L " ? . L `@? \ * L * L * L㿘 ݔ  ٔ \g]bgbD^c4beegffpgf㿘> #   "     2> > !!@@ "     ?  㿘`>  8! 㿘@  @  " d@ @  @@ 㿈 2&`P80 @7d &`P`p&`l &`p&`&`d`d&`h> 8`" >@2cp>#\&`0 `0 @2"&`4`P 7&`&`&`   7 *` @ " 2 7+ `p &`p`P&``&`&`@   X@  X`   X> 7"0`" X> ! X&`|`p  @ @t > !> `a> 4 ! 8 7'> #`> > !!@  *>  " #b| 04    >  <@ >@  >'>b|`>`ؒc~> 7"`'5>' ``' @"F 㿘$ pg   * @* ^  & @ @ !> 7` #@"0ѐ# @ Ѐ 2`aȐ"@   "0@Ґ "0 "0  > "  > %>  (& > "0`   `? p   *@  㿘  >  0"8  ?> ̐"X?&`&`ܐ T&`,`" @  @ @> 7#`0`&`&`X2&>@(?"!>> #!( ھ!@&`@c>aap!(a㿘 D> 7 `:  6* * @ $  T  7"0`& @>  <"p PH /d * %  ퟐ!!8 2 $@*0  l > 3"@ƐH 00 0(& 0H /d * % }SH 0㿘 $  d&!8&  h &  h"# h@ 㿘 ` $   & &  "`  "@`$  &  h&  h"@$ h&!8 ̐&`@& `$}&! >  *!@ $ l㿘 p "   *@  *@v  * p`  *@> 7"0`> "Ё㿘 p " T d  ߔ    T *` " ` + * ``*`*0  *` "` 2 ``*` ꩒ 0 ꥒ 㿘H /d * %   $ & H 0㿘 $H /d * %  ?& d@l @y H 0㿘a " '>  `Ѐ``$  А ? , Ґ 2 >  b?$ ?㿘 a ``?  @  ? $?  *㿘> 7  :  6J * @  p2``  ` *` *  > 7* b,  2 ,  "  Ā " # ?  $ $ 䀢$ @C `  *@"     $  $     $ > 72 @  ( """ ( "( " "ࠝ㿘>>ݔ " P㿘>>ݔ " D 㿘 l > f#0@㿈 $>  #( l X`> ``> % P> ! P> G"00> #@ @X0 >  > #\ > #` > #d ##hX,#0)㿘 dH /d * % > p ! "& l l & l@<H 0㿘H o*@ e@' H 0㿘 "&  H /d * % @ H 0 㿐   l> ɐ x l`i& >   d`2a & lȰ $````"`& h``"@$a80@2H l`>!*` €& t$`<a$`T$``   & l* T`ܐ * @ " ` "`ݐ! ?$ ``$` p ` & l>  耢`ap`ꌓ:`u ` ?$` p " `0@2`@A$`@@=:  $`4  /   & (    `" 2  `@Z(  ? h& l$` & l& `p`0B<`p>   ;*`$  $`` `@a`̪`$a:` @8> B#`  !: 8$`<- $`@Ĭ%@ ``Ȓ@ > ݐ @b`H> 70@ & `&  /*"0` > !0> !8#\> `ܐ `  & l& $&  M _, `ߒ@ ` X   R   L   F >   y 怢 " `: r ŀ 25  `ߑ,@ `i ,  `c % ^  ` `X   R   L   F    @  & l`0>   k*`T 飐  p ` & l> ` @ 2ZC `0  > 7 2 > 7` ( N@ @> 7"0`> @$`> U ?8`* *‐ *0> #`#> U b!?8  ,,b b ,,b0V <`0@Œ"  2> 7 2 > 7 D 2> 7 | @2? t> 7b0  0@> !P> !`p > `Ԑ!p`     | 4 x"0 ?  & |> ! y& x x  & x & l t " x`Ѐ &!> > a; ?D > "0& t??& x | ?> 70 ?  & |> !z D& x`Ѐ``Ȑ `$``Ԕ"  $` $`̀$`@"$@a d d>   2`@ & & l & n:`W 覐   & l& & (    `"  s& l>  * O@ 8 臐  p ` & l> ` @ܒ >'   > 7 >?  > 7"0`>  @D d$`` " p >   㿈 da & x`耊   t   6 " p`   `耊   1& l/& l-& l "`Ѐ &!> > ; a?q  >   >  >  >  ##\#`#d#hX#0 ($0$4 t & t? 㿘> 7c6   bA@ "@@"  `p@Jb@G 0z ">@Se e@ 0p !@"4V  `m@`q@ 0a )"=@, e g@W   !Q N L   @] " A> @]`: 7 @ 3 2. n) @)% İ &&& & &&&& & $&$(&(,&,0&0 & $ 㿘> 7c4`  `Đ t -  2t 7  &, 2@ t $D$,$0 ```> 7b0* $H$T$<> "(Ȕ 2H /d * % 3> #> 0"`*` * bH͘  #H 0 # H /d * % vːH 00(24&s 㿘> 7 c2 !@†@ƒ""$ (> bP$ 8Ĕ  $ 0$ , @ $ 4 4 >  b`@ !,4 HĘ  $  4$ < 84 J$ Xu$ $   aW4 $ $, 4 >`@[ > "p3㿘> #   $ O Ր  J 0   p  ? *@Ɛ   *@㿘 1> >  "x@  "0 `p2```   *` ( > 7(, /> 8=%/> B%/> 8  4$ 4   93   @2 $ _$ 6@  , ,2 @$ $ +> c`-?8 -0-?8 - ?$ $` --00 $ 0& @-a! Ѐ2 @ , ?$ $ @-a Ѐ 2 @`  ,` @$ $ $ +> c`+?P `-`0+-?P%/> 8@̀㿘`>  _" > @bВJ@ > T"3> 8`< @ !<: `<> G"!@> !<B" 㿘> #`2 2 ` D 2   & D @Ŷ`?P`   "`> #0g`> _^@c @ې@1&`0>  0> cH@ϔ ?&`@ 2 a4 H &`< L&`8)& D  > @ŀb 2'a4 ''#> @cX @ &`<   &`8> #`,cX@]@ 5> #>@@I  @ 'aO @ 㿘 < 21`0`4=#  ?*@2`&a@Q&a<> #`"`0> #>* `  &`4&`0 &a<=&a@ `<"@"`   0. `4&a<` (&a@`0+  *  <    `4  8@  @ ` @  #@  8@ `# `ޑ+ 㿘`$#>   b> `#> # @ɑ  2 $& 4& $ 4㿘> 8 (. @> #)  4 #>  `"  @ b  2 㿘>  b@ؐ a<: 2` >   ` 8`? `> #` >#'b<`8 > 8,`* "* ` 0`& & &`4 > 7&``?&`\ O# ,   *  > !ɒ `\  > ! `  > 7 "  b`" `"b" `\  > !(` > 7 b "` b"   2>  !@ > !0> @aH > @aX 2> > !`> ~!h7> #P>!>"atL&̐&l&7`&!> 8 P  &`0*  P&`p`p*&`l &`|&`t&`x&`d&`h P 2`\ & X`\ 8 @  # ' ''ȑH /k * ,  1 . 1H 0&@̒H /k * , @ H 0 耤` @ H /k * , a @u H 0 > j!p㿘> 8t`?2  @@ &t> <!*` 0㿘 4 0H /k * ,  `. @Y . `@ @2 >  > #` ۘ  \ 2  T 1 ` , 1, !  T`  X > !@ 4H 0`> 8`t`?> 2   ' 6 `t+ @ 2 0 `  4`p $ $  ` H /e4`p* &`p  $`lP`"'@ "'H 0> !Q  '' `  @' ` @ ' `  'ȑH /k * , 1 ,1, H 0$`@ \`2 $` # %$`$`$`$`$`/34H /k * ,  @m x> 8$ pP p$ l$ t  `, @H 0H 0 `h> ##*` € 2`p ## > :!㿘?2 > 8 t. @ 0 p > # h#*`  €% p` ǐ 㿘?2  > 8`t. > #`0 h*` 㿘?2  > 8`t. > #`0 h *` 㿘?2  > 8`t. > #`0c h`* @`4@ l( d H /k * ,  ]@ "4```y@8`x@6@ `z@`{@7  `\@ " j@(+ `m@&`k@*$  0 0&ɒ $``@v 0 @s 0 @0@& H 0㿘 l? 2`> 8  t*  4H /e4 p* & pA =V  H 4 P & pА HY  H , P H;ؒ H o4$ *@ l$ $  p  & p, `1 2   ,`1,`!  1    $ $ H 0l?0> 8`t(H4p(p " " p"pH 㿘 l? 2`> 8  t* `( 4``$`@" `  `   \  @,@   " % 2@ H /k * , @x 3 c 5 ? !   " #" ` 4`@`@ ` 4,3 `d,5  @"`@2`,4& & & @ @   $ $ $@@@> 8 $ d $ h   , , ,L    `, @> 8 T`X$ d$ h@b H 0@@  , @  4 `G `H*`F " `F `I*`F `F `? "߆ *`?㿘 4 J`` 5 * *5@     & & "@2 㿘 4 ?2  l@ " 58 m k@" 5 @@" 5@* } *5@     & & "@  4 5 `` `  D`2 @` 2 㿘 l? > 82` t * 4 K 4 H /k`* ,`    `*@P    ***L   `*@ H 0 㿘 4 K  58 %  @ % @ *5*% %/ 㿘 `p`|`t  M p : 0,,  :`x% ?$`p$`t `  ,`. L `  `d ``,`   ``,` 1   . 1. !㿘 @  C& @ $ $        $ $  1  . 1. !Œ  ,  , . L㿘 ːԒ `\   `> #"```2 F D F@ . D E  `@ . E$`$` ,`. L㿐H /k4 P* , P& X T& P& TH 0  > !> "`2> > !"#\> a 㿘> 8P  l> #`h# t*` "  4 |   T X `& T` & X>  *"@  8 *``p  ,@@ P* $@ ? ` p  @ @ P X `& P` & X>  *"@  8*`@@?2`  ,@@ P* $@    .  @: x2 `6& lH /k * ,  t& & t t h     `. `1  -`1-`!   `. H 0㿘`p `&`p &`p `H`P8" > #`h# *` €㿘 4H /k4 E* , E D, EH 0  G > #`h#*`  €  H  . > #`h# *` €0. 㿘  0H /e * &  .  .  . H 0㿘㿘> @mb   ` @@  " 㿈` >(aܐ`4>*``L`h&h&h&h&`> 8,`* "* ` 0`& & &`0 > 7&`t?&`p O# ,   *   > "  `p "!> 8  > 7 >">"`#""" " !> 8   *  &``*&` &`&`&`&`x&`| P 2`p & X`p  @ #0` @ H /k * , 鯒 H 0@  1`. 1 !鞒 H /k * , @ H 0> H /k * , @ H 0> "0`0L#`&h> Vb8> @ɒbH  > @bX 2h̐ &hh̀`  '> "`h> 8 Hh> "hȀ`> h"h> 8 @`a '> #*` 2"> 8`> '"'􀤠> 8 @Ғ>d &h㿘 0$诐 >  " cǐ > " 0H o+*@l@t `4 `3 ` `5`@ ``,`3,`5 ,`4(   & & $`@J(& x & |(  .(.(,`L(   ( `.(@}@  H 0( .(@@H/` / ?&(&(@ ##? @ ` @N(  7#?#? @ ` @7(  "!(Ȁ 2&(̐@\ #А#? @ ` @(̀? ?> "H 0㿘(  ` &((.(`   `0  `.(  .( `(     .(> #ϒ 0&(ȁ㿘H/` / 0 @ @  *@gH 0㿘H /k4 * , ( ? & @ (*((`@&((&(&@ H 0 @ 㿘 0H /e * & ( 3 /H /k * ,  .( 1 2   , 1, !竒     (  & & (& H 0H 0 0 `G `H*`F (" `F `I*`F `F `? "߆ *`?㿘 0 J`` 5 * *5@  (   & & "@黐 㿘 0 K(  58 %  @ % @ *5*% %? 㿘 ```  ] p J 0,,  :`5 ?$`$` h  ,h. L h  `x h`,h   h`,h 1   . 1. !㿘 @  S& @ $ $      (  $ $ ($  1  . 1. !В  ( ,( ,(. L㿘 ֐ߒ `2 F D F@ . D E  `@ . E$`$` ,h. L㿐H /k4 d* , d& l h& d& hH 0  > #X> #``2> > #X#`#\> c(ɐ 㿘 > 8  0"@  h l `& h` & l>  *"@  4,*`5  `p  ` `@ d l `& d` & l>  *"@  4*``@@`       (@Ť: 2 6& H /k * ,  % &   | (  ( `.( 1  - 1- !( ( `.(H 0 0H( `E `D*`EH  `H  *(0*(㿘 H /e * & ( .(D( .(ǐ( .(H 0 㿐.` &(` `2``2` // (㿘# @ #@"(!? # @  #@?     ɐ  ܐ&   @㿐>   /)@#蠒 $ H /k4(А* ,(Ѐ  (Ԁ E L`2 (@H 00   &(&(В!  LH 0㿐H /k * ,  /&(Ԑ &(БH 0`> U㐄 㐅H 0 H  "@"  "@"㿐(Ȁ /   (Ā   (Ā  / H /k * ,  H 0㿀 ?> #h  ` @&`$ &` O'`$䀢 `48 " 028  5?@1@.?2* `4 ' `4'>+>+\'''ڑ " `$ "0`$0"`4&`$`$"4"<`( &`(  '㿘" > -# / $ +#> !>  82 0` <2 0``  0c  " 0#   ۀ㿘" >   ) $ % 0" 0 8@2" 0 <2 0`" 4 4"`4 4 0"@6  ߀㿘`"  >  : *` @  (2 _ > [ P 㿘`  "@ @`㿘 $ & 0 & , D  " 0 2 D 㿘 $   D  0 2 D㿘 $ & 0  & , D  0 2 D㿘 $   D  0 2 D㿘 L  `2  8  4 $ $@$ 0 ` (*`> 8 > X * @@   $  8 8 L 8  8 $㿘 P ` L? T"`8  $: 8  L 8 $  8`  L  4 8 $ 2/ P# !$ L'  P`>  `& P> : P ͭ @?`2?` d& P>,aH՜>  2`@ ՚:`?㿘 ( !H /f * '  P  ? L& P`4 $ 8 D  LH 0㿘 L 8`- 2* 4 8  $ L`4  $ 8 2  ` 2 \ & ` \ `   & \@ & \[ ?? ?㿘 P !!< L  8 $  8% `c#``c   L 4 8 $ @   P $ L 8  8 $㿘 P  ?& P@ d㿘 H@㿘 L | 0@2  <  ,@2 <`  <@ $@ 0& | ,& 㿘 L  ,` `    0 ?" H, ?  H@`$ H `H /f * ' H 0㿘 P   L @*``"   T( @*``#   T)  @* `#    T' @*``& {  T%  @* `&  n  T#  @*``( c  X<@4@   @*`& ``+ T  X  @*  `+ & ` F  X   @*`& ``0 :  X  @*  `0 & ` ,  T  @*``  " 㿘 @ L`  -㿘 P M d   (""4# # & 0&  0 ! A !㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,> `0 $`03 2 L`0/   4 8 $ L`4  8 $ "!`0 `0    @`0 `0 @ $`0 `0  $`0 :` ( c  㿘 > > a K  (>.&`@>/bt h&`8&`D&`H&`L  &`P@ &```L  4`8`$? b &`T㿘`( `u "`"6`0e^0```@2  [ 0_`@2   `L 4 `8`$`L$`8 `8`$0L` 8`B `L 4`8`$`L%b`8 `$`802`@2 4 1` 8`, `L 4`8`$`L`4 `$`82 `\``  $`\@$`\ ? 0 ϐ Րْ 㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,S `0 $`0H 2 L`0D   4 8 $ .  L 4 8 $ L`4  8 $ "!`0) `0    @`0 `0 @$`0 `0   L  4 8 $ @`0  $`0㿘 L  4 8 $ L`4  8 $?b  L: 8 8  $ :` (  c8  㿘 #  > > !8a@ > > !8a` > `! (>/&`@>0c!8&`8&`H&`D&`L &`P`L  4`8`$? b &`TA㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 8`0 @2   <? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  8 $ L  4 8 $ " L`, $`, L  4 8 $"`0$`, `0 $`0  `0 `0   $`0`0 $`0$ppp@pppppppdppp0pppL :` (Q c  㿘 > > a ! (>0&`@>1c &`8&`H&`D&`L @&`P`L  4`8`$? b &`TU㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 8`0 @2   P? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,? `0 $`04 2 L`00   4 8 $ L`4  8 $ ?`*`>0"t €`0 `0 `0 `0 @ $`0`0 `0 $`0㿘  L  8  8 $ :` (2 c  : (2 #  㿘 : *  2 > > a! >2a&`H * :  $2 ( 2  (> > b!Ԕ >-c&`H (>2&`@ H&`8&`D&`L @&`P`L  4`8`$? b &`T.㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 8`0 @2   )? 0   㿘 L  $`,$`0 L `4` $ 8" L`, $`, L  4 8 $"`0$`,- `0 $`0"  L 4 8 $ L`4  8 $ `0 `0  $`0`0  $`0㿘 L  8 4 $ ? 8  8 $ 0:` (9 c@  㿘 > > b8 "( (>2&`@>3c!4&`8&`H&`D&`L `&`P`L  4`8`$? b &`TB㿘 ( `G "`"*`07002` @2  - 01 @2    L 4  8 $ L$`8  8 $0` 8`0 @2   =? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,% `0 $`0 2 L`0   4 8 $d`0  h$`0`0 $`0 㿘> #"` ` : * > 2" (>3&`@>-c#&`8&`H&`D&`L `&`P`L  4`8`$ ! &`T`L  4`8`$&`X`T?"@ <`X@> "0\㿘 ( `J "`"*`0:305` @2  0 04 @2    L 4  8 $ L$`8  8 $0!` 8`0 @2  T? 0    :` ( c :` ( c  㿘 #:  !> "Ѐ 2 > " > ]# (>4&`@>4b,#&`8&`D&`H&`L  &`P@&```L  4`8`$? b &`T㿘`( `i "`"*`0YR0T``@2  O 0S`@2   `L 4 `8`$`L$`8 `8`$0@` 8`6 02`@2 4 1` 8`, `L 4`8`$`L`4 `$`8 2 `\``  $`\@d$`\ ? 0   㿘 L  $`,$`0 L `4 $ 8` L`4  $ 8 " L`, $`, L  4 8 $"`0$`,% `0 $`0 2 L`0   4 8 $``0  `$`0`0 $`0㿘a L  4 8 $ L`4  8 $?b L : 8 $  8 L  8 4 $ c  8  8 $pߴߜxx0P 㿐>    "> U> #c#\   o 㿘H /d * %  `%>  `6    %  ` @?> U#M `  ?6 $ H 0 @> #(H 0㿘> #" ` > cH@ > U#ڒ   ` 4 ?# @4 ʐ0  `@ p@Œ b  %h/#\#d#`  @F   . * *`  @m> 咐#X 㿀 @2 @  ##\#d/#`  @ x@ a" @ //#\#d#`   @ 㿀@j  #  ://#\#d#`  :@ 㿀 @2 @M c /#\/#d#`   @Κ 㿀   @1  /`//!0 ##\#d#`   @ 㿘> #" ` > cp@    @ސ0> 08@֒ 2 0@ "    & 0 0& ,  `" $ 4 0$ 4 <($ 0$ @ ($ @ `@ Z㿘 & , $ ?& & (. X ` "A   > 0<+> 09  ` )`> #H /d4 * %    #>  c Ÿ  ` H 0 0 ?@V ?" & ,⸐#㿘`d`> ⬐ 6 `Y $` \$`$`$` $`$$`$`$`0$`T  , `  * @*` ? H /d * % EH 0㿘 ,`<*`>5! €; @<?27 , 2  & ,  ?   "@  ! > >  D(     ??&  & , ?& ?  ? @ > Ԑ 0 㿘 ``4@?  p qx@ >  `㴒 `  ` b>5!*` €($@"O$(N``?# @4` @"    $,\?: ` 7` +"@P?!J )  )2` @?``?# @4` ْ` հ `     ?  ` @. 0@ > `> `   > *`* @ @ 0 > -  㿘   >   >    㿘  >  4  @>  !L`` > !L`` > !(  , ` @> !@ , ` "> > !P>  ` ` * *`  *  > ِ!xL` m` ` * *`  *  > !Ɣ @]  > !⽒L``> !ⶒ `@M  > !⭒`B   `L@     L@ "  -> !⒒`> "0⌒  "0⇒ ? '> ` )> %> 2 @ "@w @tP?  `` jก㿘` ``` ` ` `> 8",*` 1> Ԑ!@ ϰ!8`> ` ! `  > !(` `  @ 2 @ 2`  @  >  U !>  M ! @ !F`> 8",*` !> > X!: `q ! ` " ` @  > !(` `  @ 2 @ 2`  @  >  ^!>  V!@s Q!O ` K ` G`C>5"4*` €``@> "> " `!> `+ > ` `!ْ (!> "> " `!> `+ > !ǒ ! `1> `*> !  `1> `*> !Გ !Tl밝㿘  !@!H /d * % > V`` &" "`& H 0 㿘H /d * % ` "` "H 0 * H4> V(> V  @2H㿘> #" `> b@ &  0` >  "0=Ґ 2! > #02 , [ X, Z ,`!*`>:! € ( $" $ $, [ , Y X 4퍒 ( , [ >  #0  , [  , [ > #X , [W㿈  > #[ ` < @ a> ൐#N  2 H  ( `> ॐ#> `2(`` ` #d#\#` ` H+ "H /d * %  0" #>  c   0b H 00 0& 4(& 0H /d * % VH 0㿈  !"\ a axaw ! "i  !]x0!r” `& `!   &&&&&>&  &&>:  ` #К &L&4&8&P&D)<쒔 `0<?# @6  6   6   @6 "'   6 @+@& 'В"#\#d#`    X  @㿘! @0!@ "@ !@ 3 09!@", !@.  ! ! @0!@!  """ 2 """ "    ` @$0<TH`lx㿘`> 7   㿘>  T`2`> 8""`.&`0 2`0 6`06`: $`2`: *$`:>  `: * B  &`4> ] 0`: !>   2 `4."@ `4 I `@ `:  `?@g?㿘ƒ㿘ʪ㿘 : 6 4 4, @ " :  : & 4 4 㿘` @2 `  "@@"@ `㿘?> 8b   b.  @  b @㿘  > 8  6@ . @ 2 08    `&- @6)   $ ?  @4  @` @ 8: 2@@ 9 @ " "  " "` @ " " """    􀠠"A @  \    @"*   @2 @  *   *  \_ \* @ 00* @ 800* @ 0*  @Ò`*> #'`> !ݰ      ` `@2  `  > >  >  > >   > !> !>  вa@`3 `.><!,` €> (!P> %!X> "!h> !p> !> !> !> !> !>  !>  !> !> ۮ!> "Ȑ    h    #\#`#d> "H> "X#h> #l"2 > Ŝ"` 㿈 4.`@.` ( P  #> 8 0> 8$ l$  $ $  !> $ $ $ $ $  $`b$$$444,e,"@ :b" Ȑ ` ` * ``$* `4 > Ԑ" * ``$*   2>   > bp @p >  bx@k >  > > bp @b >  b@] >  x `@     ?# @4  ?# @4  ?# @4쀢  4 `  2  4 `, 8 *@6 8   8,, 4 ‐ @=  `  `03`0 ` ‐     %•'>= ' . 4.`" " >>,0 m > #" 㿘 2 '5 `@2-`2)@ `` @  2` @ `  @ 2`@@` @  @@'в@x@ 6 U ///#\#d/.`.@#`g x\@ϒ 6 Z(///#\#d/#`N ",$#"%$&&#p$0%++,,,,㿐> bĔ  x㿘> 8&`` "$``$` 4` > 8"`0`&`&`XȐ@6`"  `2`` &``""> > ! &aT> b#0 㿘H /d * %   $'> O)> U $ $ $0"4h"0Q{ $2$H 0  *`> N>@# c@ e  ` p > O>@# b@ p e  p `, 㿘Ș 0㿘? 2  @> 8"2`  0     ` :t K0n M!   ! _70Z``4` ! 2F `  4`@[ 4   @  `+ ,@ `$ "      *@$  *@$    @ Ƚ$ ƭ0`?# @4`   2!`?# @4`ȧƗ㿘?2  @> 8"Г2`k   0> Ȉ ~05"      **@$  **@$    $  Ē !@ #?c 2 `!     Ēb 2ZJ 㿘 D'? @2  `@> 8"2` 2`Đ =& 4 `2` 6& 4 <(@;  -& 4 ". < D   ` `@ @6 $ #" ` > c8@  + `?# @5 0 `$  $"`$ `2   0 ( <$ 0$ 4$ @Om ( T@4  D ` " <*  @  <?@  b" @?,@ @l  0  4`4`///// @Z  0 * (44`4`4`///////  0!0#\#` 0 0( #d < HĚ   > #@  2u 㿘  0` `@ 0`<ܒ"@ 㿘 D? @2  `@> 8"2`  "  ( <*`" 4& <`㿘>A>B"" 㿘>A>B""  㿘? .!!@b.@!@@[ K.@ K. *  ( ` * (   ?jP> c? @ 2  `@> 8'"Г2`ĥ `    ` Z ! @"Mc@c@Cc@c @=.!,c# @"58" p ! `q@") !@"# # # @`m @0 @" !@ 0!@2@2    @"2Qc@/)c@"!Tc @"!T!@^ `r c @c@ `i c@"F c@Dc@ `[ c@"% c@" :c@c@ `H c@" `p@`s@q `9  #@"!T2 #@ "!T# e e@ "e  r @ ` @Y #@ ` @ "!T# @j `  `m@T`q@ݐ `  e`g@`f@D  h@"8  #@q `  !@ `瀢 0#@"p 0#@0#@ `ր 0 @2@ɐ `̀   @ܘ 0 !0ɒ `& *`` & 0 ʼn  $   @3   $ ł0` € @` € #\@1!T` € @~ ,@@W pÑ*   8Pd   @c Z  d ?# @ `*`2 @7㐔 0G#$  #̒ : @9  '```"@` !?#?*`@  &@  `$@   * 2` 2`*`  d ?@# @ `*`2 @6@@?8ܐ>    #$   @ @ , `$`?# ` * 2` 2  d ?@# @ `*`2 @6@@  ` 8`&A 0!T@ !T    @     !T@     !T@     v@     l!T@     a@ ]@ X ̔ S Ē Ɣ M  HV "B !>2  9 Ē  3  @ + 0(2?#ϒ @"2@!T`@d@֐    ĒVɐ >  #P㿐@!@"`Ƞ d &(&0&,`@! d &4&8`Ĥ  ?b  > cX@"  > ch@  6>  cx@` !W  &&!,&<6H6J&X&&<6 &6&.@]    @ $@``{`,    i  @ k`Ĩ  d   *  @ *`@ * @  +`*  @*` @ @ @>  `   d    *   *` *   * *`  *   2( (""  "   00  `@$`Ā ,  @ؒ  * 6 ? 2  @?`6 # @ `* * >Ab@0\p(" & & h2; ̠ @ b h %/#\#d#`  #  2% * *` *  aa(& * *` *    c8& "&  ́x @f Ô@6`6`6` E6////#\///#`#d   ޚ h@8 46 А@ 2/Ӷ 4Ҳ@ &.  `  `  J  ? `  ;  .` #\ `@x\ @   G/#\//////#`#d    x @ Ē K'/#\/#`#d   o 㿈'В"#d#\#` Ē    ` x@ɒ  B`/ / 7` @( //#\#d///#` > x@  C`/ / c7 (/#\#d///#`  㿘   ښ 2``#  +    ˚  㿘   ? X> #'@Y Ȓ @U@` >@ l*` € a0  (//#\#d/#`  ʚ   ϰ 2 .`` ē*``0  (///#\#d#`    ˰ `I ` ē*``0  (///#\#d#`     `-``* ě2`!0 2`2` ////#\(///#d#`  n   ̒`2 2  2  .` .` .`͔ d }` ē*``0  (///#\#d#`  F  d ϰ _.`` *    ///ɒ/`7  a0#\#d#`  #  A $ ` *    ///ɒ/`  a0#\#d#`     .@  .@ ` ē*``?0 //#\#`#d        > #> #'@>  T@:@`a0 Ĕ  T(///#\#d//#`  T  M` @ ?**  * +`*`+ @ 4 +(( ` @4 2 2`  4@5` `   .........& &&.  c > /#h%> '@Ē ؒ @` Ēa0@  (///#\#d//#`  :  ܰ .`.` > #h> #'@ ؒ(@` ē*`0@ ( (////#\/#d#` (  `(  > Đ#ȁ㾰> #'@X   @T @a0  (///#\#d/#`  К   !*  &` `ǐ$  > #h> #'@ ؒ(@ a0@  ((//#\#d//#` 씚  ٕ*&` `݌ܰ  > M#㿘@` >@ *` €= o 㿀 >  Ш @ @ B b  (/#\#d//#` 0 㿀>  `Ђ  @.@ b  //#\#d/#`   H> #'   2  ``/Ĕ c >  H> #'   2 ////’ c >  H!> #' e    .@.`.`.`# > t ЁH> #'  C 2` ` /`@/////ÒV c > I  p"  Ġ#\      //// ܘ p" #\ Ę ؖ     .@.`.`.`P"  Ģ#\  њ  " N #\ ǚ  ɒ@` `/` / ͔  Ę //  x @x Ô@ /#\//#`#d    㿐> a  1㿘> 8&`0c$ > "2 !P>"@x?> 82 `  6x . @ 2 0p ` l  2` 0 鎔 2^ 0 H  @ "@ `> 8"@^ > !X G 0@     @"40 8 L  > !0> ! T > > !0! H#\ H`2> > !0!#` P#d P`2> > !0!#h>  L!h T 8 $ 4? c 2 ? 0> 8 * @?0` 2`㿘? 2`> 8 * cF  #D #H  ^  #H"Q#F"?8#D"+8H0 #E"(HA0 #A #C40 #B"-0@0 ,@~ (@ $4"  "?@$8   44" "H"L"P" T "@}x@ 4M `4I +  H`?@4A * ` ?@ X8  @ :  81   `` ` @ @  4, ,``4 4` 24 4`//////`/ / 0ab#\#`#d   w x@`4l `4h ` 4d +` H`?@4\ *` ?@4U + `?@ \L  @ : "G  @ :  8@ `  `` `@ @  4, ,`,`4 4`4 24 4`4///////// /`  / 0ab#\#`#d    x@ * 0  H `  '  :` @\  4, `4  +24 ////쀋 / / 0ab#\#`#d   Ϛ 㿘H.`  S   Q$8 @I$ ;` ` ` *  5    7@0 "` ` `*  > !  ` -@ `@&`ƒ ` x @ڐ 0a6`67  7 (////#\///#d/#` P h@ ؐ@ #p 0` h//  //#\#`#d  .  > D!ߧ, ,,`,  @  +((+`   @ % T% 8% H% <% L% @% P% D@n  @k  0`////#\#d#`    > "C 0 X@O  \@K  ,@ , $  0 ` 2`㿐> 8c4& d   `& d㿐> b\  㿐> 8&`c| `0 .aT$`$``> 8x&`X`&`B@'h`" >  >  &at ` 2`` 4``" >  `2> ` &`> ѐ"``   > 8" 枒 aU`@ a^`@ ao` @    at> 8"@`Ƞ`>  ˥"耤 ">   > 0> 0 @1@-> "#\ˈ0 ˅#00> ˁ#@0Ӑ#X|> #>T!@8  &ax> #n 㿘H /d * %   $)> O+> U $ $ $0"4h"0A $2$H 0  "*`> N>P"c"`U " `p 6!x> O>P"b`p`U `p ,!x`> #G!@ 㿘 0㿘? 2  @> 8#d2`  0  Ī#  | ` 6p  W! j` 2 ` 屔! _``4` 勔! 2J `  4`!t@  Ȁ 2 3  @  `+ ,@ `$ "      *@$  *@$    @ $ 0`?# @4`   :!`?# @4`㿘?2  @> 8#d2`s   0H  "A"      **@$  **@$    $$  "  !t €  Ē !@ 1?# 2 `!     Ē" 2XH 㿘 D'? @2  `@> 8#d2` 2` B& 4 <(@@  9& 4`    /& 4 ,& 4". < D   ` `@ @&z $ #" ` > c@  `?# @5 0 `$  $"`$ `2   0 ( <$ 0$ 4$ @?w ( T@4  D ` " <*  @  <?@  b# @?,@ @h  0@  4`4`///// @U  0@ * (44`4`4`///////  0 0  0  & :"`#\#` 0 ( #d < H䷚    > #   2k 㿘  ` @ ?"` 0 `0 @ <ɒ"@ 㿘 D? @2  `@> 8#d2`  "    ( <*`" 4& < `㿘>Q>R"#H 㿘>Q>R"#H  㽐> c? @ 2  `@> 8'#d2` `    ` .  !@"! !@"8  p !   q@ " m@  0!@2      `m@"e e@ ";  `p@`s@$0 r@& !@0 !@"vV `q@i  h@0 e`g@{`f@ x0  @ 0{@ 0tє!0p `& *`` h&T 0M a $   @$I 2  e g@2 ? @2  `@?`4`# @ `* * >Q b@$l   )$ 05"4    -$ ?*$   ⚒@ " "  !22 @"   q > $#؁x> #'@!@"`&(`&0`&,`&4 &8 d&8 6aT` > > c@8 ؒc@2 آa^>  aUǬ  @@x`&<`ޖ (6H6J&2` &&X֍&&  aW6&&.? 2`  ?6  +  *6 >Qb@" >  㿘  !t € x@6  @2 6`6`6`  //////#\#d/#`  ⪚ 㿘  4`?  ` 4 ? ( ;?  7 3  >   ֒#@%?$  ` `  >  8Ғ  > ̐ h  ្  >   ? 㿘?2  @> 8#d4   /? `*@2 `Đ  2?` `, ` `"(? շ2`    2?㿈'> < ? 2` > 8 #d2  #c< $ #d*@ (@ R @.` @.     @ > ? = "7@ @N 6` *6`6`6///////@?   @&  #  & & & & & F& (& & ,?& 0& $@€  $<  _(*``  @*8> #' @ b  # //#\#d/#`  z  2Z       >  %>  G     . *  *`  &` &` "&` *  *` * @ &`&  b #\ Ȗ &֚  2`ٕ*ԓ*`&@Ւ@&` &`&` @2  &`&@&` c >  ؁㿀@ , @} p  , //#\/#d#`  , P"&`  ߛ &` @\ cp  ? ///#\#d#`  ,ٚ   ʑ* ˓*`  &` &`  @ &@`&`@(&` h.&`!T`Ȑܰ  B ː  ``&@  `* *   *`@ &`&`ˀ  ґ* ӓ*`  &` &` @ " ` " ` 2 Đ"&`    &` ` @@g`&` R . ː  `&@ ` ` * *  &`&`ˀ  ґ* *`  ` `*  &` ``&`@Ē ?&`7`   5 ˔ @  &@&`` `  *  *`  *  2 &` &`ґ* ӓ*`  ` `*  &` ` " ` 2  ` ( "%&`   `@2 Ā` > >  M > ! H > E!@ ދ @ 2 "&` &@&`&``?&`x @  "`!@8 aba 5/#\#d#`   ߹  > !` 0  @& ggggHgHgtgtgtgtgtgtgtgtgtgHgHgHgHgnnno0o,o\otqop oppoop$p㿐> `  Ř㿘> 8&`L# $ $ 4 @J> ϐ (`X `>  8> #> Ð 05> 80   > @Ò` "`d> ð @a> ë P```$> > ä h`0à p`0 "> >   > Õ a&a&a&a ?# @4 㿐>  La f  & X& h& 4@& @㿘 X  l  @z @ ,@ h@`" $ @ ,@   , @ ,@   㿘? 2 > 8 #  2 K #*@`2`L0C  4    >  ,`6   ݖ  $ 4% `D`2`0 @֔ `0(`@S$`D`  `0  $`0 @Ô ?# @4㿘?2  > 8c6 *  0 a`  @   " L     L @  L  `2  L @  L @  L? c 2  㿘? 2 > 8 c2 *   0@ 4` Lh `g `@,`$ 0*  l@,` h $ 4 @ U   4`"@ I"@\ @@ ; @  *  t, < d, < 0 ?$ 0   @J  0*  p@$ 8$ 0@ >  !@ 0 h$ 0 4 < 㿐 0( L @ @ @ڔ @ !@` @ @ 0? 7& 0  @ 4 L" P0`"0"" <T2 <0"82>W(0`"0""8""8`"04 `20`0"0`"80"8"0 < 4 0&000"0 㿘 D? 2`  > 82 *  <B@ 0 " P 8@ >  8    &  T T    T>  ! & 4H /d * % & $ `( $& (`("@#"`(H 00 0(& 0 <& @H /d * % 7H 0㿀> #" ` L> aH@\ ` ?## `  4`B0!  $` ("`(&! (" 0h"`` `` @4` 0$ 4 <$ 07S$ @n` 4`"" 0 0@  @ז " 0 0 <h$ 0$ @79$ 4T`  0$ 4 < 7$ 0$ @ 0   0$ 4 <($ 0$ @ 0 7& 0:` @  0@  0 > /& 0% /( 0   / 8@ <2  <2 2 ///# #\#d#` < H T > !P ` 2j`㿘? 2`  > 8㤑2 * @L>Z` 4 g㿘? 2`  > 8㤑2 * @L>Z` 4 P 㿐? 2  > 8c2 *  @ !4` 8 <  ` aa 0 !7  @X @W 8 6 8& <& p& |& &  &$ t&( &, &0 &4 0`" 0 6 0(" H 6 H6 J64 J4 HV`o>W#4*` €@A   @g &@  @ɖ   @W   @   0 @c  @] } @5 u Д  0*@9$ 0 0 4$ 0@m b`2 P 0 ?`@  T  @ S  T@$ 0M  0 $ 0 0$ 8 $ 0`B  , <  <  L6@ >   , <$ 8 0 %$ 0 0 ?!$ 0   V   ,`0,` 8*  p"@    <* * t  * 㿀2 @c  0 `/ 8 `/@: 22///66/// Lc #\#d#` ǚ x`L  % @( a0h /#\#d#`  ک   * *` *  $`T$`P(>  L @# '@ a0 h/#\#d/#` z  &*`** *@  @  & \& `. d 0  0 ?& 0 @ \  4 > !`(>   @ L` ' 4 2= "7 @  /@/   03 <//// 0 "  @ 82 2 /// @ !0#\#d#`  c > Ȑ!p㿀@`  `/ 6/b /c  L #\#d#`  ٚ 㿀"# 0 8`0B 0"0>`4 =9`     " 0I 0""' ? =  `4 ?߀`6 0 ?& 0 0  ?& 0 0"` =& 0 ` 0   ?& 0"  ?& 0` @ L66`6` ///#\//#d#`   t  㿀`( `  0!"! ?& 0 0 =ϐ =& 0 @ǐ L6`6` ///#\/#d#`   D 㿘 0 %$"  %  & &` 2  N x`  ٖ 2" 4  `2 @  @u L6 /#\/#d#`    x   0 =& 0@T  /`/!06"#\ L#d#`   К 㿘  4 4 0   7 7 * *`  *    $  p2? 0 "L $ 86& (  @ ` 0 $ 0 ($`@  ` 0 $ 0 ($`@   ` 0 $ 0 ($`@ "  4  2 4> !  4 "  (  2 ( 8>$ 8 ( $@*;  0 2T  3`2L$`@M & (  @2H  `C =`<     8 > "! 1  `   `> !В $ & ($`@   2? 4 "  0  2 0 8>$ 8&2 ?"$ 0 $`& ($`@ ?㿘$ x  6 x '$$`8(`82`0`0    ?$`0    z2 0 2`8z+   㿐> a  㿘> 9&`4`  "2 ">  c@   2@ d>  c@  2@p d@ d$  `&`&`<.`N.`O.`L&`86`@6`B&`D&`H.`M&`&`㿐> a  @̘ > `&  $ 2&  > `#. ^@Ւ 0  ѐ !> 8#@}ޒ ,#Ȑ . ^& ԁ㿘?2 > 9    2 6'  *@`2`4    >  `  !!  ? # @4    4 㿘?2  > 9` 6 *   쀢`" 0@   0$ P ?$ 0 4? c 2  㿘 D? 2`  > 9 2 * @ 4` 䀢€㿀? 2`  > 92  * @`0 #>``܀`@ "`00 @}L #  //#\#`#d`4   ̚ `0 $`0>`>`"!X {㿘 D? 2`  > 9 2 * @ < P 8& < < "& @H /d * % & $ ``( $& (`( "@"`(H 00H /d * % 1H 0x 4` C?a#b`  4`͐06 3 $` ("`(&  (" 耢€` @|  (/ <(2`2`///#d#\#` < H ; >  0 ` 2`㿘? 2`  > 9 2 * @# : #( 5  # # *  ` 8@ ( 8 (0# ؀€ @0 쀢` -@  0 ? $ 0  -   4ڏ(> # 4'@|=  $ 0///@|4/ ` `2`// (// 2 2 2 2 2 Գ2`55`22222`2`////////////////////`   "` / `   8 ` " ` / ` @  " `/ i4/ɀ g // %/ " / /  a  ' `"  ` * * @* @ ' $" 2`//   (c#\#d#`  > # > ې @㿈 2 4`*2##\#d#`  3 㿈 4 *0` h" @ i g  2 2  *1 2*2#\#d #`  6њ h 4@{9 a" 4 (//#\#d/#` ؘ Է >  0 + *` `< +    &`<㿘>  . ^ P`>  `X@ 2` > . ^ h`>  `@ > 9 > . ^ܐ > 900& & &  & & & & @& 㿘 0 " ` @N "`  @`$&`  @@$@&` @`$&@@ߒ $@ [&` #؀@U`S!@8Y `!,  @* 2 $` 6`!,  @* 2 $`* 2 "U06` *`2 26 ` @?$? H!.`` @?$? .`` @$? P .``   i4  g6 ^   ^.`& 8 (@t 㿘 \a X`<2 @m$&`<P 4@aؐ@z8   //ܐ@z0  D @/Ȣ H@  8@ @ <@ c4`4 42 ///#\#d//В///#`  ӗ  2 @z  / /@y/ @ a,/ @z /@- d / M @x? N/@x / O @e/㈐? p//#\#d/#`  Y  2B@y’  @  /,/Đ / L " h" i g   # @ H PĐ X/##\#`#d   !  2  <@X   㿀 P  4@y{ # /#\/#`#d      㿀 4@y`  \  Xt/`<2 @`H #44(//#\#d/#` Ԛ  >  - 0 T"& T`< P" & P x 4@y.   #//)>d'> (#d#\#`  Ҫ  2:耢 ` >   " (#* *` * T@  > !  P   P> !@Ӱ 0 `  㿘 L "  i   6 \4 @ g 6 \ @ 8@Q$ \ & X` ?` ?& X B <@A$ \& T X2 ǐ& P㿘>  . ^!p`>  ax@~  2` > . ^!`>  a@~  2` > . ^x!`>  a@~w  2` > . ^j!`>  a@~i  2` > . ^\!`>  a@~[  2` > . ^N!`>  a@~M  2` > . ^@"`>  b@~?  2` > . ^2"`>  b(@~1  2` > . ^$"0`>  bH@~#  2` > . ^"P`>  bh@~  2` > . ^"p`>  b@~  2` > . ^"`>  b@}  > 9 > . ^"> 9 P P&  &   &  &  &  &  &  @& > Ґ"0 @7  > > Ȑ"0Ő"㿘@(`  @ #؀@8< ``@ !@82 `?* 2 !,8+ ` c !8% `   " ^  ^.`& 88 (@ >  #@ >  # 㿘@ > #@ג > #!> 9@i p p@4 >  #@`㿀 4@wb `<a`H22" /(//#\ /#d#` ݚ  > #`6 0`< P" & P 㿀@w;  4a66 ///#\#d/#` ж 㿀 @w 4a66 ///#\#d/#` Л >  H  8p <0 D>  @cp' B2#d#\#`3 3`  L ">    0  0> 6 \ c6 \c > 6 \c@ 0> 6 \cА@ @ M N >  \"@@?ݚ  w >  #x`8> `<`  `L ' ? $`8 $`<    !> 9@  !> 9@z  E  > 9J`tؤ  S @> 9OJ@  d2`J@   E ?А  !> 9J+  @ *`В@  `L $`X+ $`X@8   > 9 `t  > 9`x`5OJ@  d2`J@   2 > 9`|` ?А  J,  @*`В@ `\$`T`X2 $`P  > V  㿘> 9&`0` > "2  ">  В`㿘?> 9ऑ2 `  6 ऑ. @`2`0  2>  2  ` ? 0> 9 ऐ* @?0` 2`㿘? @2  `> 9क* 0>㿘`"!@>  !!@> |! 㿘``@z  > @y! "   > B#` `&`48H@ P "8, 2  80 @។ &  > &`D @y͒` 2#> > @a(> @y’a8 > @ya@ 2 `D`D* "`D "͐" > c   @ " > aH@ٔ??&`T&`T`T &`T> !X`D<@ @ &`L `> @"> !> $@> (@"> > !`> !h> > ߐ!p> ې!x > א!> `LҐ!> ϐ!` > 9@ Ȁ>i>i>j#|b4>k#Вb&`l&`x>i>j>j>j#`&`p&`t&`|&`c I&`P 28`0Z8 > @y,a  > 8@y&` 8@y! 2'8 ''@k`P %> #>h@>@  ˒ '`  @Z 0> @x`  > `@ِ! &`<"# 㿘 D@$!@耊d! ?  Dd ?   >  D@!> a;!K> 8"  D@ < "@ D Ȓ`" D @ ?"@ D " L@  `  D " L@(@2)& H D* " T   D " D D@0 "& H D " T`  D@ 7@("@& H㿘 㿘``@xh 2 Ò@ 㿘t  D  D 㿘 D@#> $ %> @耊d! ?b  Dd ?   >  D@!> a!> "  D |` "& d& hc  > "(@@   d?@@*" 8 & `'c >  `x"@ 2 d ``  d @ & \ & X> "` D"  L d D"` L@2 D d> Bd ` @" D* D"  D" >! "@  D  " H㿘`D`<> #` > > ""`'> `D> }"`D"` # ?`H 2`D> b"@$"!`L@耊d! ? `Dd ?   > `D@!> a" > @" `L @`2`D`D@ @@ "@`D`  耊` ! ? `D`  ?   `D> > !a" > # ="```($`Hc "%>    € @€  * @  € @€     @€  c > #P{ 2,``  € @€   * `@  @€  * 2 ````@@2`` @" ``,c  >  @#p € @€   @ @€   (>`d!H> #`2 `h`X "`h`\@ 2```h ""`d@"@㿘 D > }" D> ⨒` " "  l@ 㿘`"!@>  #!@> #ȁ 㿘``@vi 2 Ē@ P "8, 2  80 @ &  &`H8&`L @ " > c@΀??&`D&`D`D`L `&`Dc> #:` &`@ 28`0S8  ''@v %> #>k@I@  ֒ 'cX @e 㿘`"!@>  o !@> k  㿘``@u 2 K@ P 0 @ݪ &`<D&`H4&`\4 2&`L&`@@l @ " > `(@?&`P> 4 80X > - H0Q> `p@??&`D&`D`D`H `&`Dc`P :` >  >  > `P &`@ 28`08 "' '>  @@ِ #> !>l`@ͬ@r  @X '!<x @Ȑ `㿘 @#> @͆` k  & X>  Ȓ ɔ05 @xa& T X` @@J T (`< * *    X`8  @2 `   " `8 X@ ` "   T&`<㿘 0"!<.` X(   \ &@("!@ 0.`( T @` 4   X   & X @` @ޅ.`㿘`< $`   ?   2`P>  ?`0@n`H$  `P$```H@n*`$ `P *``H@n$`d$ $ `D @ 2  < $㿘 ` ` `@`㿐H /f * ' >  N H 0 #)>  4 H /f * ' > b` 2`H 0  $ $ 4 $$ $ $ 2$  ۰ 0$ ) ܑH /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(  $ '􀦠x> " cܑH /f * '  Ԓ H 0  4 H /f4* ' 4H 0  $ $$ 4    +*H /f * ' > ! $ $H 0 $ (  $ 4 $ 0$ ($ ,$ <$ 8  2(8  $ $@&@㿘`@s`?㿘4``L>  !0> a(@Δ?&a>qb `0  @P 4&a<  @J#`&a H @D &a&a <@(&a> a8@ˬ??&a&a> aH@ˣ??&a D&a D>paaL &a&`<`<&`@ @aא@a>t>sL㠐Ғ @ ?@}h # ͖ ! # ǖ  #&a@ ! # ڼ  #&a@ & ڲ ! & ڬ  &&a@ ! & ڡ  &&a @ ( ڗ  (&a`  ڎ  &aaګ``d >o>q>p?&`L"<a<" $$$48$ $`E> a!XH8 > a@r͐ `@"&㿘b $ 8@- 8 $@ @hb#b Ԁ       ğ€  D Ԁ  r    ğ€  "  ,  & & $  ?&  , " I b* @ ɒb8  ," a ""  2  8$6 8 a$a"`b 6 6$b$b㿘"4 6 " !"" !b " ! ` !" `?"# !c   Q !# `?㿘H /f * ' ː@H 0㿘> ax   `$ 㿘!ܠ  !䀌``!!`@J`@!  ``@` @㿘2      `  `    > !> !> > !&!> !"㿘 @  > !> !> > " ">  !o" L!""*`#`` T`a"T  *`"#`` "T$26"  #"#"828"?!#! #㿘 L 㿘"", @ # % @@  "*  "@!`  "@ &" 㿘 L!H /f * ' b@bDbH@ bL@ \@  \#b@#bD#bH#bLNH 0>  " 㿘 H /f * '  a2a1;a a H0!5=0 !69 = 8 6 8 ` @H L[0; 8@  2 8u 8 ?/6 8  @j@.0$ Ls L`4@ʐ g! Lǖ $  H 00H 0㿘! L!!ؑH /f4"* '"  " @/ &" "   " @% &" " @ "* " + @" " ("    " "*`   + " ""  "   $"&"&"&"@h&"@!(!*  $c!!* $c!!*`@ $c $c @D@  $b  $bP $@" $ " ($ `!$ $ $>$  $_d? $ , , $ ($a$ $ &!$ $ $b,$ 0b  $b c `$c 8 @ ;48H 0>  }#!    ?#d ?#d#㿐!!쀤`> "h 90# $   '$   '   &!?$'0  ?&!$'0> " 㿘!      > "M1? @ @ @ݒ @ڒ ` < `@Ԑ?< >@ `@̐?>@! @W@U @R *?@@K@I@G@@ @ *?@@ @@㿐a a $   '$   'U  6  >  $   '$   'C  6 "` 㿐a a $   '+  $   '6  >  $   '  $   '6 "_`㿘!     > "P 00@. @+ @( @% `. <@ `@?<@ >@ `@?>@@ @  6 > `@?> `*``*`` `#d #d#㿘%  L>  d" P`$ P"`*`   2 L P  $ P , `$ L >m㿘 ǐa !"  0 2  & & #&`  `   ?&`㿘! X  K G  # L ?    >  ;"z ` ``*  !b " b ="b ?*     ? L $ >   #S 㿐! L 8!c  @$c 0Sc ?$c  8b?#$c@$cD$cH$cL0F?c$c@$cD$cH$cL 8="!h7777& @o+  ?;n #       @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cL 8 =6 8㿘`@my`?㿘 L`L> #80l> cX@Ť?&aА0  @+ 8&aȐ<  @% &a&a <@&a> ch@ō?&a D>u#&a&`<`<&`@@ aǐ``dZ >u>w&`L!Lb>u?a#`"$$>y>y$48t,Գ<  Է # #֐ $ $> aА#x8 > c0@m  `@"&㿘 8 $@ @[ Ԁ  ̒     ğ€  "E$ Ԁ      ğ€  "  ,  & & $  ?&  , " ` `ؑ*   8 ' ,`" Ȑ `"a"   $ 8$6 8$㿘!Ē !,    ?    $@@`   ? @ 㿘ڐ@*㿘>  c   & H /f * ' H 0㿘!! *`2 2! `#߀@q?"  @  " @= 㿐! L $!!*( ' 2!  T # T !?  &!!*( ' " T!耢 "3 6!쀢  &! 8$ ;3 8  㿘! !,`@ 2&! #  @ @E` !* `"@a   !@&! 㿘`L@   > `9# X `$ X@ X  $ X@ > `&# X `$ X @ > `# X `$ X @@ > `  X `$ X  @>  (` @>  @` @  \  Xa!$ \$ X@>  X`  @ > `ސ x X `$ X @ > `Ґ  X `$ X @@ > `Ɛ  X `$ X @ h \  Pa!$ \$ Pd P !$ Pb P !$ P `>   P `$ Pa > `  P  \` $ P$ \``@ P !$ P` P !$ P `> ! P `$ P` `> x! P `$ P ` `> m!8 P `$ P ` `> b!P P `$ P ` `> W!p P `$ P  > !J`> `D!W?㿘 H /f * '  a2a1;a a L0!5A0 !6= A 8 6 8 ` @L LU~0? 8@  2 8 8 ?36 8  @@20(ɒ L; L`4 8  @ +! L $  H 00H 0㿘!Ħ L!!H /f * ' ! ! @ &!!@e!؀ !@ @ &!!@e@  !* !ܗ,  @ "   # !ܒ !*`   , " 4 !"   $!!$`!($` &!&!&!&!$`$`$`$`$`0$`4 `!$`$`$ `$` `$ \ d  $`,`, "$`(` , ,,,, , ,@ ,    d ? $!  !,!,!,!,!,!,@=,8 `@  {a48 , H 0㿘%  L>  d ! P`$ P!ؒ`*`   2 L P  $ P , `$ L M|㿐!Ī L 8" , `  d ?     ,?0R 8"6 8!h7777```- `@j  ;n # ? @    @2?2 $ @22*  * @5 ``ڐ , `  d; ? $   @ , $ @ #"` @ ` "` "`   㿘``@h > @hݐ"  > @hא"  0@ 㿘4``> 7" 0`> /"@08  @0&bD  @y<&bP  @sH&b\  @mT&b h  @g`&b> &`Lb`@Ҕ? &b &bb  `!&b> bh@??&b @&b @b @ @&b`0>|#&`<&`@`<@  a> bx@d  ɐb> ̐">~>~#Da>`P!,&`&`>>&`&`l<???n `t   " ʖ  "` ` H  >z>z>z?!tcĔ"  $ $ $ 4 8$ $ $  $ 8`@> 9!@h > b@h > b@g &㿘 8 $@ @G4# Ԁ      ğ€  "/$4  & & $  ?& "#$4 , @ 8  ,`"  `"` " 8  $8 8$6 8$4㿘" "@"     "`   2 |> "  | ?& |㿘H /f * ' Ӑ@ʐH 0㿘> bА   `$ 㿘H /f * '  z   H 00[a2@a1@9a @a@"8F 0!5@;0 !6@7 0;8 48 ` @rR0-@  28m8 ?"48  @b@Y0SŒ 4 @  PθH 0㿘"$ 2 ","  @ &"$", 2 " p!@"( @ &"," &"8((&"4&"0 @ ", #@  `&"<  ! ",*  #@ # 㿘""  ""@"?#$"`"  ?$@@!!*` @  $bP!%!*`@$c ! !*  $c! !*`@$c$cc$b0$b,$b$b"$%`"$(% " @  $  $ > "В $!$ % ,   %  %@q@"> # $c @c b  $$b "`2"$@b  P`$b c $c _856`@ {58㿘"  "?#"`` Ȕ "`" 9&"㿘"  $b00 ? b  > # u 㿘"  $c0 ? c  > #8` 㿘>  Y#P 㿐"  HLD @ `\ @$`\"H"L"D"@"0 `T { 4`8 $`T "8?&"8"8  , " (@Ԕ  6`8&"0"8 "4`6 㿐"< @P $P@ " , ! '   " " , @ `2 &"< 㿘  & *     & * ?" > > 㐐#pْ ސ 㿘b?a" ֒ f@h@㿘.`* * "(* @  > "'>  `2HH /f * ' V* 4  ""8@ <"`<<8"`8"($} $0,\W4&0 ?6>  hH 0L@H /f * ' V* 4>  ""8@ <"`<<8"`8"($2 $0,\ 4&0 ?6>  H 02l 㿘%  >   8 P`$ P"(.` @ A  P $ P韒  L , `$ L 9h㿐"   8!c  @$c 0]c ?$c  8b?c$c@$cD$cH$cLc ($c 0M?#$c@$cD$cH$cLc h$c  8"A6 8!h7777& @e  ;n # ?      @2?2 $ 22*  * @0 2  ؐ$c@$cD$cH$cLc ($c  8 }6 8" ` "  " 㿘"" ``"  a2""  b   &@ 㿘"  #"*? .`c   $` ` @@  ` ?  3>  `% 0. $`       >@ `>@ > `> > `>$`㿘" " % *`@ .` $` ` @@  ` ?  >  Ґ xB ` 1?#=  $` W ?R O L I  >@ `D?>@ > `<?>$`? ;*? 30-㿘 8 f 㿘e P &` |&` " b "b  b "b  Ȇ2 ȝ㿘``@b "  > B#` `&`48>@ 㿘>  ` @g > 9b8&`4`?`> ; 0>   4&c( 2&c80 @ʁ &c&c$ [ > `@ &bc$> `@?&b" &b&bb耢 6`$ 0&bb@\ƒb@ &b&c & <`@v` &c " <>  > I b  ` .`.`.`   `@€ _ "`-&b .``  `.`   ` .``  `@€   `.` @`.``   &bb#@\kb`&b``>h#|>h#|@&b &b@&b@\S$&b@&b>h#|&c` >w c`$8c>w4>w`0c(&c c &c@ĥ > a`0 "8 6> 9> a@a /> 9 <@   #> 9 `@2> 9 @J > 9 > 9> a@aԐ > 9 ? > 9 `@2> 9 @2 > 9> 9b(b `&b@& #*` #*`( 㿘#  t@㿘#  l@㿘#  x@㿘#  |@㿘#  @# D"# H ( 4 4 @ L d       \   4 |  8 \  㿘> #`> @a^#H`? 㿘!0`> #PÒ06 >  #p 2  N 0 @   N.` .`&`.`.`.`@ `> V" >@Fb > &`@`@&`D @Ɣ > `ђc> 9"X@V !* *  E** *  C*  *  P2   " P" " T" " " " "  㿘@Ȑ@& P?    @" 㿘@   > c`@e   &`&`&`   > (@X2 (@2& (((0 > (a2$2"(@> 2"2$  -*-H( i+ , c+ + ! f+   d0+ + ' e+ & j0+ + #+ "0+ + %+ $0+ + -+ H  `T @ ` !* *  #`T@ #`#`#`#` `T @ ` !* *  #`T@ #`#`#`#`   !*@ *`" T   !*@ *`" T 㿘> 9b; 0 @``& `" @>T( ` * ` * ` *`    `  ` * @`` ` @>l(  *`  *` *` "` "`  㿘@` >#*` €  ?&`&`> c &`$&` @dÐ` > &`<`(c  ?&`&`> c &`$&` @d` > &`<`(yc  ?&`&`> c &`$&` @d` > &`<`(gc  ?&`&`> c &` &`$@d` > &`<`(Uc? &`&`$&`  > c&``@d{ > &`(c`,@du G&`@? &`&`$&`  > c&``@dg  > c&`(`,@d` > &`@c`D@dZ ,&`X? > &`&` &`$`cؔ? > &`&` &`$`c? > &`&` &`$` c? > &`&` &`$`c&`@d2    㿘  H /d * %   @(  " H 0   @ H /d * %     H 0   @ 0H 0 /> 9%(/> B%/> V %   ,%+> c`+?P `-`0+-?P%  ,% +> c`+?P `-`0+-?P%/> 9(@̀(D`(@lDx D l   ! !4! ""##<#$$L$p$$$%%$%l%& &l%&''P'''''((|()t**(*p*L㿘``@^? > @^9#   㿘4`>  0C >  (0:8  @0&`L> &`h`P@R??&`l @&`l @`0`l 1&`l>!&`<&`@`<@ >  p `> `P`x> 9/#0   .`.`.`.`.`.`Á L( L( L( L㿘`L@  $ >  @`  " " 2 $    ,    ϔ  ˔   Ŕ   ,  $ `t` ` `` "` ` 8    "` $ 8$ <@ €`   `` ` `` "` ` (    "` $ ($ ,@ €`  #" > 9 @?  p8      ?"?   &" *`@  #`#`   @㿘 p  LB  & p& & & & t& x& $`6  $`2` ` $`,`W ?$` @` " ? @  2 >  e   @  @      㿘    @  Ð 2``?   Đ 2``? N    ` "N     `N 2  N 2 ` 2 ࿐ `        "       @   ɖ `0 ʓ2`2  0  `  ~ 㿘 L@e@S ,  , & p㿘@`S >#$*` €> ``@aW A > ``@aP : > `Ȑ`@aI  3 > `ؐ`@aA + > ``@a:  $ > ` @a2`  > ` @a*` > a @a#`   &`&`&`> a`@a   &`&`&` 㿘? `  >#H*` € X A  R ;    "5 G  C ,     7 >X#  퀢 , >X#  • ! >Y      ? 8 E 2 &' $  $ $$ԁ 㿘 ؀  L  ӑ*  ܐ` H /d * %   @,@ I,@ ,` H,@,` `W `c ? @   \> ! ɒ  \,@,` `W `cn ? @  > !@ ,@ @W` #Z ? @   > !`  ,@ `W`  #C ? `  > ! H 0& ؁ L?`"` *@ ` *@*`"L?ۄ"` *@ ` *`"㿘> 9c 0 㿘@` >#t*` €`2`   L *(` 2 L*@`  L * L*@` ` 2`   L *` 2ڰ L *`   L `*  L*`  L *`ɠ ` ư` " 0` 2`   L *`   L `* 2 L *`   L `*  L *`  L *`` 2` 2 L *`   L*`* ` 2`  ` . ` 2|` . ` ^. ` 2s`? (` l Q. ` 2e` @ ^. ` 2[` @ T. ` 2Q` @ J. ` 2G` @ @. ` 2=` @ 6. ` 23` @ . ` 2)`  ` . ` 2` . ` . ʐ ` 2`    2` .    >(  L *L9* L(L* L(L **  L *L*  L(L  * L(L  *   L (L *  L(L   * L(L y* uq L(L 0i* e * \ * * SJ M@ JJ D@ AJ ;@ 8J 2@ /J )@ &J  @  {*  * t*     " 㿘@`; >#*` €  ? &`&`> a &`$&` @]` > &`<`(a  ? &`&`> a &`$&` @]ѐ` > &`<`( a  ? &`&`> aȔ &`$&` @]` > &`<`(a  ? &`&`> aД &`$&` @]` > &`<`(a  ? &`&`> aؔ &`$&` @]` > &`<`(Ӓa  ? &`> a&`&`$&` @]` > &`<`(a  ?&`&`$&` &`  ?&`&`&` &`$              ?&`&`&`$&` > a`@]W  &`(> a`,@]P > a&`@`D@]J  &`X  ? &`&`> b &`$&` @]:` > &`<`(ua  ?&`&`$ > &` &``b@]'  &`(> `,a@]   &`@> aȐ`D@]  &`X> aА`\@] > a&`p`t@]   N&`  ?&`&`> &`$&` `a@\  &`(> b`,@\  &`@> aȔ @\`D &`X> b`\@\  *&`p? > &`&` &`$`b(? > &`&` &`$`b0? > &`&` &`$` aؔ? > &`&` &`$`b&`@\ 0 㿘 MI  @Y $ ` $ $$`N 㿘   2 @ @e $@Nޒ0 @ 2 > "8   㿘 t  L> Ԑ"`=  "& t"   2 & > ") ""@""   "8"<  ?# @"D " * * ** * * * 㿘   >  "U  $ & $  ` 2@`& >  y"C $ $ @$ $ ` L" ( L"`, L `D ! `@@"         L $"    `  $   (    $  L" ( L"`, 04///0H/ԝ㿘> V > V`  㿐```t> > > #`l`& 0& 4& 8 (\ 0`2Y 0> 5 @@ L 4 P`"N 0@'2  E"G 02  E"A 02  E2  `"6 02  `/>"H*` €$!##$%$"!" 0J "$   $ 0  %  0#&@%& 0& 4%& 4& 0 0 8 & : 7& <> @mc& 8> @gc& 0> @ac 0& 4 8@PO@ 8 8 & : > c@M& < 0 8 &  <: @&& < 4> Ȑ#( 4 <& @J   J* (J А 㿘%> `! 8? <& | 0& T 4& d& \ & `!> V"8> @cPؒ ""8> @c`ђ P  T> 5 @   " Q` P "` T P P T@3 㿐> #` D@ H " H& D& H H & x  D "  & t?& t & t" t` & t x` & x 8`  > ;> ;> ;> ;"!""#!`$ ` T> ;> ;!! @  T!   @ x t@> V> V" "`㿘 8 $`"> "   @`` > ;!  @    @ > ;!  @ @#``#dd"@@d`?"@0 d0E" Ed0 # P2   P`#dd2 #㿐 , J  `K > V ` 2 #\     0(  J  &` &@@  &` L, L) " `#\`\ &`&` &`C$$ $ `  $ $ $ $ , (㿐  " tl  <   K K 㿘@` `> > > #c/!h"`N@  `  `, @ @Y-  @&` 㿘>   ǔ> @ (.` <> @ 0@ `"> >  @>  P㿀` R .` < L  8 2 0E   4耢 "8#\#` 2 & 0  € 40#H /e4 p* & p    0    ` 4$ l$ pH 0@= 㿘@ 6 @ p "@ l&@@` *`  <  `@N `  @Nݔ 0 㿘` > # h#*`   € > U p    <> O">a  "  , 2  @  *@ 2 (> K X@   k 㿘` J .``<  A > V @";   27  / H /e4`p* &`p"$`p&H 0  "l` `0 €`4>  ``       㿘@H  '> 7"> :` !> U p `> O">a  "  , 2?c.`  * "`㿘`> W   㿘 @  㿘`> D  㿐>  @)Ӑ  &">  " h`;&"> V ` !> V> > > #cj" ̀ " #\> > > #c^"#`     W& <> V>  ! $ "@" > !@` <& l& p > !P& 0& 4& 85> :#>  t%>9> :Ѐ@  = "`@&@ `* @*`" * &  : & & q & @   Ԁ   > #>!@8 ^Ԗ  ' ԁ㿘#> V` "  > > > #cX"`4  > > > #cx"  > > > #cؔ" > > > #cΔ"&  > > > #cĔ"> V`"`> $ $ @!$  @> :`> 7 $ "$`㿘?> :2  l`26f  l*@  Z * < 2Q  J> p>2#db`$ $ Т` $ l"  p`" p8 P  a# %$ $ $ $ $ $ @ Ö p> # h $ p*`  `" ` "  ` 4  `4    $ 㿘 ?> :`l6 W* <@ "'   " H /e * &  @ H 0 > # h#*`  €  " @   ?&  $€ > V `   $ > V` ?& > V @L > V*  㿘 > :?`l6  *`<@  > # hc* `@ 㿘 > :?`l6  *`<@  > # hc* ` @ 㿘 > :?`l6 > !Б*`<@㿘 ?> :`l6  @9+*`<   > # hc* `@@ 6 6 @? 㿘 0 4 @ 㿘b@)  L"<#K "*` #D"``0#RE"y`0 #Q"V"`0 #PI0 #U`0   :& 7&5& @ `#` ?&`  `` &` @ ؐ` "`0o`t`0` `@ϐ@ ɐ`0 `0`4@ `0 `&8`0@ `4 r@ `m`$ € 0g`?[&`(`0_  2`4Y -`M`0`> *`" *  @J* &`*" *  @I* &` =&  $` > ` R @R’#` $`$`$> ` B @R#` $`$`@S 0@c  `0`4@㿘 `@ ca@"  #V@NcT@@ 0cb@X@$ 0 cO@   #S@ cM@": 000#N@"k0 #U@# 00A#c@u 0|@Bu m۔ 0hcM^@ X `T  P($@E  D8 "&8Fe 06 0   4 FY 0**" *   <0 * "@*` ` < ?2 " 2"@&"@& 㿘 > :?l6 @*`< `  `0 `4?㿘> :?  l2`   * < ` J㿘> :?  l2`   * < ` z㿘> :l  l l* @H /e4 p* & p  H 00 H 2 o " p o<* @   & pH 00& pH 0 H  `% P ` > > > #cڔ%@ْ p2  ( @ А@ u   @ Ȓ    P `2 > > > #c%@    @ ȿH /e * &  p> ` ? & p` 耢`&`:` m_V  H   p  ?& pg7 H H 0H4 p( p" pH `$ `( ` ࠝ㿘  ` `   㿘     > ## h*@ `㿐  > > > #c& p E  A}* 2  o!<@ 8@>@  > #?#@` 2> ## h *` ` * 2 €0 +   2` ?> ## hJ*@ ' ?㿘" > y" 4 " *> "HĒ  < ` > "pf   """ ?> ["" $"$ p$"$"@c   ?$"` ` fM 㿘b > :"I b , > "`< ` > #'  "$`lb ?> #@b $b($`p$b$b@$  $`p`b > V Ԁ` >!` # r㿘" > #`@ " ? $"$ pe03*> #'  < ` > #ɒ   """ ?$"@  0> V Ԁ` >"   4@ #h 㿘  ` .` <@ H /e * &  p` l@`2 "2 "H 0 j   H 0 _ &"&"H 0  p 2 l?&"J &" `2  .` < ` 2 @  2 .` < ` " @ r@ |  .` < ` 2 @ r  " " > V Ԁ` >#\ `#  2 "㿘 2  p> > > #cE'4``` 0 @   $€0㿘  " &  @  "&  &   " "   @"   " ` *`   <2  (p?l㿘' H /e4 p* & p  3> !c b  p` !H 003` .` <  `) H /e4 p* & p@ ` >  &` ! b @  ` ?&` H 0㿘` p "``"` je 㿘!> V ̀`"   @9b   ́㿐> V `/> V ̀ > V < `      㿘> :l 6   l* @> V` " `0 $> V`4€> V Ѐ€> :> V  Ё > :>> V  " Н㿘> V ̀`  `< `0  `4@㿘`   p` `  0   p 4㿘 @` 0 `  `" iΐ t 2& 㿘 0 ' 4  H /e4 * &     t i&   &  `?& H 0㿘㿈 #X @'?"'?  ? @    @. @*   ?  @\ ?㿘  * 0  0 : @ 0 *`:`@ 0@㿘 ".`  `0/*`0,` ?&@   0 0@@_P@n@[@@@W0@6@S @@㿘  0 `> :H " @Ȑ> V* &  > V* :&2  &!>  (# `  * 0&!> : ر. <`"@ 2  ؒ@:`6`<22` 2 "2`$2 &*`( ذ 㿘> : ت`p`  @I@CG.  :` ?@ ` `ؓ.` p:`   ? ? `ؐ `p` @4 `p-`2 @  `( @0@ ` p `(  @0*`(㿘'> :ر. `p6 `@B@I`0``45  'ء,  p4 @, 4 ` ` w @BӐ@Ie@` `@㿘> : `p (.`* @6`. 2    , 2  , 2 , 㿘#> :`ش p @`"  @I0 "@  -2 @8. `ة-p5 `4@B0@I .:   - ? ?  㿘!> : ذ `p  @H%@ -2 &  ؑ-`p: @`4@BA0@HӐ  2? 㿘+> :`)> p#@  `@H. "@4  @B@H0`4 *   .2 8 `` ؑ-p2 @c`4@A0@H * @ߐ` 2`㿘+> :`)> p#  `@He. < &@Aɐ@H[0`4 *   .2 & `` ؑ-p: @c`4@A0@H6 * @ߐ` 2`㿘'> :ر. `p6 )> `# @A@H`0``4ؐ `p* @.` 6`@Aj`p`@G`0``4 *   @ 㿘> VJ` !> : *` p (` @̐   p (` >  ؐ  p2  p2" p 2$ p"2& p"`2   p (`*( `p ( *( `p ( *( `p ( *( `p ( *( `p ( *( `p ( *(㿘> : بp `(  @~   p (`    p`2`  p2" p `@@ޒ@Gp 0` 4    p`" ؠp`   a ؔ p ` " 2` p" 2"p` 2`$p"2&p`" 2`p"  `p ( *( `p ( *( `p ( *( `p ( @*( `p ( *( `p ( *( `p ( *(㿘%> :`p  @@z ( @ p (`n ؐ `p`4 `p` ?@2"`p 2$`p`"2`&`p" 2`p" `p ( *(`p ( *(`p ( *(`p ( *(`p ( *(`p ( *(`p ( *(㿘!> : 0`p ( *( `p`( `"` @    p"`2㿘!> :  p `( @@  p `(@ @  p `(@|㿘> : آ`p ( 2q`؀ :`= ` p$@ `ؒ  p  @2  p 2" p 2$ p` ` `ؒ  p$ @2$ p$?2  p$?2" p` ` p ( `*(`p`$` :``" * `@( `p$?2"p`$2` `p`$` :`` `@ `p`$2` p$?2"``p ( *(``p ( *(` p``$ *` `" * 2  `ؐ* 2 ` p2"  ?*` 2``ؓ*` 2`` p2 㿘> : آ`p `( 2``"` @`9 ` p$ :`"@ * `& * c2 ` p&2"` p&@` $  *`P2`` p$2 ` p$ *E "Ր `ؔ  p * @ 2" p2 2"r`ؒ`*` a2` ` p " , 2 " p2`" * 2 [`` p`"``ؐ  p, 2@2" p " H * 2  C`؀ `ؐ `p? *`"3 `p2` 0`ؐ* 2  ` p` `, 2`  p2  *`ٓ2``` p` ``ؐ  p, 2"@2  p @ *` 2``p `( `2`p|`㿘> : خ`p `( 2`"` @i  p$ :"@ * & * 2  p&2" p&@ $  *`2` p$2  p$@*2"@"2`p @>*@>&* 2 ,`"4` 4"`p*  "4-`p"2` * G2 , @>آ p ` @=* 2 b ,`4` 4  p*` '2`  -` p 2 *`2`p `( `2`p`㿘 p `( ` p `( *`(㿘> :`ؠ  p `( B *`(   p`` " "  p`"` ("" ** @  p 2$p` 2`p`2`$p"2  p `( @  p `(@ @  p `(@㿘 p `(  *`( p"  p `( *`( p ( *(㿘> : ز`p   9> V  " @ I* 2 ? $E- `ؑ-`p2 @`4@==0@Cϐ -2*@  J `  `ج  p`@C? `- 2` *   `*`2  -2 `ؑ- 2 *@㿘> VJ > V`@G@* `> ##%> : p `h*  € *`  㿘 > :`M 0`I 㿘 8> V `H /e * & )> V   &,2` ,`2   `"4 @=  9Ԓ 4  8  % > {ؐ#%`%`H 0㿘 p (` 㿘 > :L > :  ܰ `@G  2 dX\$`Pp,<\\\\\\\\\\\\\\8H\\\\\P\\\\\8\\H\\(\\\\\ \\\\\\0@ttt|t|t|||||||||$$$$$$$$$$|\||ll`" "`$" `" `" " " " 㿘#> V`ؐ $ ($ $ $  `> ;   @  `ؐ`   @ 2$ $ P$ T$ X$ $ |$ x$ t$ @㿘  > V  (`" > > >  P``x ̔ 6 \& ( & $ 6 & P  6  & T@;ʒ   & X6w!&   6r"& t  6m"& x  6h"& |  6c"& @ @`㿘 &@ & P " T8 & P T " 8 & T " t8 &  t " x7 & t x " |7 & x | " 7 & | "> V7 & > V ؀7ܒ 㿘`  ` 0@0@ 0 @ & &   0   `@㿘> ;> ; `& 0 & @ P& D & 8& L& ,& 4& < & H  @;6    :  t  P*   * P t  & p& h& `& & & & d& l& \㿘 0 ! !'` H L  " ? &  T "& XJ    2  ?@ & X& & X@  0&  ?& 0` d `* @` `*` d &  \ d* @``* @` 0 " X  X 2"   ? + *@* X *@  4  @   X 2 " &  0 & 0㿘``y> |*` € $0p `m 0 ?& 0h&  0&  ?c& 0 P" X  X2  " W`@ :S& J 2O&   `@ :I& J "`C&    2@ ""@  8 Β 3& \1& \> xА 0* ,   $& ,"& , H L  " ? &  T "& XJ    2  ?@ & X& & X@8 㿘`?`^ՠ > *` €. & & & & & & & & & & & .     &  4&  8&  <&  @&  D& &  d  @ "@ ` \ `& &  Ș d &  &  & 4 & 8 & < & @& D   @ "@ `  & \& ` 0 & 0 0 ?& 0&  H L  " ?  &  T "q& XJ 2< k& X@Ò 0f P2  > > >  P``vi! X*  U& ` R& \ O& ` L& \ I& ` F&  C&   H"@ &  T`"8& XJ@ "4& X  2  ?@,& X*& @ 0%& & & & & & & & & & &  @ & & `?&   `?&      `۔  >h( dd( d tdxd|(" ``5ฐdt(" 㿘`ۀ`5% >"*` €   d t* "             @l㿘``6@c      Ā ( " ā 㿘``\ @j  `0 9;  ` *`  ((Є " "   "  " ``$ 4`|0  ``p`q `t   " " ā 㿘`̀`}>#*` € X t   .`    @` 2 @    "  @ 8 T *@X& X X T 2 ,  .`  @ <  2 @:     `  @ 8 2 @*   T +  & X2  ?@8!& 0  :&   @    E 4@` @* * & &  㿘`?߀` >#Г*` € +   `*` * ?А "   & .  .    &  & @`  㿘"  0 ( 2 0> t! @    X*   (> : !> @   ` ,``  `(tz!@* @ €& ,`2@ 0 @    X*   $$$$$$$$<$$$$$$$$$LhHHHHHHHHHHHHHHHHH HH$HH,,,,,,,,HH<<<<<<<<8\dddl00000000000000000000000000000000000000000000000000000000000㿘 L@ 8 "  H   @ T H@   H @ 8 T`  H@@6Ȓ  T`"& X J@`   2  ?@& X& & X㿘 L@ 8 "   H @ T H   H  8 T` H@@6  T`"& X J@`   2  ?@& X& & X㿘`"1 ``" XT T"DP T  2 "  * *   @ 8  " `<`   8 T`4  @@6F , T   8  T " @65    X`*  @ 8 T     8 T " T @6  T`"& X J@`   2  ?@& X& & X㿘`"``" X0"0  2 "  * *    X`* 8 @ 0   8  @ XN > N *`* @`@ `m'"e < `M `f`L6 `C"  `H`A"R 4e `@-0" 0`J`D0y`K|0" 0`h`X" `c`P0 0"n `i`l0Ԑ}@"'"p@ "4p`r" `y`n^0!p@0@ "4u"q@@w@0K@4iu@"> ~@ c@J@0@"s lh@-0@Kɐ p@^0>  $a`Ĕ z u* p @l ,` !@ `@ ,`_  @Z ,` !@  `@ ,`N  @I ,` ,@ݐ `@ ,`=  @8 ,` ,@ `@ ,`+ @ 7& @ٔ 7  8    P   > > > !paq!V $> aG   ">  PJ@  > ! > !> "   sN $)  * P>  $b  b `"   X 2# 8 #  + * *@  X ,@`ٕ*`"   H" 8 "&  T "& XJ 2 & X"  H L  " ? 8 &  T`"& XJ@ "& X  2  ?@}& X{& "   X 2 " ? 8 l&  "  @  08" "   "  L@8 H  `"  8 ?&  T`"& X J@`   2  ?@& X& & X "   X2@@ 8  0 ?& 0&& "  H L " @ 8 "$ & L`L& H& Lڐ& L & H `"   X 2# 8 #  + * *@  X ,@2"`*`"   X 2 " 8 *  *  8 @  >  $b   P`2  > > > !pap<!Ҁ    *@ @3l   < @@3 D,`   `/(>#<*` €@> ;> ;! a     ? ? ? ?  ?  ?آ`@ ғ,`@x l& D& 4& 8& <c& @ ?`^>"*` €>  $b0Ꝕ S 0   H"@ `> 8  q $ꇔ=>  $bH>  $bP| 2>  $bXu +耢`"     `?  8 " ` 0& L & H  &  & !> ;a& < & @& D& 8& 4 > Y"h㿘`  "  @` `; `  `  `` `   `  ```  "`"  2  `  @  㿘 `<`7>  P 2  > > > !pao"@2Q  Ĕ    J `/" `94 đ* * ? $  P*?  Ė&   P*?n"&  >(!,`0`0"`0`0    㿘`0`CF > H*` €!, " ?4 5 3 !, " ?' !, " ? !, @" ?`0 @@``` `!, " ?   $`0㿘 ,    t   $> " ,  x, ` @    > # ,  |, ` @    $@ 㿘`   > > > !b`n> .`,      $@> `ؕ*>    , @ * ` @ ` , $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$m(0  *`?Æ0> :!(l(0 *`?Æ0> :!(mo(0 *`?Æo0> :!h 08mЅ(0  *`?ÆЅ0> :!x( "*`?Ç0&(>̇(> DŽ> Ą> > > > > > ؀` + > (@@" + 0<#w> 4#"q> """x ""j> "} 0"n 0O>  ""R> "S 0wC> #H 0oH> ##"O ##6> #< 0[H#M 0T> : ##> #  0F> # 0>> :PT 8">   > > "# "> >  ("> > 08"> >  @ H> P> X" 㿘&   & *&  @0㿘 ,q 㿘` g (H /e * & @`@ %> <$`! L} ;@`@򀎠`@ !`" H 0` 4 4@.` * @@@ ``$#$@  `0H 0 #H 00 4` @d.$@㿘 H /e`A* &`A   @ r H 0$$$$$$$$$$$$@@@@@@@@@@@@@@@@@@@@PpАААҐҸ HpӘh ,hhhhhhhhhh耊`  " 㿘`> m  `       㿘&`h` &`d`  " > > m~ Ȓ?> mx  > Ԑ#P&`0  ) $ $@/z&`0`0"@`0>`S{c`0 " ?&`4 ``0&`8&`&`<&`T&`@ Ɣ` "`0> k > :`> :&`̚!&`l&`p&`t &`x!&`|`&``&` (> > #H` > > > > !a`ke!cL " > > > > !axkY!"cLm!ѐ &`h> !m`> m!㿘#> cH  !> > > > !ak:!$#P#PE>>>#$ $ `H $cH㿘!> #H  > > > > !a`k!ʒ#P"#P"`"`$#H㿘H /e * &  `2  hH 00" %>  6  0,     h & 0 {@6:#RH 0 㿘  `. & R  d > cL" "cL> > > !aj"" @  B> UH /e * &  ? +&   $  `8$    " $ LZ    $: >  > *`" * J` > "l: H 0> U p  > O">a8  "  , 2    㿐 6`2  0 h " 0P  0@ _  h%>  0< c€  $  6   0,     h& 0 & {@5~#R09 T 6 @`` ,    ? @$ 2" > b( jj 0 U\$ H$*"@ *`@ *`$ $`G` "`$`K`  `$: 㿘 h Q` <  ? < 4 € 8& <㿘`2  4 "   h " 4 € 8㿘?> :᠑2 `  6 ᠑. @ 2   ` 2 T  2  & TŐ @& ǒ  㿘?2  > :a. @㿘`  &  @& T  㿘?2 > : . @    $  @ `$ K 㿘?2  > :a. @㿘  & @  ? & J㿘 "~@ "}@  0  v@  0  @ "\Ta$ @ @? 㿐 #@$c@ "Ȱ | #@E#@" , 4#@ z l#c @> : 4@> : 4 #@ "1# #@ "t #  #@ 4@  4@ "Z #@2 40# @" 4  4 c 8 l  " p & t &  x & & 4`  8˒c̰  l " &  " &  "   &&    & & &&  1Ԓ > :۰!!  |  > `y2@3#耢 "   > `y&@3#耢 m " &  "  && x   & &&p 1 k> :̰!!:@@H*` *   &u   @   va  0  $ ' 0? 8&*  *t3 0&2+ ?# a2 0 !  ? ߀" 0 @  '@'  0$    8@㿘?2  > :a.  @U> : 6?᠆* @" h * ?㿘> #L  > :$ ha  @@  㿘` `h d 2(   h      @ & h  & h> "H i  > "` i`  h@ 㿘  > :  6 . @2    T  > :a @@㿘  > :  6  . @` @㿐> #H` > #L 1> : %> / %> #> "?`&"cDP*  < 8@$cD /> @ " `*`2 P  @&"$cD㿘> #H`> #L >  P 㿘> #H` > Ԑ#P `  x h !0'WcY @'䀦  '܀ 60"''0 h=cZ㿘.2 <!@ "@4!! @ @& @@!   0`  ` * "`    0`     0`  ` * "` @ 2 .2 =`,`- 0  0 `"  h |  x  `"   h p  l 2 2c 2?Ò@`+\>#X*` € d > #"` @l &@J  h 2?Ò  ?  h ; ⢒ 7  h 3 ⚒ / =2 $@ ? %@`? =2 '@ ? (@`? =2 *@ ? +@`?  0 㿈 `'H!  ?Ò " @ & `2`2` "  <@ 4 € 8 " < &  6 . * @@ݔ  =@!`H`?Ð"@`}> *` €H   & ?& H   |& ?y& H v   r& H n   j& H   b& ?_& H   X& ?U& H   @N& ?K& H   D& ?A& H  !:& >7& H 4    /& H +  "'& $H 2  (&   h  H H`` 2= `  "6  H "$ $ L $ H  ` ` @ b2`d2`h2` " <@4 €8 " < !@ ` 0"`" * 2  o< 8@> @  $# b       * 2  o4!< 8@ >  `?# > > <@"* 4 >@@ , !=@@,   ,  ; &  &   2  ; & & 6  , =2`!@2  ` @ b2`d2`h2` "} <@4 €8 " <  "@*` 2  ? & d @   {&  ` @ b2`d2`h2`  =<@4 €8 " <=* 2  o;< 8@6> 2  ?# ` 2,6  0?* 2  :, 2 ` `2 ?  * 2  `8?"  " 6    6 6   6  㿘 ` @ b2 d2 h2   <4 €8 " <`     ( "  0Lt㿐> ; => : .(@77 7.. (.`0@2&`7   @`6``6`6` ((7@00 "! > :    68(( @ @ @ @@ 6868261=!-(0 @#* =(0o< 8>   * ? 2 ** 0>  *2 㿘`0>"L.` €4a666$666666 6666 6 6  66 6 6 6㿘4a66666   2  (` ?#!>* 2  ov< 8@ > n(`` i(`@   (`\X(` * 2  o< 8@  2  =@ < a aa26  * @   ?#  38 1>( }* 2  o < @  @ 2` @`@  > #b20 (` *`2h㿘 . @! . * & ٔ &@ 4! @ 2@ @ 2 @@ 2`@ 2 @@ 2` p ? >   `  2  2  aŐ# * "  ` I *@  *  <?# >}* 2  o- < 8  > 2$ `  2    < < 8@   * 2  * *`c Г*   * ?#'8-> %>}* 2  o< @ > @ 2 @@"aB< @  @ o " `  * 2  o<   2 =@*< a   aa **@ * 2@ *   * @  @?# 8>,` }* 2  o < @  @ 2  @`  ``@ `*  ,` * @ *{ iа @"` 㿘 l    l@# > & `  b&  㿘    2$ 9 $ $ $ $ $ `` $" ``$ $```h "`D  #  € "  ? `#   * @`T`X`\  " 㿘  >   `  2 2 h>  (a 04    `" @  "   ` €  "`        "@`"  "` "@  㿘` `  0 @2     "@ 2 && D 㿐 ca@w  "}@  v@"`D`D #`@"`Dcb@"j`D0A#c@"k```D  `0H /e * &  ``` ?&@  `H 0 4  .`"$ $  J$  $ *"@ *`@ *`$ & t  " & AA    $/ H 0X  T %O L >G   " `" 2 &3  @ -$`La$ &@ 2```h 2``    @2   @ "  2 2 㿘`?    `" @2  @ "  2 `2 㿘` ` `h h  C  > & h>  H ` ` `% ``  " `` `2@``@2 @€` 2@` "@`2`2 2>  ` `^  h@ PpDPDPL`t`" "`$" `" `" " " " > ;> ;  " L" 8" @" P" $" 4" <" H㿘#> VaԐܚ $  > ;a> ;  !@ D aԐ`   @ D 2$ D $ T$ ʐ㿘  > V! T`"& > > >  `]Ô   X\& T& 㿘``_>!*` €` 0V `S 4 ?& 4N&  4&  ?I& 4    " " ?@ 8  D @   @   @" ,&  4 (& 4     @ 4&  ?& 4&   ?& > _! 0  & $  " `& @>㿘 4 "  " `& @- 4&  ?& 4` D <   @   " `&  4 & 4㿘``[2  (& 0@   㿐``3.>"*` € ( "   # 8  @   #  @    (`"    "& &  (`"   " ? 8 &  (`"   " ? 8 &  (`"    "&  (`"   8  ,?`&    8 ?&   " `   @    X"  ( "   " @8 @ "   $   ( "   " @8 @  "  &@    "@ @v  ( "   # 8 @@     # @    " @ @U  0  H L@' P,` (  `/>",*` €@C> ;> ;!  a      ? ?آ`@ ޓ,`@ 2 & H& <& @& L& P> ;> ;!a> ;> ;!a (  8 & 8ؐ  "  4 ?!> ;a& H & L& P& @& < & 4㿘` 0  9 ; 0  0* ( *` * ?А "   & 0 0  & 0 & 0`  㿘"  T 2> [!`    "/@`۔#`" $8 `     >  $*  & $R[{!& $`2@    㿘 `  @` `; ` `  `` `  `  ``` "`" 2  `  @  }(0o < @ 8> @ 2- @2 -`2-> (tt-(0 * ?,(0 * ? -o(0 * ?Æo0> ;! ( ",v(0  * ?Äv2`> ;P* 2i"<➑2`\> &㄄♀a> ⛄▀^> ╀R> ☀U 0\"F> A> ✀8> ❀1 0N<> ㇄぀(> や⟀< 0>%> ダ# 06,>  ㈄ㅀ > ㆀ 0( > ㉀ 0 >  ` h> px> "  > > " > " 㿘 > V&@ aԀ & 㿘``"00     @ 4&  ?& 4& @    㿘 8` &    @  0    "  8  "   @  8 " &  㿘  *@ #    @)    @" > [o!?  @W  4& > [c! ?@  2?@ 㿘H/` / ` ? (> Y"   ( `  \& $ $  j[ & 4 $jV @ & 8& 4 8 4& 8<'>+>)>/>5>->7>Ð& 4 4j=  @$ & D $@$ 8& @j. : $@& H& L& <& $&  j#2 & T $j& X (j $ (` & P j @g   (` %& \ j <: "  :  ?@ 8&   "i:  \ " @& & d  \ @""@}* & `& d& `tb T`̚& & & & & & & ̀&  ( >>" ! & & ?`> d*` €@ (@M (@ ? (@ c (@2  ( ( ?& (H 0 ? & (H 0 㿘 2> X"@ @Ӑ    @ &@   &  & " > ;> ;  2`>  2 2**` #      (* # 㿘  $i2 <:`:`  Xi( @ Xi#  @i $i i @i @ * ?""" " """"    ?" ږ㿘 Th֒ XhҐ `$ h˒@hƒ ?f ?@?㿘 ( "  ̟@ & `& $@` (` ̟€& (0 ( ?& ("*> -?> )?h"h ?* 0v h* UUU?""h"hh ****"@0YⰂ h  , @ /8 /(( -  @ 08 0((@ .  @ 18 1((@ *`4(*`@(  @?( @*`2 2` @ `(0#@#@`2 2 "@" "㿘> h< @2  (    :  \:     <$:g: Xgސ   H@` "@"`"`"` "`"`"`"`` ""@`@ 㿘 $ Xg   Tg   " $$@"@:`??C  ?8" ?2 00??-    8*  82?8"  8* 82?2 㿘 TgS XgO gJ?   < h@@ B$``??x> ?"?2 0g??c> ?2?2 0R?P ?*?2 0?` "@ `& @&>>??2 ` ` `*2? """" """"  " *22?2 ` ">>><<"``  >>>Ƅ"x"`"`"`㿘  f Xf <  @  $  l h" h l@ 2 ?     P&fv 8 (@ Y- > , cp@8  B @ @ &@@9 `2   *  *` * @82 @ @&@@    *`  * *@ 2 @ @&@@ ~ @  * &@@ @v@ > "* > h, 88 @  @U @` @ @&@&`@H  `$"?   *  *` * @8`*  @ 2@ &@&`@"    *  * *` @*`  @ 2@ &@&`@ -@  * &@@-@` @ @  &`&@㿘 Xe @ Te  @ `$ l h" h l 2  + ,@@%   Peu& 8 (@  @8,@@ @    @,@@ @  * $@*㿘 XeJ @ TeE  @ `$ l h" h l 2  0 4@@*   Pe"& 8 (@  8,@ 8 ,` @    ,@ ,` @  * $@2㿘 ` dd?  h <@ Xd > `$  + .> @ #p ? ?=8 ?  #? 01> b+ @ > "h*  >?/ ?/   # ?#?  `   #?2 㿘 `  d $ Xd  < `$  *,>  cp??-@@?  #@?@ 0"> "* `> h*` ?8 ?8 @@ #@`?@ #@?2 㿐'D  d@d<d8D Xd3 $` XD> < ? ?@@ ? >  #p*.>  "h . @: $``* ?  > @ *  @* @ @"@@ @ @*@ @+ @`$ ` `@:  `D?`?@Ų@0j> .b@  '> "h-   "'  ?@=`? D ` <>    "@ @  ??6;>  **`> b #p .D @( : %`*  > @ *   #@*" @`  @ #@#``?   : #`4#@* #@ 9 : %`* ? , @ *  #@* @#@b @ #@*@#@*`%  #`> "h: #`?~D0>` < ?@ @ ? > *> ."#p  - D`@  B :  '`* ? > @@* !#@* @#@".@ #@*@#@*`'  #`> "h: #``࢕`?   : #`4#@* #@``% : '`?* ? > @@ *   #@*"@` @@ #`#@?vD  "> > >Ȁ">>(<t" 㿐 XbO @ TbJ?  h?  < @ <@  ` `$` //=  + 2 - ` Pb&  `(`8 @ ` `*  ` @*`*   @ 2*+ 2 `   * 񀦿$, 㿘>`<h>`<7> Ը > ?&㸴#x  `"&&#x`./ &#x`./ &#x`./ &( 1?@@.`(6 6`&``Ӷ㿘> #` "#$cF0N> # " X Xa @ Ta  $* > x$$     Pam&8 (@> Ԗ#x 2  < $ *  <  $   >  c* $$$ c?$c㿘> #` "#$c0U> # " XG Xa, @ Ta' @  $0 > x&@&`&` @ %   Pa & 8  (@> Ԗ#x 2  < &@ *  < &` 2  <  &` @  >  c* &@&@&`&`c?$c㿘> #` "#$c0Z> # " X X`Ɛ @ T` @  $4 > cx&@&` &`&`*   P`& 8  (@> Ԗ#x 2  < &@ *  < &` 2  < &` *  <  &`  @  >  c* &@&@&` &`&`c?$c  "> > >ʀ">>$" , * ,* /`  * -* .`* 0  * 1㿐 X`E @ T`@ 7 7  h < `<  `$` ''?  3@`2 / ` P`&`8 $@*  *` (*     2*  *3@`2   * $4 㿘6` h<6`<?> > ԟ(.c @   "''c&c&&(c@&@` 㿘>  D` " D$`DQ0W>  @ " X X_ @ T_ @ $> Դ#/ &` &`&`&@ @%   P_l& 8  (@> Ԛ#` 2  x &@&` *  x &`&`  @  >  cܑ* &@&@&` &`&``D?$`D㿘>  D` " D$`D0b>  @ " XJ X_$ @ T_ @ $> Դ#8 &`&`&` &`&`&@ @,   P_& 8  ( @> Ԛ#` 2  x &@&` *  x &`&` 2  x &`&` @  >  cܑ* &@&@&`&`&` &`&``D?$`D㿘>  D` " D$`Dv0m>  @ " Xג X^ @ T^ @ $> Դ#A &`&`&`&`&` &`&`&@ @3   P^& 8  ('@> Ԛ#` 2  x &@&` *  x &`&` 2  x &`&` *  x &`&` @ >  ܑ* &@&@&`&`&`&`&` &`&``D?$`D  "> > >̀">>4" , >τ  * .* 1* ,* /* -* 0>>φ<" " 㿐 X^ @ T^ 7 7  h < `<  `$` ''S   ::+@`+@`+@` 2 < ` P]&`8 1@*  *`(  *   6 WW+@`:`+@+@`:`+@`+@`* 2  * $ `: : , , , 㿘6`< h6` <?1> ?&!H > ??  ```` 6 (6`. `H(`'@.`'@'@ (&`@ . ( 6` 0'@@ . ( 6` 0'@@ ( . 6` 0'@ `?㿘> !L` "!L$aL 0_> !H " X X]! @ T] @ $> մ H5 &`&`&` &`&`&@ @)   P\& 8  (@> ՚ H``   &@&`&` *   &` &`&` @  >  `|* &@&@&`&`&` &`&`aL?$aL㿘> !L` "!L$aL0m> !H " X X\ @ T\ @ $> մ H@ &` &`&`&`&`&` &`&`&@ @1   P\& 8  (%@> ՚ H``   &@&`&` *   &` &`&`   &`&`&`  @ >  |* &@&@&` &`&`&`&`&` &`&`aL?$aL㿘> !L` "!L$aL0|> !H " X X\3 @ T\. @ $> մ HL &`,&`(&`$&` &`&`&`&`&` &`&`&@ @:   P\ & 8  (.@> ՚ H``   &@&`&` *   &` &`&`   &`&`&` *  &`$&`(&`, ڲ@ >  |* &@&@&`,&`(&`$&` &`&`&`&`&` &`&`aL?$aL㿈0: `< h ?** 2  2 *   (* '耊`'#'?#?  @* () (`@ 3`2+.  @0@1 0`6 @ ''' @2   (   \   $[r < X[n  H@ $@ , , &@  +`+` &6;  谆?&@&`&`&` &`&`&`&`&` `$`"  谆?&@&`&``  6  .  &@ ` β@㿈 ˜0 X[ @ T[ @ [ ?  `< h ?+ / ?  ? /   (/  $`''#'?#?@@@ @ * ((`. 3`2+.`  @0@0`66` @ ''' `&@ b + +  &>??I @ ?? ? *@`*@`*@`  薂"""" """"" $" 薂"""   ? ? *@`*@`*@` ?2  , >Є  * .* 1* ,* /* -* 0>Є" 㿐 XZg @ TZb ? ?  h < `<  `$` ''?  𔂿# 2 . ` PZ8&  `(`8!@ ` `*  ` @*`*   @ 2* *# 2 `   * $$ 㿘 8 Y (Y $  > #p ,  * 㿘 (  $ 8Y ? ( ?   , ,  &  ( 㿘H/` /> aT     $ ( 2 H 0> aP> I`  "aP> Ն !T  "@   `#!T> T"  22 㿘H/` /> aT .`  $@2#`  @2   (@2  @ 2 H 0   ׀H 0?㿘Ho o 9 `,  H 0-?  " ,"  `0"   H 0?  " 0   * 4 &@2`?H 0㿘Ho oY &@ &H 0 ?㿘Ho o<  ? ?> G p* 2 2`H 0 @@(> K(Є:`6 `62?"(+?&'?6"? "`0 `0   **` ? ?㿘@``!"  . ,:) *`   @  `@Tp  ` @Th  `@T`  ܦ`   㿘@``!"  , *:' *`   @  `T0  ` T)  `T"  ަ`     23`2(+`@ #@( ` ("@ @"`("`("`("``0 "@ @"``㿘*@ * \ *@  * Ŗ 㿘`&``@ 24 > c  V` 2+  2 % TΒ ?# 2  2   E" 4 @" 4  ?倢  `@ &` 㿈` >   c    &`L 0@   @v &`P &a40 @v &a4&`P &aH   6> > "> > # > `L@@  >   &aH>      `@f> H #`2#> 5 @`L`*  J`@`# #? > W`H`?0&a84 &a<8 &a@@&aD# $`0> `4Gΐ > Bcd`@  aH@v* @?&`X `f&`pa> L # $``# `# # >Ԓ @?`a(I[> L> L <`D>''''10 A@"$ 4_@"% <@@?0#F@ C@B@ E@ J@  "" 0" 8" ""? > Bd  8  &?`@8 2?@ (?> aH a< a8( a8 ?㿘> #`!D @ L@0*`Њ@@ Ъ@@0#Њ@@ ?Ъ@@0H/` /`!4 `  `!4 ` *`!4 ` *`H 0 㿘!L  T&'&!  @ !L `$!L !L"!L 㿘``@ d  > #` *I> B#` 0@u?@S 8@ 㿈  >  > E > F > c 2 0> 5 @ " J  20 0 &a(40&a,8 &a0&a( $ @t&a4# @t @&a8 @ה   #`$> B#d`@a( * @t͒ @?&`X `&`p>֐cda> L $ $``$ `> $ $ `0 F]`4`>֒P6?> L> L Ē`>''''/ޖ 㿘#A@"+ 4#_@ "- <#@@?05#F/@ cB@" !8 #E%@ #J@"#?cC@"!8? &!& 0& 8& &&@s @Ē 0? 㿘!<  T&'&> ;> ; !@ !<`$!< !<"!< > Bd  8  &?`@8 ?@ > a, a((@ a(@ ?H`!4!4(H 㼐> @ `c'!"  *=    @*  `"  @*  `$  @*  `` P 2` P  `P  c > -!㼐> @ `c'!"@ ? `Pu 28`  Pm 20`Pe ",&   @ 2 "   @ 2 $  2  c > -a!!8*` 0 !8 @0!8 @2d㿘``@ f  > @ `!0 "   > B#`  Q& 48@  㿈      6>  > $ "#` > > a8@c\L  !(   > a8@cPL 2> !(#> @ a0 > a0 D!@> WH0 `?  @r`dDaD`&a@>+> B7> 9>;> L) ` 2&0 > L!  > L @`" p ᩔ  +@  $  (0 ` 0&a44&a88 &dD&a<&dH@mca@ $* "  @  $ s$  $ $ $# c`  `@ * @rf &`X`0H`4D &`p `0#  "4=aa # $`# `#  # `0# ?>ؒ `ʐa(E> LaL> LT>''''-m 㿘#A@"+ 4#_@ "- <#@@?0=#F7@ cB@ !D #E-@ #J@"+?&cC@!D$?  &!& 0& 8& &&W   2 @ ? 㿘$T  T&'&> ;> ; !@ $T`$$T $T"$T > Bd  8  &?`@8 ?@ >  a8 a4(@ a4@ ?㿐!@ #\!DH`!@ `!@(!@(H 㿘!@  "    !D `*!@ !)  !@(㿘`&``@ u 2 > #`2  2  O0 ?"  >  @ `@ &` 㿈` > `!`B&`L> c   > 5 @ " J  0 0  @q &`P0`&a(4&a,8 a4&a0$ 2 *a8 @ $$ $?$   #i$> B#` `@ * @pՒ @?&`X ` &`p>ڐ`Xa> L!$ $`> $ `!p$ $ `0Bf`4`>ڒ??> L> L!b''>''+ 㿘#A@"+ 4#_@ "- <#@@?0@#F:@ cB@ !8 #E0@ #J@".?)cC@!8'? !#&!& 0& 8& &&ђ   2 !4 2 ? 㿘$8  T&'&> ;> ; !@ $8`$$8 $8"$8 > Bd  8  &?`@8 ?@ > a, a((@ a(@ ?㿐!4 #\ !8㿘-jjpjjj̝㿘`&` @ " > @a 2' > ! #`2 2 $> B#`  ,@o?@Mƒ ?"  Ԑ ` `@ &` 㿈` 0 &`L0 &a44 &a88 &a<@o&a@   @o&aD  *@o&aH @o&aL @o &aP  `* >ڐ *` €`L@@  > !> !> #`2> > !   > a@_ɐ> A !0> A!> c  > 5 @@`L   " J # #? 8aD> W`H`?aD>a&dT&dX:dT@j `@0`$ 2 *aT @+ $# > B#`  `@ * @o  &`X &`p`0#  R>ܒ`t`>ܐ!>>>>ݒc0H#&a&a&a&a &a @)a> L"X$ $`> $ `!$ $ `0@`4  `0# ?>ܒXa(B&> L> L"b''>'') 㿘#A@"+ 4#_@ "- <#@@?0=#F7@ cB@ !T #E-@ #J@"+?&cC@!T$?  &!& 0& 8& &&   2 @z ? 㿘$d  T&'&> ;> ; !@ $d`$$d $d"$d H?? P`"" "  D`@"@" " > Bd  8  &?`@8 ?@ >  a8 a4(@ a4@ ?㿐!@ #\ !TH!H`!H H 㿘!H `0 02 ?#ߒ @`"!@!T !  !L`?""`㿘 \!L` @ @ 4"@  4"@G Nh$ $Nc $N^$ $ $ $ $ $  *`3$  ̔$ $! `$  d($  4 `@$  d?$  `$  d$  4 `@$  d?$     㿘 m!L`j @@f D  4"@  4"@ R N   M  M $M$ $ $ $ $ $  *`3$  ̔$ $! `$  d(@$  `?$   d`$ ?$  `@$  d$  `?$   d`$ ?$     㿘 `O!L @@K D  4"@@ M   M $M$ $ $ $ $ $  *`?$  $ ? $! `< h $! d($) `@$)  d $@@ $) `?$)    㿘 `!L  @@ 4"@J$`$`$`$`$`$` *`??$` $`>$a < h@$a @2  ( "  $i$i ?$i $i(M&$ d@$i `$i  d$M?$i 4 ` ?$i(` ` 㿘  !L $L  L $$$$$$$ *`$ U$$ d($ `@$  d$@@ $  ` @@ $  !Hh( "h㿘`&``@ 2 > #`2  2  Iْ ?"    E `@ &` 㿈`    &`L @k0> c  &`P> 5 @ " J  0 0 ? @k&a40`&a(4&a,8a8&a0 $* "  @  $ s$  $ $   #$> B&`p#` `@ * @kz @?&`Xƒ `a> L"$ $`> $ `!$ $ `0=`4`>ߒᴐ?> L> L# c''>''& 㿘 #E@"P?#F@ "J?#H#@@ ?0A@<#A@" 49? cC@"#!8  #G@+cB@!8)? #J"@ "!&!& 0& 8& &x   2 !4  ? 㿘$8  T&'&!  @ $8 `$$8 $8"$8 > Bd  8  &?`@8 ?@ > a, a((@ a(@ ?㿘㿘``@ 2 ` >  0@  > #`    㿈> <1"> b @ZJ@ > <%"(> W H? 8`? 4> "0`<@04D> "h`<  0> :`<"80 @jX  <   "0&e4&e8&e<&e@&eD&eH&eL&eP<&a(@&a,D &a0$#`@<D*` `?&eT &eX @j* &`X`0> `4;ΐ" &`8@eD`a4  @ "@ ` @  @? `]&`p>ba> L#h"$``"`"" >?X> #>!@$ > L> L#c''>''%" 㿘#A@"( 4 c@@c_@".%TV? #B@ "/!4 #C #L@":H?@*!4C?%T  <&:&& 0&%T   &%T @? !+&  <* %&#&@  @ 2@ 2%T@X   @Q   㿘%\  T&'&> ;> ; !@ %\`$%\ %\"%\ > Bd  8 &?`@(8 2?@ (?> a, a(( a( ?㿘 8`2  X%4 A>*b  & 8@ @%4 q*@%@@ђ!& 8㿘 8  > 7!> 7"b` %4  A  @   *㿘@``!"  + )% *`     `@EĔ  2` @E  2`@E  ߠ `   㿘@``!"  , *& *`     `E  ` E  `Ex   .`   *`%Da4 "@ `㿘*`!7* !6* !5* !4*  㿘`@`?㿈> b@X> 9> b@XJ@ "> > 9"> 9"> W H00 &a44 &a88!&a<`? ! @h(&a@ "!@h"&aD# $@h&aH$ #`0 &`8:`4 H&`<`0&`@e `?&aT`8> B#` `8   @gaT&aL`0 #` `8   @gސ&aP @&`8aL@?&`X `#&`pa> L#"$``"`"" ?K > #>!@  |a(;`0> `4`9Z"> b@XJ@ > 9O#9Mb> M> M` $>''''"֖ 㿘#A@" 4 c@@c_@" <,? #L@" " cC@cB@  0 && & 0&&& * & @    @   ? 㿘 8`?!T' !D."`\!D " X!@ "`p!@?"T!@"`X!T !L@` !T' !D."`\!D " X!@ "`p!@"T!@ "X@!H?#"c !H"#(!H]& 8' !D."`\!D " X!@ "`p!@?"T!@ "`X!T@!L!T' !D."`\!D " X!@!"`p!@"T!@" X!T`2!L@ !T% !D*"`\!D %"`X!@?"p!@#"`T!@" X!T`2!P@ @n  **!H "*& 8> Bd 8 (&&?`@(8 ?@ > a8a4(aT @   0@  ?㿘!X  T&'&!  @ !X `$!X !X"!X 㿘 8   > 7!> 7"b!H ` !H2` `"㿘> @# `?㿈4> M> #(7 0 ` "dH 0&dHdH 2`> 7ѐ#P00&a4d &a8h &a<@f8&aDD< @f &a@> W H  `?"! > B#d `@a4 * @e aD&`X&`p> &d`#x`0 `7`4>b|&dL&dPdL@`” aD ` &d`"` " `0#4  .>’a\>#8>>>> H&a`&a&a &a@]&a a> M x&$``&`a(&9& @  > M`0#? >4> M> M `>'''' ܖ 㿘 #L@"A#F@"?#D@ "y?8#_#@@,?0q@": <m?#A@"+ 4f? #J@"a?  #B@ "(!HV#C@*!HT?0#Z@ "?J#Y@)?0H (E& 2C @? !& 0& 8& 6&4& 0 .ܒ 2)@d#   ? &@G&& &@ފ&&   ?@   @E  ? 㿘$\  T&'&> ;> ; !@ $\`$$\ $\"$\ > Bd  8 &?`@8 2?@ (?> a8 a4( a4 ?㿘*` !H* !I!J* * @  $H (* aJ@ $H ( $H( @$H`(* 㿘H/` /Da`"`a8" ߖ !D"a8@ݵH 0㿘!D `   !!D "`  !@  "$` !@ !@ !@ !@  0 4!@("b$!@"$` 㿘   E?E `E$E d0@  3@ $`"@ $`o*  "  $ o@?@ /*`@ X" @ @ * $` #@  $ o@? /@*`@ " @0 $`@ 㿘  $ DĒ?D dD@0@ 3@ $`"@@ o$` `  /*  #@  4@ ` @ o@*`@  X"@ @$` ` /*  #@  4 ` o ? /@*   " @0` $` 㿐  h Dk   Df `  $D` d0!@  ?!@#$$`"!@""!@@ o*`$$`@#@  $ /@ o!@*  " !@0` $$` 㿐 " a@0@ ?a@#$d`"a@#""a@ $d` @ 2  (  #"   /*  o `$DC d ` oa@o*`@"  4@ ` o /* a@ " a@0` $d` 㿘   $C  d  C $ `0a@  a@!U$d`"a@ o *`$d`@#  0 $@ / oa@*  " a@` $d` !D "$` 㿘> @#`?㿘8  @b0&`0*`0> #*`0 4Z㿘> @ߐ#Ȁ`?㿈4H> #4F 00&a4L &a8P &a<@b8&aDD  @b<&a@aD> W H@ &d\ `?@ " @ > @@ >    # 4 ` # "X> B#d `@a4 * @bS &`X`0> `4 `8&`p3 (>a&dH&dLdH@] aD `&d\"` " `0#4  >`P`8 2a>">>>>c@p#&a&a&a &a&a @xa> M!,&$``&`a(&5k& @8  > M`0#? >$> M> M!Xa`>''''/ 㿘 #L@"A#F@"?#D@ "}?8#_#@@,?0u@"> <q?#A@"/ 4j? #J@"e?  #B@ ",!HZ#C@.!HX?0#Z@ "CN#Y@-?0L I& 2G  8 2C @? !& 0& 8& 6&4& 0 .+ 2)@#   ? &@ږ&& &@&&   ?@b   @ڔ  ? 㿘$X   T&'& 8   > ;!> ; !@ $X!  @ $X  $$X$X"$X > Bd  8 &?`@8 2?@ (?> a8 a4( a4 ?㿘*` !H* !I!J* * @ !D*`#$\"!D!#$\!#$\*`*  H!Db#$\ ("b!D!#$\!#$\㿘H/` /Da`"\a8" ߖ !D"a8@H 0㿘!D `   !!D "`  !@ ?"$\ !@ !@ !@ !@  0 4!@("b$!@"$\  0 4!@("b!@"$\ 㿘   AE?AA `A<$A8 d0@  @ b$\"b@ o$\*` @" $ o@?@ /*`@ X" @ @ * $\ #@  $ o@? /@*`@ " @0 $\@ 㿘  $ @?@ d@@0@ @ b$\"b@o $\ `@ /* #  4  `X@ o@*`@ " @$\ ` /*  #  4 ` o ? /@*  " @0` $\ 㿐  ؒ @   @ `  $@ d0!@  !@ b$$\"b#** !@* "b!@ o*`$$\@#"  $ /@ o!@*  " !@0` $$\ 㿐 F a@0@ a@ b$d\"b#** *a@ "ba@ $d\ @ 2  (  #"   /*  o `$@ @ d ` oa@o*`@"  4@ ` o /* a@ " a@0` $d\ 㿘   $?  d  ? $ `0a@  a@ Ub$d\"ba@ o *`$d\@#  0 $@ / oa@*  " a@` $d\ !D "$\ 㿘> @`P`?㿀> ``@O>> 0 h `>  p`0v 00)> B`da( 0?"44"88"<     @^ &aВ @^*> W`H#&aԔ `? $'> @O` #`  `@ * @^ &a&a &a#``@   * @^ &a`@< * *  @^w &a`@` * *  @^m &a&`8@ɒ $@ `2  "*a @ a؀@?&`X `&`p>9`a> M!$ $`>$ `!D$ $ &d&d@Y >?> #>!@Ԓ 1a>  3``02 #\`43 /ƚ `> M> Ma!''>''O 㿘#A@"( 4 c@@c_@"*!Z? #B@ "+! #C #L@">L?@"*!G?!  @&>&& 0& 8&! @? !3&  <.&* +& 2) !/ # ! 2 !^ 2@ 2!@   @   㿘!??#"h!" " 8@"*& 8! ` @`?# " ` ` "`2& 8>`T& 8㿘 8  > 7!> 7"bH!Ԗ`(! H > Bd  8 9&7?`8`@8 @ > a8 a4( a4?`@(8 @ > aD a@a@ ?㿐!А #\ !㿘$  T&'&> ;> ; !@ $`$$ $"$ 㿘!h  ?   "h!А! !啘 !԰ "(! 㿘> @ ؀ > @ې > @Ր 耢   㿈> `@LL "> .4 > W`H@`?> > !`.& 0a( @w&eHPH @\q &a@D< @\k &aDT>&a4X&a8\eL&eL&a<&eP@W3  @ $#ے > B#d `@T * @\H &`X> `0!8`4-&`p  `0# %  >b> Ma"<" $``" `" " `0# " %"? >?> >"<a(/h> M> M"hbp>''''= 㿘#A@"* 4#_@ ", <#@@?0>#F8@ cB@"%H #E.@ #J@",?'cC@"%H%?"&!& 0& 8& &&@{!H  !H@ϒ 2 @[ ? 㿘%\  T&'&> ;> ; !@ %\`$%\ %\"%\ > Bd  8 &?`@8 2?@ (?> a8 a4( a4 ?㿘%H  !K.`* !J*@ !I* .`* !J*@ !I* !H* @ 㿘@`!"P ! ; ,   `@8!  2?`@8    `  / ,   `@8  2 `@7    ` , @` @7  ״   㿘@`!"Q   9 ,   `7  `7    ` 1 ,   `7  `7    ` , @ ` 7  ״,`   *`%H!H!D!D$  `"!@!@ 0  㿘!@` " `  "` ϔ! !@  㿘> @aP`?㿈> aX@J> +`> W0`H&a44&a88> &a<`?ap@J: >a@> 0@JaD @Z!&dL> aB@J @Z&aH> a @J&`8> a$@J}&`0> #a@Jw&`4`8`0@e:`8:`8 & `4: &`<:Đ&`@`0> `8+!dL@?&`X `3&`p>cǐa> M""$``"``"" ?W a(-'> M> M"b>'''' 㿘#A@"+ 4#_@ "1 <#@@?0I#FC@ cB@"$ 8 #E9@ #J@"7?2cC@"  80? ,&& 0& 8& 8 @? a & & 2 !L@   2 @!L 2  @! ? > Bd  8  &?`@8 2?@ (?> aD a8 a4( a4 ?㿘!L* "L#L* * @y 㿘$P   T&'& 8   > ;!> ; !@ $P!  @ $P  $$P$P"$P 㿘@ `!"@(` 5ߔ 2!` 5ה 2 "`5ϔ  㿘@ `!"@(` 5 2!`  5 2 "` 5  @aH(""aH0@ ( aLbL@cL `aH(  aH*  aH( @ 㿘> @b0`?㿈> bH@Hڐ> *@> b`@HҐ> *"P> W> "p* `0p H0 `? $@XV&a@> b@HJ g" 6?π  > , "> b@H> b@> b@H 0> B&a44&a88 &a<cd`@ @X"* &`X@@? `k&`pa> M#L$ $``$ `> $ $ `0"`4)`? a(+]> M> M#xc>''''2 A@"$ 4_@"% <@@?0#F@ C@B@ E@ J@  "" 0" 8" ""? > Bd  8  &?`@8 ?@ > a8 a4(@ a4@ ?㿘!D  T&'&!  @ !D `$!D !D"!D !@     !@`51 ก㿘> @b耠`?㿈00`T&a44 &a88&a< $@WB&d@ .@W<&dH P.@W6&dL  @W0&dD  @W*&dP> b@GJ@ "> (ǐ#> W`H > `?&`8c$@G&`0> #c@G~* `0&`<> &`@ &`4(#> Bcd`@  * @V $`$` @?&`8 `@&`8&`T>>>>>>`Ȓb\> M᠘!lb0#$`$`$`$`$`$`#$`@`#`D##><S @  @v a(*> N> N `>'''' 㿘#A@" 4 c@@c_@" <$? #L@"  cC@cB@  0 & & 0&& & &@[ ? 㿘$T  T&'&> ;> ; !@ $T`$$T $T"$T > Bd  8  &?`@8 ?@ >  a8 a4(@ a4@ ?!@( "@( #@* 㿘`$H]$@  @"  @ 0  @    0@}$L?n?"n$.#$.$. 4? 0*`? $.$.  $. P$.$.  4  0?*`  &`&` &` !@"@#@&` @ >  " @+@` @`+` @ *`>c@W0 $.?$. c?$.#$. 4 0?*`  &`&` @  &`#$.㿘dD$ ` #6 ?    > #('?`㿘$D`& ` ` @"?&& `& &  㿘$D$Ð  #@!@$"@  * @@ * @$ `  $  $ $D `" 㿐 $H$@  6  `  $6 d   5 ?$5? \/ $n. *`$n  @  $ $ 㿘  $H$@ \5ْ `$5Ӓ d5ΐ5ʒ5ƒ?5’?  .` . / @   P@ %@ %` %`%`㿐> ;`P#\ $  +` 㿐  P#\w 㿈 @! (  H @ o@   P& *`&   ?* @&`&` 0  P#\ DH 㿐#\ D o 㿐 #\c 㿀    P#\ " 0S   dHd@5-` `$5)*  , `@ P5 &`8`(   P& *`& ?* &$` " * $` `$`* $ 쀢` * $ 쀢 ??$㿘> @=cP   > @6cH   㿈> ch@DY> %#`> W`H@`?!> B> #p`% 0g#`` @Sܔ &d@ @  #Z$> c@D> " `@ > #%k`0F#`&a4 &a8a4&a<` `@ @S* @?&`X&`p `a@@b#>`a> N \$ $``$ `> $ $ `0#%>`4>ࠐ?a(&> N> N `>'''' 㿘#A@" 4 c@@c_@" <-? cB@cC@!@#? '&!& 0& 8& &&!@@  @ 2 @j  > Bd  8 &?`@8 2?@ (?> a8 a4( a4 ?㿘$D  T&'&!  @ $D `$$D $D"$D $@ (ǀ`$@Ƅ (Ɓ㿘.`!@@* `* `* @ !@" @$@`(< @㿘@``!"  . ,:) *`   @  `@/  ` @/  `@/  ܦ`   㿘@``!"  , *:' *`   @  `/c  ` /\  `/U  ަ`   㿘"HD > N "`s 0> N 䀢`   3  ?"H D@ x> "D2 23f#"D0㿘 #%"H D@"3r"H D@?2"H㿘?# %#"H D @"3Z"H D@?2"H㿘!А `  `1  " >   > ' > # #`2 -"H " - #`2 -"H    -#`2  "H "  "H> "L 2  %D # %"`㿘> #`!"H``D `l@ "H?"PD "` "H p@"H D@ @" "2㿘> #`"H !  `` ``0 Z0A0>㿘"H  D@ !А  > #" =0  >  0" 㿘``@l " "`/+ 8$@ 㿘 > `h @>  `p`? @> `?`@  4`? ">  "0> " &a&bL0  @P &bD  7> aab47> aab4 4 `p`@ߔ  2 `P 2  ` `H&a`L> &a&a$`P`@A; %6a쀤 㜀   a   a @{?* @ @* >   &a&a6a&bH& @&bP '8> &b0b(# #b( &>  T@   <@    ` >  T@誐 ` @$ $>#>>`>Ē>㜔>l&a&a&a&a&a&a&a&a>"&a>a>&a>|P   # P P& #0#㜀 bH   #O  % O   O P  0  % O P %>d` &b4bH ">#&b4&b8@J۔ \㿘``@0 2 4 6  2  - ? 0- ?  㿘 L 4(@11 d4(@ Lh@?Ȅ2h@h@(2h@ Lh@2h@㿘 L d,1 , L ( ( L(㿐`P􀠠"q>> >>>>(!da>ݘ#T@&a&a&a&a̔ &a&a&`H0 @O `H&`L!?'> [# > V"",> v!( `H &`D> l!0#> Bc``H  @qs2 c``D  @ "`H> [!@&`@aП`D> W &a &a 2 > G!`> W8   @ ?&ac`a`D &ac``H" K&a>>>K aH>J0#@&a&a&a&a̒  &a&`H&aԖ(H@O&`Lh@?4  @ * " `H@O  &`@&`DhD?! 4hDa* 4@ * 4ga`D€`H`D`H$|# &a&a&a&a&a !p0U@  `>  !0J-- > >>?`x$"$$$48$)11ia> Na*@ > ! h  `0>"\&`0&`4@I 8 4 8>"\&`0&`4`0Q 8  > a @Ӑ ` @"$ 㿘> a ڔ  `@ $ 㿘!!` ` L(@""!(D> (D (F!  (Da4(D! ` @ @0 `P``@``@` >  " `@& ! `` ` 㿘"! @<`!,` @ ; > N<`?& -#< $ 2` ( @ 2 +    2 +` *`*2(2`2* 2 @ @* 2@  & 4  4  4  4 #<@ @ F&" *!*2 3 !  F #@+`3 +` 4 @㿘# b {b6 6 *    > r"  4   @& +& >  "8 >   "P >  "`  >  "pN `&  >  D"  ` & & !؀  " "* @ː&! ` 2`@ ?"@& & & @ Px> #!.`!'"''2" 2?*`  2` @O &`@J &ܔ@؀   #& ܀ !> !X "g$!X؀    |ܖ'''"+؀ $!X P.^# > 0"؁㿘 ?"Ш`"̢&+> *@`@b L @0  `2 * @2@@ &*`@  2@  &㿐 8`@% 8ܐd6 8 |`*  2*` *@ !2* <# 2ԓ*` 2 $* @ "@ '  쀤 M   $$$ ?$ A *  e *   @  *  2  %(  > "g!,2  ; <"@@ <,* 2,2`2`@ ?"@$$%`h d|`*  2*` *@  2* <# 2ԓ*` 2 $* @ "@ ' +  ( ( +  3`+  3`+  3@( F#+ + 3`@ 0+  F#@+`3 +` 0@  $4㿐H /f * ' ! !П€! !П€! !П€, @$@' ,  * *,@ F`$ , 2 , 4` @ D"@ ' `,` `* `*!@!ğ€, d @ !  @W `H 0  H 0 㿘H /f * '  > #  P ;6 '  @f` @& > # ` @ > #0 `6 @G H 0 "x!`' 4 !!Ā@>c> ` @݈*  0@   㿘<%6`6`6@ F&@ *!*2`@ 26`  23@@ 2`3@!   ``$@@> #P`@> #h 0` ?> @ #`> @ #o 0> # i㿐!# !!П€`! 3@#< &>  !,!,&*@ `"Ԕ&  !&, "      6  , "    ?   6 ,  @q*   F" *2 * 4` ,   *`@   2 , "       6  , "    ?   6 ,  @/*   F" *2 * 4` ,   *`   2 , "     b & bb& b & &    2` @ $' `* `* `*    F ! " !bȚ&bИ?&*b&*b̗2&  3 F&"@ *`2 *`! 2㿘6@#6`<#! 6` *` !̐"`** ** 2`@ 6` F &@ **2! 3 ` > @ 2 >  5 ( 㿘!< F#$ *`!*`2  4`4"4 4 !ܖ ,  ,  @,  ., ,  `, ,  , @ , , ,  ,  ' >  2 F>   X0J!$ *`*`2  4`44 4 !̐!    >  >  ܐ x0*)!   `k F! " * @*!2 6 3` ߖ ! `ؔ !Ȁ`@ 㿘  ʖ 㿘 H /f * '  a@" 8a @"  8C a2@>a1@ ; (!1 6 8 ` L P0,@ #$! 8 @ @2 8 8 ?6 8  @00@,8 P, P`4@   H 0㿘!  &   +"  4   @4  "   "6 a P~  *@ *`@ &”   &  2 &!؁㿐b'     *@@@> + @  2*` @?   7?b ?"`* @ ̒ ܀"" |#!"0||"||@ &`є  @ @  @  @   @  @  @   "& & @ @  @  @   @      "  2 &q    6q 8"   @  @  @  @   @  @   "  2A&E ה?    "& &`2  @ @  @  @   @  @       &   @ &  +??5$?H /f * ' >  " &@H 0@`(+>  2`H /f * ' > b` 2`H 0 @ "@@" @$"@2`@" @"` @  ߐ?a?ؐ0P&` &` &`> "' 8ܑH /f * ' `ǒ H 0` 6`H /f4* ' 4H 0 `&`&@&`6`` &` (.` H /f * ' > ! &`$H 0`$ (` &`6`&`0&`(&`,&`<&`8` (8&`  2 &` > ! @ 8&` ` &`&` ` $@&̶ U   ` ,`  2 *` ` !"" `@@̟@& / @`̟@& `@@̟@& `2@ `2@$*` ?c 2@ $  L L` L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L L K K` K` L L L K K K L N Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ N N O O O O( O4 O@ OL OX Od Op O| O O O O Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ O O O O Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ O O P P P P$ Q\ Q\ P0 P< PH PT Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ P` Pl Px P P Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ P Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ P Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ P Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ P Q\ P P P P P Q Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q Q Q, Q8 Q\ QD QP Q\ Q\ Q\ Q\ Q\ Q\ Q\ Q\ Nԝ㿘 <""> > ̐ a\"# H 0"& 0 0 & 0㿘`> "!\""(`?*   *  `>`a@r >  O`+ `6"@`4`> ? `> `F `6 *244``  64` F4` 3,` / %Q,`4`Ґ"$ (㿘``@ܨ 2# 2   "g` ?  .` ` Ѐ` "@% ? $  `    x  0@DF & &`X> 4#*` &`l> !(&`p `h"??`x  @o##&`|&`x@#`x &`|&L   &`t> !0@Ԓ&L`` =  `x+ `t "@ ( `x  `4 *`x @ *``x`s * $`x .a2&`.a3.a4.a7.a6.a5&`&` 0#\#`    @  2`x> !@0Г,  S,, * `t* @` " > @ a> t!h> q!pa5 ` .a5pa5a2`.a2 `, `t" a2`ba20> ! Sa5 ` .a5Ra5a2, .a2 , * `t* @"`a2 2#`?a2#`#\    @/  2a5 ? `.a5)a5, @*``t@*`a2 .a2 , `t " a2``a2` `@ > !0G> #&`0&`4`0 > `@0a  "@n8 8 0 ?耦'?2 '`@2' @.Ӑ 'a8 i ``'@n<" @. >cߔ>  *ޒ@ `    㿐`0@ֺ > N!`&`&`X  6`6`&` \&` * "`2%`ȑH /d4`Ɛ* %`ƀ  !> `ƒ !  `ƀ ``> "o``Ȑ 6`#\#`   @d   ! !5? `.!5]!5, @*` t@*`!2 .!2 +  t " !2``BF!2`B`> 8"6`" @ > "0-6`> ("H`Ȑ#\#`   @  2!5  ? `.!5!5, @*` t@*`!2 .!2 +  t " !2``!2``@ ߐ> "``Ȑ#\#`   @  ,  x  2!5  ? `.!5ݐ!5, @*` t@*`!2 .!2 +  t " !2``Ɛ!2``@ > " 6`6`6`.`.`Ր<#6`Ζ``  }2 2 ? `Ȑ#\#`   @  2!5  ? `.!5!5, @*` t@*`!2 .!2 +  t " !2``~!2``@ [> 8" #``Ȕ #\ @d  2!5  ? `.!5^!5, @*` t@*`!2 .!2 +  t " !2``G!2` `@ $> "66`Ɛ`0{.`Đ  `> `И "#``"H`Ԓ"E &`̒"`> `Օ: #\# `Ȑ#\#`   @  2!5  ? `.!5!5, @*` t@*`!2 .!2 +  t " !2``!2`"`@ Ő> I#X `Ր`Β`! ?!!`Ș#\#`  @  2!5  ? `.!5!5, @*` t@*`!2 .!2 +  t " !2``!2`" @ }> #N6`?#`    2 " `̀@ ~`ԑ2  `Հ  ~  } ~> #fH 00)`"  @,L  >  @ْ ` @"$ @m6`  B`ƑH 0? 0 > N 2 * " ` `` ( ("` ( ("`` `"`㿘?2 > N !` 2   !*  > #В`a 㿘? 2 > N `2   ᄑ* @  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@u 0}| H /d4 * %  S"H 0e  G!_  & *`` &!  @mÔ M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @m , ƀ   4 ƒ@?`4# @ `*  *  >  ` @m$   @ $  @6㿀?2 > N !` 2  6M !* @"G ƀ  Ȣ'  @ji" ?'l@j"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘> >ݔ ܘ" ѯ㿘> >ݔ ܘ" ѣ 㿘?2 > N ` 2  60?ᄑ* @    *@2   r " ?,` `?( ȓ2` 2  d ?㿀 D? @2 > N `@!2` !*@   T &   (@ڭ <  u& 4ƀ  Ȣ'  @i" ?'@iɒ"ƀ  "  < D  " < O& 4 O @l $H c > ` .` 0t.` 0r 02 .`  o.`  `Ր?.``.` .`  `А?6`   `Ԑ?.` 0Y 02 .`  o.` .` .`  .`  .` "6` .` .`0B` .`  ``0   o` `  .` &6`   2 6` .` ` .`  (@_.`  @ؼ @W.`  @ش Դ6`  (@`  &` $@`*   = .`㿘` \ 02r !2 = @q  2g !2 1 `!2  ` 2!5!> !2 #  2Q !2 !2!5 (!2!> !5    2? !5 !5!2  `א ` ` >   .!2 ` J , *  t* @@. \     #`#` #`$#`(#`#` #`#`,#`#`#`#`0@㿘!2 2?>  Ԑ .!2 J@  ,`*  t* @@ 2$>   8("(& (?"D \ 2`  2 * D T`*    H @g< 2#<>  @ H!2,`.!2 , *  t* @"`!2  4!2 &$($&(( "@%"(&:   $ $ $$ $ $ ($ $ $ $ $ $ ,$ 00@   A`0@  㿘.` X*  t * `1P2!7k !* !7 @; !4.!7`  .!40=> 0O> 0 `@2Q #>  `h   @ @ C   p * X2 *` X2 * X2 *` X =*  X * !3  .!30> 0 P>   `@2 #>  `h 볘  @ @   @  ِ 㿘!4 @ X B B  a$ ?  B   `  ? @ ? ``?  @ 2!4- @!3 8!4" @O !4 !3 .`*  t* @`!2 "    "!2x x ¢  x@(  x @@  *@ x =  `ː ` * | X*  X2`* X2`*  X2`* X*  X*`   X ? $  x X `  x @ "$ X `@ʠ >  ܐ  X *`  X ` "@ ?  X ` 4 x>   Ȑ *`  xd 㿘!2` >     X *`  X ` "@U ` X `` ? v   t` ``0` `2j !3?.!3"V!6&` x/   + 2`*`  +  t  `` 8`0`"`0G "2!5C  "`4`00("0`$`0*` " @`0`,<@foH t@`0`@ 0<"@ `0!2 `.!2 `*  t" !2`2 >!2 :!5 .!5` `@ &` ?  .!6!*@ !4 .!4   4@( `2 !4!2 "!4!2!4!3!2@!5@ @ ` >      > (> > !   >  !H㿘`)!4 % X ` #> !6!J@ @4 !4.!6.!4ܔ P " (aX !4  X `"!6㿘 X ` @ `  @> ah  ? > ! >  ! `  *`     t  Đ @-  x @ !3?.!3 2  ` `$ $  @ "   "    @  N2M  H  $  (`"$ $ ($ <$ $,`$ $  @ ,@ @ @*` `  ,@ &$ 4`  @ 4`   @  @Ґ ,`  ` a >"@,`  (@$`!6 ?  `.!6!*@!4.!4/ J   ` "6 ?`0`> 6 ?:   0`0 ($`4$`0 $*` $`@$`@ ,`H@e`<`< `@ 0˒" !2 `.!2 `*  t" !2`!2   @$ !5`.!5  @$ !5`.!5 4 5`4 㿘     >  Ő! 0  D> `! `a@  @  @  2> > !!` > ` !`  @ aȀ"  @ >  ! > 2> >   ">  "8㿘` ``?` ?`@&`!5 .!5`?&`!5?.!5? X` V `$ + ` `("  @ &`$&` &`(``   @ զ@ @ѡ Ԡ@ѝ@h?- ` &`  `.2 *  `@.2  .6```̐ ?6 ` Ԡ" @ߐ. `@p . !6 0?. `  `` < `&`@2( ``4$ `&` .2`*`  .2  .&`!6 ? .!6 !* !4`.!4  (> c ' H /d4 * % !4!!3!2 j!5 f H 0@ ZВ #\>   "@@˴ >  "`!87> ?)>    " - ?>  "`)>   @ " @- @Ӓ ? >  x"8  %>  2  x,  @@ @2 t   3 #\0#` ^  `40 !87> > !  P H /d * %    t `  @" ?` ?"`  t@ ` " ?4` >   (" ? j H 0*:@ # > "㿈 ` {'> *` €     Q Ѱ  ͑* R  ư     `ְ 6?`!?> l*` € ` @ `Հ   * @ %6   @ `Հ 2   0 ~ @ `Հ x  2r   @aϖ ``   @a0X `H /d * %  #``Ȑ[#\`,`0 *  t* @ `. t . !5? `,!5H!5 !2 `,!2 `*  t"  !2`29!2   sH 0 @a >* > #> # > #8> #X> #p> #> #> #> #> #> #>  >  (> | @> y X> v x> s > p > m > j!> g! > d!0> a!P> ^!h> [!x> X!> U!> R!> O!> L!> I!> F"> C" > @"0> ="@> :"X> 7"p> 4"> 1"> ."> +"> ("> %"> "#> #H> #x> #> #>  >  >   0>   P>  `>  > Ð 㿘\ `& & 0& & & & & $& (& & & & ,   <  ( 4 @ L < < X < < d p < < < | <  $ < < < 0 < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < < 㿘 <""> >  a`" H 0"& 0 0 & 0㿘`> "!`""(`?*   *  `>`a@a > Ð )`+ `6"@`4`> Ò `> `F `6 *24``  64` F4` 3,` / +,`4`֐"$ (㿘``@̂ 2 2   A ? А@kb@ @  p  0@4. & &`X> 4#*` &`d> Ð!(&`h&` ``"??ܔ  H@_  #?ܒ H @  'ؒܔ  @^ H H@_ؐ H  @> Ð!0`0@ǯ H&`t&`p  ʔ  &`l> !X@ǟ `   +  `p `l@ " `p`4  * `p @  *@ `p  * `p@ ` *``p  @*`p@ `  *`ڑ+ `l&``p`h 0&`x&`| 0 #\#`   @ `| ``2  `x " K`x ` > @ > 9!h> 6!p0m> 2!``"> > +!> (!`" `X`@ ѐ> Ð!0T ` >> Ò`!> "> "80E#&`0&`4`0 > Ð`@=b` " @^E 8''쀦'?2 '`@2' @ '` w ``'@^J" @͐ >b>  *@ `    㿐`0@Ȓ > N!`&`&`X  a&a6`6`&`&a&a* *  l * @&` \&` * "`$ H /d4`Ɛ* %`ƀ  !> Ð`ƒ "h ➘ >`ƀ ``> Ð"xq``Ȣ 6`#\#`   @   x " e x  > W";6`"@ > ;"> J"<#a\a^6`6`6`6`.`.`ِ  }2 2  &`̐ &``̀  `#` #\ @  2` x " ' x 2`̀ " `̐@Ơ`> Ð"6`>  "`0T.`Ð  `> `Ԩ #``"`ؒ &`ْ"`> `ؕ: #\#(> Ú +``Ԁ``ـ"``̀@2` ـ `Ԁ@` ؀ ` `ǖ> #``$ݑ+` ??,`2ސܒ`Ȧ#\#`  @A  x "  x "`@J> -# `ِ`Ғ` `Ș#\#`  @   x"` x{` " @> Ð#jN6`?#`    2 "``Ѐ@`~`ؑ2  `ـ `~``}`~> Ð#AH 00)aTܔ"  @'  > Ð @ɴ ` @"$ @^6`  `ƑH 0? 0 > N 2 * " ` `` ( ("` ( ("`` `"`㿘?2 > N !` 2   !*  > Đ `Քa 㿘? 2 > N `2   * @  e`f@"N  m@"We e@3 0  h@3 0  n@"`g@O 00 e@u 0}| H /d4 * % !T."H 0e  "!_  & *`` &!  @^ M ƀ I G4 E  "  Đ 4 ?# @4 Ā2 3  @^} , ƀ   4 ƒ@?`4# @ `*  *  > ap @^$   @ $ ܒ @B㿀?2 > N !` 2  6M !* @"G ƀ  Ȣ'  @[D" ?'9@[a"ƀ  )  `6! . @ ` "   *@$ *@$  $㿘>>ݔ!p" Š㿘>>ݔ!p" ~ 㿘?2 > N ` 2  60?* @    *@2   r " ?,` `?( 2` 2  d ?㿀 D? @2 > N `@!2` !*@   T &   (@ˈ <  K& 4ƀ  Ȣ'  @Z" ?'|@Z"ƀ  "  < D  " < %& 4 % @] $ Ĕ8  w ` *  "@> Đ @$ H . \   $ $ $ $ $$ ($ $ ,$ $ $ $ V$ 0@G 㿘`܀> u XD T`*    H @YQ< 2<> Ē   p! &:   $ $ $$ $ $ $ ($ $ $ $ $ ,$ 00@   흐`0 㿘 X  5P v " @0T> 0&> 0# `2g`1> Ē    @ `  Y` А @b@ > >      В@F 2  X#P"< >  @* X2 *` X2 * X2 *@ X * "@0> 0P>  `2`1> Ē   ݖ @ `   `@d!㿘 @s ` lx 0 ` p 3`"h`"  & @ ` *`>@ @ƙ &   ?, *@ l*`  !  p*  ,` "@ `  *" @@ ` *2    ` @h Ѡ` @㿘@ `4  XBa     ? @ '   ?  @ 2@ @@ ` 2@@@ `" X`@ 㿀 |  m  | @ *  2`  *   `*` ߐ * | ` *` |   * |`   `@* | X *` X2 * X2 *` X2 * X*`  X< ? $  | X `  | ` " X `@* > Ēv8 X b@ 2 |> !P *` |  㿘` > Đ!`[  X ܒb@  ?      l` ``0` `2J4"E4&` p  *  2`  *` `` -`0`"`0-4"'`)4 "`4`00("0`$`0*` " @`0`,<@X,H`0` $"a l0@ 0<Ԓ"@ t8`0&`` ? @&`4`? 4@ 㿘`  \, @" "   `2    ,  P㿘 X `  > ǐ!p ? [ > Đ!> ! ` @ @*` `  *`  ``  @" @  "   2`  $`$` @ߖ " ` " `` @ `B2A` < `$` `(`"$` $`($`0$`$, $`$`  ,    `*`  , `&$`4 ` @ ` 4 ` @` `@Ě , ` ` a >"@, `(2 `4 4 9 ` ` "+ ?`0`- ( ?)  `0 0 ($ 4$ 0`$*` $ @$ @`, H@W2 <` $"a` < 0 @ޒ" $`sA   @$`   @$`  - @`2V` 㿘     > Ģ! 0  D> Ē `!ߒ`a`  `  `  2> > !!`> `!`@raȀ"  @j > ! > À 2> >  "> !㿘`@``` ?`@&`` ?6&` R` P  `$ + ` `("  @ &`$&` &`(`` !T @: ٦@5@ ؠ@Ő@ZӒ?' ` &`  `. 2  `@. .6 ```А ?6` ؠ" @.`@Ù .0'`  ``` F ``&``@ `` `&` .2 `@ . .&`㿘 H /d * %     l `  @" ` ?"`  l@ ` " 4  > Ē "8 ?  H 0>  *@ 㿈  ' 6  0z&  u q  i  0c a  ]*  Y  S   @T `   @U0= H /d * %  #`#\ 2 x   . x . x" p x  H 0@TȔ [>* > U"P> R"h> O"x> L"> I"> F"> C"> @"> ="> :#> 7#0> 4#H> 1#p> .#> +#> (#> %#> "#>  >  >  0>  @>  P>  `>   p>   >  >  > Ő ȁ "F   "A   "< 4: @ 4 5   &/ . ", 04* " 0%"$ @ ! " `    " ` %   "  @ $   @ 0 㿘\ `& & 0& & & & & $& (& & & & ,㿘``@ 2E > #`2@  ?2 &   24 > @`؀ 2- > `2 & > @` 2 > `2    ?2` > @`؀ 2    (?  㿘` `   2> N> N""&e   (@( ,> N> N>u>u>">#>#b " Ȗ0#`Ԅ@  6`6&`L&`D6`:&`\&``&`d&`h&`l&`p&`t&`x&`|&`&`&`&`P&`X``'> >#>#>$e"8b&`&`&`&`>#>#!b&`&`>$>$>%>$>$!p#Hch 0&`&`&`&`&`&`4 e &` &`e  ` &` &`&et!@&e   &e> !`0  e" &et>""&e&ex&e|  "    ex@"Ք   ex ܥ  !@&e > !0e> > Ő!@P`> N!`> Ő!h> N! `>@ @r6`>SS͐!4 ><@ >< ?  `@2 @^ ><$  @U 㿘 N!`> ŒM!@W& <C㿘% %t  `` "> Ţ 3! > Ţ@ ,!` #  & ! # S  > !> Na @W㿘> N!`%t> !%``2" t 4  4  4 4 4 4 4 %4 4  t $ $ $  $   $  t 㿘  > )"% ? `  > Ɛ"0034%> Ő"P   @  `> "h &  $ $ $ /@   &   @Qߔ  $  >  "&$ 㿘 ` 2 > ݐ" "> א"؀ " $`   @R $$ $` 㿘  '%t0#cP+> N d% `` a> Œ U#`$a > Ő#(K㿘@%t  4 %t? 0%t?`#2``#2``2`` 2`2`2` 2` 2`2` 2`㿘 `  %t> Ő#Hh> N ! `&%> Ő#h ? @4   4 `    4   4 4 ?#ߒ @4 44 4 <`4 4 4 4  "  > ŔԐ#@V}   d*@ t \ *@ `  * l d * t \ @* `  * t*@  4  !` & > #㿘   %t> #0 ?& `?# @4``" `>   ", `u&  o``%  & '> N "> Ɛ (i4  > ƒb P `O& $ >  h"@& & > Ɛ M :` 5>  A `` `'?`  @0`? 2 ,?`,?` 2 ,?`?c 2 ,?`,?`?# @2`,?4`4` 4` 4`4` 4` ` `* \*㿘@ %t  $ %t %t   㿘 `  %t> Ő#H4> N ! `&%> Ő#hі     ?%   a  > Ɛ  <$ % $% `` d* P > Ɛ   t  @ \* `  * l d *@` PT > Ɛ!  t \ *@ `  * t*@  %  a` & > n#㿘   ` `%t> _#0 &   ?$  @ "  > P!0@ ", `;&  W)> N!  $@ > Ɛ :4  > 4!P `C& $ >  h"& &  5 `   "> N)b&> N ?2 + 2+` > N @ 2`+` " > N2`+ 2 +`` " > N2 +`"b "b$ $  ` * \*@! > Ɛ 㿘`` @c > @] > @W > @Q Ȁ > @K ؀ ` `2  > B#`  & 48@  㿘4` >  0> !> N&bd&bh&bl&bp &bt&bx&b|&b&b &b$&b(&b 2&b\80 @#Δ &b\> &b` @9a ! А@&b@6b8 *>  <@%>  @@ > > ڐ! @ " > ڐ @ْ " > ڐ!(@Ғ "  > ڐ @˒ 2> ڢ > @Ð > @ 2`&b` @bha &`&`.` &`@1 >(b "$bd6b&bL6bbL 6b6b6b@=&bP`? 0 &`c`  &`&`H /d * % `  &`&`H 0 ``^&`a=2   "``?`Z&``&`H 0 0P  `ؐ` 0`    Qa=2   `>&`?`1&``&`H 0 0' > ڐ! J  @ 8a=2   `>` @ `?` &``&`H 0 㿐V"> "\` ?` 7  07@    ` `7 7`  6@*` 6"* "\: * 6 2` "R ` "\2` "P ` "\ 0 㿘!t 2E   , [ &!h@4  , Q @*&"! H  &!l> ڒ #!H@MK &!t> ڒ !p! 2  &!p> ڒ  !@M5 &!x > ڒ ! 㿘!B`$* `!l ` d6> #  `  @M 2&`,f e` "?* `"`> ڐ!  /  !l `2* @ 6> ڒ "㜀` ` @M`$ &`,< f "?* "`h   @`6   @6&$@&  ,`,@`$ `$` `$`,`,`,@,``$ &$& 6..  g. ... @㿘`(>!H`$`(` " .6"?`6> ڐ"0 ?> 6?"c  `$@M`` 㿐!B 7" 2 # ? > V> c"xb0 b0 y4  * * " > Ob* @㿐> 7"!> V"0 z$"0 }C  6 }s 6  * * > O" b* `@㿘> N"܀` > 7b    b0b > O * * " b* `@  㿘> N"܀ > 7b "l  blb 2  3  * * > O" b* ` @  㿘  b@1> N"܀   %  2)&"& "܀ > 7b "l  blb 2  0 * * > O" b* `@@㿘> N"܀` > 7b  b  2 b b #i㿘> N"܀ > 7b " l  blb   2 * > O* " b* `$@ @`(  € 㿘> 7"` ``@㿘!> 7"   € "  €㿘> 7" !> N"?$""  € " $"㿘> 7"       $ 0 D $ $ $ $ $ $ $ l $ $ $ $ $ 4 h $ $ $ $   $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ ` l x ` `!0: ``> >* t*` €> ]":`2> N> 敖"#> N #(' ֘(`` % > "> "Р! 4> ڐ bܔ 4> ڐ#' ? N&`> ڐ#(& > x#8 @B'> N> N#c(,``@2`> ڑ2` ??̀ > a#H'@- " `  > 0> 0 ?*  ' | `'  s `9#X``@Ǒ,`&`㿈@> ڣ6` a#h `J6`6` 8 ? ` <` &  `4& >* ,` €, ,  , * ,%  %  @@ِ @ ,@ @ ,@ 0`& 0@i @ ,@ݔ@\ @Ք ,@Д@vO @Ȕ ,@Ö@   @ ,@@      p. % W "S% O  @@ ,@ 6` 6` 6`  @ `@i  >  `  > N"J p. @ %  *% , %*   %* %*`%  㿘  ,@,``2   @@_ ` 2    z&   v&  r "L   L$`$` 6  $`  @" $`  $`  @2    $`  @$`   $`  B #@$` @n``9$`?  @    @  b #   `?$`$@  @> ` `" #p$`@ @ @ b@ #$`$`$`$`@` ` `,`,` #`< 2"7 2 - ) &`` b`     `   `( #`㿘  `,, `,@80`2  @@p   $ ,  " 2  " "        @`    " $     ?" $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1  $  @ @@`&1  @1     $ $ 㿘`   &  & & & @z&  㿘?.@6`2 `*  ?  & & & & @c&  `2  2&  & & &  ?& & & & &  㿘?.@*26`6.g<  & & & & @2&  g 2&  & & &  ?|& & & & &  㿘?#@#@66/ *6`..7  @ ?#  & & & & & @ @ ?2&  & & &  ? @ & & & & &  㿘.2`&`&` > 0 > 0=Ks  ̐#x2 &@` 2&@  &`& ?&@㿘/ /` (`67`7 @20`0+#" "   &  &2&  @@@&&&& &&&&  0    `?㿘@ ` "`` 4` r"@@ڐ "`` $``  2 0`1 ? #$`㿘@`* @ [N E2`M`4 Y Z"@@Z  `@2 9   @& `,@`@2> #8 @`@"` ` & u "11 #`,`1?*@㿘@`* @Z >M'@2`&J  ="@@E  `@2 @ 5&  @& ! @* <ܒ `@"' ` &  ?1@&1 & 4@`, &`1?@*㿘@`*  @Qc@2`&<#@  "@@ @`@2 %@   @& $ } `@" # ` &  1@&& &?1 &4@& &`?&`, &`& `@ 㿘 > > & &&x&#㿐   ,@ ,   @ 2`@`  " 2` $`  ` ` ` `'``  (`) , 30`1  @ 4 @D    (`) , 30`1  @ 4 @D `  (`) , 30`1  @ 4 @D   (`) , 30`1  @ 4 @D( # (`) , 30`1  @  4 @ $`$`$` $`$`$`$`㿘 `   `@Q       B : "! 1 B  (" @ B 0!    b`    B @ b`(  @@ B 0@!    b`  ` B  b`(  @ B 0!    b B `&    b`(  @ B 0  ! ! 㿘`  &> d#`r   > V## ####1 `_      `?    `$`   ` "(+@+(03@3  @ 0##### 㿘` ?    ?`8#  ?@ 7`@  6`@  .//@67@/`@ .`@  670@./@(@!#####?   LL      ( ( ( (㿘> #` > `@ `?O#`> J     9F (fɀ  ( 4("@`> c ) !> V"<@2!> N#"<(> $ H,"$ L$ T\$ `$ X$ $ P`$ d$ l$! $ $ tऀ`>JА""@>@ !x!> $ H  \ d@%4 `@G v > @   !> @@@ђ  2> . (@Z  2> $ `  >  $?>  Ƞ )> '> #?P,  p҂@` ` @P`? @ ,  p҂@` ` `> !H@<?p ?p "> @̐!  @@! 2> ܐ!@ ! 2> Ԑ!> U?* > U"""b  > [#|=@?P` ?P*㿘!> V#D@u!>  ` #D`@ @@#  @ L -~#> V ` @cDL /<cD'> W L @`  L` @ / 2*@*@L @? ܒ`L , : Ԓ`L : P L?$` $`P  $PL /ˠ cD@,@  @ ` .L - #>  L c"c d a"c4c  L sc  $c $c$$c@F{ L $cx> #> c ' 2N`> 绐"#' (''ؒl`J@ ,#`dܒJ@ ,#`\# N@ x>@N` d2> > bb @/ > WP?& & & `"P  N`> ۔( 筐@ ؒ?P& & &  $PN`> N@ 0 癐 @& P& & $  i l'`sN` e#`s> ې @b8!> W P?& & &  $ PN`> N@ 0 n@۔  P& & `& $ P2#N` d t r2#> ">   >F & A>> ےb @ !> W P?& & &   $ P> #b@> ےb8@ !> W P?& & &   $ P> bH> ےb8@ !> W P?& & &   $ P> ےbP@  P& ؒ`& & $ P  > ,"X> N#`LJ 1ܤ :  : N`> N@0 @_ P& & & ~  f@N` d`l> ےb @L> W Pؐ & & & h# P`l!`sN` e`s> ےb@5 !> W P?& & &   $ P> ےb@'  P& ؒ`& & F$ P2E#N` d t r=#> ےb@ !> W P?& & &   $ P> ےbP@  P& ؒ`& & $ PN` r  > ے  N@> ے 0vܐ@ P& &  & $P# > Υ"㿘> -"N`> %> #> !>  2   b ``a"ذ N 2 >  "> Հ h h㿘> #`,>  `'> Vb8@ "> @  > ې" `"?@` &` &@L *?Ѐ &@ $L 0` &@㿘#> Nc !> > ې#!l $c!l. @㿘#> Nc !> > ې#(! $c!. @@ > W<" L> #d> <> #+> ր`)>6-> ۢ/> [1> > !x` `=> 7!(!<`/`$` *> @$ @`$``$R > > 4!|b*: * @*` " R    2`2 > 㞐#8' > Bc`' Ȉ'> U "cx> ㍐#X㜀  @> @c> @c > ې#x `@}`# x"@'' 2> b#Ѐ $ 㜀  H o@@@%TH/ / X@(8@6_H 0㿘> 5#㿘@#@#1> '> ܒ !@##耢 "!#@̐!!@ "@ .,@!㿘`>  䵐  4  0 "> >  ( 0>  4䥐  㿘> հ! 2 &!@ 2&!>  8㿘 " !> ܒ P@E@ @l  P 㾐> #'@!> ܔ`h@!?#> ې@c  c@> @`p " @  > > ܐ XM   > > ܐ XA & &@ؒ &  ,ߐ> ܒ`ؐ @ ? &   > > ܖ X" <  & (> ܤ a@ @?" 8 '> ܐ@ / <  *@4  @> #> N> Nc`#@ +` * @* $ ` @, В    > > ܖ!(XӒ <  &!0> >  , # 2? " ? @ aP㹔 # > "!㿘`@5`?P> #` > !> W> ܔ Xƒ  > > @L`P!> W X@g > ܐ"㈒ X㜀 7 @!D> ې#'#>7`( @!D> V> ې#Db8'''`(  > ᶐ"> ! !''(  2'0> > "h!㜀 )@# 9> V-> 1> 77> V> ۤ#)> '>7#@@  @?!D''''(̼ @  # 9> V-> 1> 7> V@%!D> ې#>7''(''̟ ` `LJ`> > W" Hbؐ@ > W"`H@Ӑ`! &8> ?"#D'L &)> '>7M "ג*'U  (` 2L `Q㜀 > > ۠#@  @i> @7c 9> ܒ`P@_ @( 2 '  > ܒc@> ܒc @ > Nc "cc  >7H 0+>7(' @X 㜁`> #`& "<  "<@ > "8>  '''#(࢒> B#` ' 'Ŏ耢 "#;#? 3> @#` > b8 > #H@ #> ܒc`@? > ܒ`ؐ@ ( @c >  #h\8> #`> 0 > N#$> N#$$ #r >    " & 4%> ܀ !`0$" >  ##M O>  $$  @ > ܐ#Ṓ`> ܐ#᳒ Ȳ @> b >  > 0>  0>  h# )`@@.   >   $$   > А @y `㿘> #`> ݐ m >  ` €>  0 T 㿘>  `€㿘!> Ր!˖ ?" !.㿀!> #'  # > ɖ ؁㿘>  `€㿘>  @€㿘l > ےc> @ p  ސ > > M  P'> %> ݒ@| #> ۠#@; @np  @g ǒ 2 ے 㿘!>  ` > ݒ! `@  @ 㿘>  `€8@ 㿘>    8 |@ |€0@(> c> ֢  '` `  @ > ݔ8 d੘ > ݔp d࠘&@&  @ c c > ΐ!㿘> c? >  x"@ t@㿘> c? >  x"@`d€> ސ!؝㿘>  `l€㿘> d"%"> O> B c` *`" * `@?" ` `@$`$ ` : * $  ?2 @ E㿘> N # @@@P ``?> N     㿘@%  > Ԑ" > `| > 5> 3>   0ƒ  2 b@߿   2> ߸"㿘`A @@? , : .@2&>  | -?#%>   @   2  ߐH*   `*` @*@ & 2  @  Ԑ?  2.@㿘    2> ݹ"X@s $ $ > W`L`L $" $ "`L> W P> ? 'h'> V*#$@  > d"%"? @2  `2` `pC `4 > ݘxW   > v" 'h1> d+> d;> d"`> 뀤 " "> "> > ݀`" a  > ݨ"p@   @@ ?L@ *  ,@ l l l > ݤ 1> d G+> d'> ݐ ޖh @ :?8'hްȀ > `"  bޤޢ"@̒ ߒݐ`>2!*` €?'hl? @2  `@?`n# @* ` * 'hlh%&" >%b 21l "?, # ` ** ? 2`   2 *+  > d'h%""> d?'h "bh> d""  Q> W> ݐ"ؔ a;J> W  > >!> 8%O"b ? 2  > `ܠ2 > %"ؔ a `4  ?"8c@4cb> W2 @2? 2`  2 2b%b"?"`Lb&"`L c 22` `  @ c > I#㿘 '>  "+  @   #@ @"   #  @ @ݫ, > ݐ# ?ݢ0Ҥݞ0> ݀ > > ݕ#(0Ő#0ݑ,p> c>  |' > ܔ ݬ@~@{ > Ɛ#8  @ @B ```@ 2` > Ɛ#`㿐 㿘> #<x> W" |@>   > W "`x Т@ Њ@@ Ъ@@ >"> %#p㿘> > Bcd?* > W> W"`|"x Ԃ Ң  Ң Ң> > "#p"㿘!> @ Ģ @ ܖ*> B#d* > W" |> W"x ւ   Ң  Ԣ   Ң  Ԣ Ң>T "`"  pК@ `к@>  ""> ܺ#p㿘>   @> B#d?*@ > W> W> V" |"x"b쀌!#> ݒ @   ֢A@ ֢AЂA   @O :>! `!$ >` "`> ِ#  ܀cp㿘!> @7 Ģ @3 ܖ*> B#d* > W" |> W"x ԂԢ>`Ā` > ݒ @ 6>ТA@ @ > ܀  @   آA@ آAЂA    >"`=p㿘> > B#d> W*@ > W" |"x ւ  > ݒ @6 آA@ آAЂA    ֢ >"`p㿘%>@Ɛ@*> B#d* > W" |> W"x Ԃ̘ !> ݒ @ 6>ТA@ @> ܄  @   ֢A@ ֢AЂA    Ģ&҂@@" > Ȑ# >"`Ð#p> W >ਆ  > Bc`ࠅ: c` Т0 ࠅ8 ଐ Т> W``> "`* * :`>8  Ģ@@ > W> 㜄"* *`* *`:>਀> Bc`ࠅ: c` Т0 ࠅ8 ଐ Т> W>ਆ ` Ģ0 > B`఑:? ଆ Ƣ?㿘%> <)> B#`> W@4 #`@"  .? ##` Ҧ?0" ,?  Ҧ?0#@4  6 6 | `?0:> W> ఖ  ࠄଓ:@  "  Ģ` > W``> "`* * :`>8  ĢB@@ > W> 㜄"* *`* *`:>8  Ģ  > B`> W>`:`? " Ģ? 㿘㿘> Bc`> W  %> c`@ @?"46.$,? " ԢB?@0#@4  ?6 6  `?0#@4  x6 0a  Ơ  Ơ Р㿘P>>ࠇ8   > 耠2>w o ??  Ģ> Ut2`  ? @0 `( > Ut2`  ? @0 ` `?> Uw*  㿘@2  ?`" ` @&&` <* & 2` x> #`'   ! 2` 2c2`> U ?bp  @`c2   '耢 4`H*   '* ?@  c2` *`: '2`  ` '䀢 4`H*   '* ?@ 伒   c4   '>! > ״#而X1!4쀤`2 !4 * >'ؐ* 9$  2  '؀ 4`H*   'ؑ* ?@y  c耤`` 2    $  4`H*   $ * ?@ [  sc耤`  Sf`ؒD  ]c而"7 *  6 7ؐ?7ؒ3 Kc耤쀤`2 !4 |ؖ "2   * !4"@!44c 2  ؀ * * ؐ " `H    c耤` 2    * *   " `H    c >   㿈ؔ  2 2  2z 2   ' 4`H*   '* ?@ 㸔 ^ 2` *`: '2` `  '쀢 4`H*   '* ?@ 㓒   `5 2  ?`; *> H€& # A쒒  2   * *  " `H  c `  㿘    `? @ &@6   . ??'  $(,048< ?ݶ@        6 .  `2j ?6 . ?6 8&㿘 >  >   (O``> > "  > a   "a> Ք p > ""㿘> W` 9 L / Ho o> !h"!hH 0 , h @@TF Q J` *` 㿐!>!8''€ 2  H> ޘ >  L 3  H  ?p> > ސ ڔ> ,!P㿈"> ސ!X*> ސ! &`Ho o> :  > ސ!   > > #`5> cȑ. 㜐!`>"!\>"!" ?.)  :  @? (R@"> U?).   (R#\#`#d > ! Ȕ> U. "@@  2 "&` H 0 x> cȑ. !6` cH/` /> դa:   > U".  > > ސ"Ԓ#`2>">"!\!" #)@  :  @? (R@"?).   (R#\#`#d > "P c  q8  '''  N@@(```   *@ $H 0㿘H /:`@ hH 0.  㿘! `2 > '">  * > ֒` + " & & " "@㿘!> 2 8 2 >  "> ` "  +` "&   * ( !'!'!'!'!'!'!'T!'!'!'!'!'!'!'!'d!'!'!'!'!'!'!'!'t㿈 ?H@ > c ?H?L >  X> > "cu#> B> W c` > ޓ* k"@ѐ > 2P@ *@ Δ > ӱ"@""> U> Ө""> 2* > ֖ cP* #` #\a( ?,? "(> Ӑ# > U'b "@@@ :@  T'b" b@@s3> W.5> W`(,`@  6 ")> ['> #\      2 4OP #|`@"쀤*(> 2cP  H'#\q > > Uc"b䀢??&`?0 &> [#c > U`""> # ` " `@> #> ސ##\  ) > W "`> #Д`> #Ԧ*@ `b"> Ԟ E-㿘> aXaX`> ` "#@` > "#,* *+`>  @ "<*`*  > U" > "c8*   > U"> W@/ d$> Ub쀢   &" &""쀢  &"" ̓*`#3@("$3&""> Bc`* @@@$"> ױ* &. . "b0㿘!, !0" !,`@p " ?   ? !8   $`!8 ?&!8!4  `#>a$a *&!4@! P$a$= #$H$$$$,&㿘`(  >    -0 -03> Ubb b h > 5a0#> U">  $0  `H`@'@`@ *@   $  @'H'L> _ d?P@ ? 'P'L'T@'X'\'`` 'd`*'h@'l`'p`0't @   0'L'DxD?@( Hʔ  ?@Ô  ` , *@($``$`H$`$`x@( H @ޜ "+ !0$ < @ * ## # # # 0# H؀  $a  a ?"a ?" @&!?㿘>  T`' B> 뀎 "#> U > ` > "`"` `s"(>  @H/` /!> #@e> #!@I ` " > >  h@z>  >  > ݐ   > Ւ s*`  @ d*@  -**@ *{㿘> d""2 > N* "@*` `@ @$f> Bch> W *@  * $ $> U> U"c ">   㿘> c@> db?> U#`%> U > d"? 2 2 > ߒ ` v > db> N2  *"@ *`` > e ?> d> _!0`2` `*`" *  > R!@$ @$> B c``> ߔ* C > Wb> [? F"t`D`` c`< > ߒ.!(? .#-> 5> ߠ"@ 8c`  04@ @+> d> [#@Ҕ@`2 4  ڨ `>F -` €> !80> !H0> !`0 > !p0 > ސ!0> ߐ!ْ㿈> ߒϐ!> ̐!`'> B%>  0 <  $ ( ,#\ 4#` 8#d 8Ѹ#h 8 ` 4@ 4 @ " 0㿘>  > B?x"> B#` 8  `> " @? "> "0 ` > @ @  *@ . 3> [c|` `&㿘@X  㿈>  `"> > `4]"@!> BY"X!> B#` >  "h#\ #>   K ܪ> ߒE" > ߠ , ">`  * @>  0b <  $ ( ,#\ 4#` 8#d 8(#h 8 2`> !#㿘N@  t> 0``> 0> b#(>  #80 #H0 0#`㿘> #`> #x H/` /> ` `>  Xa,` _$` H p@` * ( 22$  *@ `   `" *`0*@2@  `  *@㿘!0> P 㿘!4> U#8 2! 㿘!0!<@ P*(@<!0 " `  !0 !0`  㿘!4` !  !/\!0 !0!1!1!1!1!1!1!1!1!1!1,? 0        㿘? @2  `@- > b  #> ""`$"!c F " "!> W  `$> 2cP> B\`$  2`> b# ` `   ?` ?&@ &`> O# @2 ` >K!*` €` @3 > B#```, > W !> W  `%> [ @ `` ` `" @ 8    `@@ g`` ?G#@> B#`?H@ @   8 %> ["L@ `> ["d@  2   "@ @8  @ 8  @? ɏ E (` > &`; > #`" ^` #> W`  '> B`  `@|$` `@8` `  "S@? @2  !> " "S $"? ->    㿘>   `"  @ " @  㿘#  K &V, ?㿐#@2> V"8 &`> b @ > V"8@ > ֑H/` /KH p@  $ >  0`''@İ   #@P@ 0c@c@p 0؀` Ho o €H 0 @` &  ͔ 'Ho o  H 0Wp`r\  U |Ho o  H 0 @2b aC`E/ 2VHo o €H 0@9 @ $&  v4"> Ho o €H 0> Հ`& " Ho o €H 0> "" & "  ܒ !:8!:8!:!9!:$!:!: !9㿘> !\@㿘> 2cP> C8!> B#`z  #`>!`@#`ސ#`` @2 㿘> 2> BcP`͒㿘 `#҂@   ? . %$Ң` ` `? 1?` `?1?** ` `> ?.   ϒ  2( $(@2  ?(:  㿘> [#0 Ҧ`z> \(  >M+ t             " "  " "   㿘 @*`   `  6"@ @:"@  *$$ @$> W> W"ԁ"@㿘> W!> ["!  "t> W""tˤ "t  > F @> W@ "> B#` > [  bx  ,` ` 2 @   @> [> B#`bt* @  2@2 `@ 㿐> W@ ? > Bh1> 26@#h`! > Dd`6`@8@. (@ 6` &' 6`@8`6`? (3> D `d(`.@( 8  㿘> #  > ʼ `> [%?> [/?"bL""d2 > [%?> [/?"bL""dK> [#1> W4*` $* c`⌀`@Д`> Uc4 @&> \?  +> W)>  a? 4 `@2 4  ,  2 @ *` ? > B#`Є Ф? *4&'㿘 !Ђ* >`<  `T   Т@Ђ ```> 0 > 0> p> "@3 > 0 @>*!`< `T  㿘?. # , `$* @҆ ` (  .  )> ? @ ` `*@*    * ` `+` {?  ?*  @   !0 Ǒ, 㿘?.  @,  ҆ `   #  >  ? @ ` `*   `+  z?  @    ɭ!` ?$@㿘?.  > > ֆ     + `@`.`z ɍɋa  ? 㿈> W  쀤 8'P` "`" "@$ $  "@& $ ` $ `"&`> W",> ["l",0 "04 "4.`$* P*  @ 2`P$ .4 > W!쀤 !> @! 2> [> 9"#耤2> 2"0` "`" "@$ $  "@> ["l & > W" 4 0`" 0" 4 * @$*` `2 >  "P* @'@`1 > "@ (`@>> c 2"Ң>Ю@>!P € >    (* # (* 8> > c   "Ң> Ю@>    Ҫ`  Ҳ` > W?? c> DP x.*` ''7> B-> W#  @`> 2#h ! > D d`2: *"@ *`@ @ 2 @#@   2: 2?  *`" **@  * @`8>  @" $@`  > c    * *`:  Ԫ`  *`*   *`* :`@Բ@` 2 ` "` $  "@ ꪀ@$ `$ `"@&``$@*  @ 2`P$ 4 4 㿐> [.``"* @`*  $* `> #``** @** >`@> #`` Ҫ`  Ҳ` > W > Dc x'> B%> W/> W†@#@ >> 2#h@! > D d 2: *"@ *` 2    2: 2?  *`" **  * @`88` @" ``@``` "` & ` `"@2> W> ǎ" ` *`> [ #耦2`@`"``"`> [""p`@"@0?"0@`"``"`> W"!`@"@4?"4#`#@#`"@"`, "`,㿘 0 6`+   $* @6`` ?*@@> > W 􀢀  `6 І@ "1?0/?@H /f * ' > W ! > #`Ԯ@`> WԶ@`> W> B#``Ц@`@ H 0 㿘> #`   0 4H /f>* '>x`  t @#@ "x+<`|@\@"|??""|`> ""|>`|`t,` "a  @ `   `0&`44#@& F&  @>!X@> #  $  >  # ?> W`   Ъ`  в``? 2 > ,,: $*` *  ӰH 00 !>!`@ ,,` p:   z"@>!X@ "Ң`H 0㿘#> > B"c &"#>a` "aX>"aX "Ң` Ԣ/>% @>! `  "!X%c ">@>!X@  Ԫ@>>c   "Ң>Ь@>`x$"`x㿘H /f4 * '    H 00 @  +>  2> ΐ"ؓ4 *` $* 4   `?> "*` > W `@  2c> ų# 2< <  | *d$ % > C  x * | S2 ?#?#(H Ҫ@>!L@` @c > `Э`c`е`c> B`#h<  < ?,`6@ <` @& @,@ c 2< <  | "@    $ " ?$ 2n @H 0㿘?H /f4* '   H 0b  @ S> B??#`c  4`*` $* 4` `?> #8*  > W`􀢀"3 Э@@@@>!L@@@> c  Ԭ`Դ`㜀 <`  `<` `?,@ @ 6<   @2%  @H 0㿘  > ij#X- *> Wb   "> W& ! &   & &    J& *  "&  " &  ?@& !> W> W"`  "` > x#h 2  2 "!      > W |    2 "`"`  & V㿘 ` ` > Wb` "` & & D& A& > W b` "` #> W"  ! #" `& # a> W`| "a "!a 2> #x""" " " &㿘H /f4 * '    H 00[" O??#c``> Ȑ#  > C  x ` |*/@`((@"Ԣ>aL€ 0Ң`  :> #Û @& *|``  $` "@` ?$` @`2`"H 0㿘ЄH /f4* '   H 0B " 3 3>  2c " Т@ pꢀ`  2 `<    @>!L@ p` ?|2% "H 0㿘  > #X- *> Wb   "> W& ! &   & &    & *  "&  " &  ?@& !> W> W"`  "` > ݐ#h 2  2 "      > W |    2 "`"`  &  㿘 ` ` > Wb` "` & & D& A& > W! 2> W> Œ " `"  ` 2" `  #" `&   > W`| "" 2 $$ $  $ $ &㿘^ 8H /f4 * ' * > c  "" @"' %>  c ХLЬ@L@  2 c  "0@H 0㿘> #!> B$#`輠#`>  c: > W"`@Ȟ@㿈> #'D'H`'L`2 L> W " > `> W "`L> U"c4>jc5> [&@!>k $> W"`#>gaT> ["c|%>g> W"a'>`> W"`)>a"> ["bh+>ka> W"a->b> W"`/>\> ["bD1>^!> WL"`> [>j>k>d>j>j> ["c#at7> [9> W;> W> W > [> W?&X'"'` `!#" " 'L " "> X> WDc"@`k*+> W-> W/> [3> W"$ ,` ,`@ *`  ?2 ,` HL>  P> \ aȦL> [*" * "b`@!>$ t> ["`" %`" %l" %l> Bc`  ,  '> B`&`Ȣ`"`P> W"`> W?> [" Ԓ% \  @  $ x  % \`@ & >  %>?"> #c "|?@ !@'6`<  <  ? > [> W` $> [ bl'>   `? D4   D @  `'D`@$$"@&$$ "@&> W`0> [ "`0$44``? ?%@4* @ 2` > W  *  `- > Bc` > W * L   > B#`"  Ҥ@ >> W> W b4$$"@",L ", > \ @ 60 > W ܤ + @@ > W> ` #` <   '8   ?Ь` д`  怠 @  Ԫ@>> ax#+  c> B#` Є Ф 㿐> [#>k`>k3> [&bX \1> [&"@>g7> Wb>j&ฐ"9> W' >k;> [`>k'c> W +>d `تa> W->]"`> [/>_""DH> W>k>i#>j%>c'>c)>k"`> [> W㐨"8 > [> W> W`ܤ5> W> [#!&#bh!#| "# !> X#" +"$","(@ `> W"@@> W+@  7> [)> W;> W5> [* * * @ #$a ?"?*>  P> \ aȮ#>`\$`t* &%@}> B#`$`\-> W耤 " , @Ђ$`p %!%@\ '`Į%@U & @N%- '!> ["bH $(: $,``pz(  $``ē-@-*``$ks`(-@ 2 @ cz@% @ 2 ->   h> W- @@$@-  , - R 2 ,@  z@$@?a`> Bc`> W"Ƞ"`G> W"`?> W" Ԓ>&\  "x  &\ & &>?!>"`>"`|> [>#ax4 * `$@*` 4  ! >`*2 ` > Wa > [bH > > #Ȁ  > > #`<  |< z> B` ˑ4 !>!  > Wa> W> ["H "@q㿘 "Ң!,   $Ң` p2  ?!Т@ $Ԣ`㿘> #`  > \ >+ +$ 2   #  ! 2   @ ߔ! 2  ,"@  & & p㿐> W> ! `#\  l > #`!> U#> > "(`$$  \#\> > #\# `!! R 㿘> #`> W! Ԃ@`>!`  > ["H> Bh"@ 2@ @O 㿘> B@ #`#> [c|@@ 㿘  "| @@ @@㿘  "{++c& > # & & $&  & & > Ւ "(& ( ( & ,   z@`> c @z` & 4㿘   ? & @}z "㿘H /f * ' > c    "> Đ    >  qH 0 "c}I "c   >   >  T>  (N"(& ,& (  " 㿘 V> [#耦> ["Dʌ> W > c  "0 @H /f@* '@' #6` ?`6` * ** :`* @ **  $* @ ` @@ #H 0#  "0@㿐. $* @@ / ` `  Ԫ@> B c``&2  >!P €@>a  @ @r> D x@ c`h@_ 2> 2>!L@> 2#h?, ! > D d2: *"@ *` @ 2@ @#@   2: 2?  *`" **  * @`8<  @" H /f * '  H 0 Ц@c`@ @ `',> #`../ / >`@> \ > #> W` Ԫ@@Ю@`ж@`[ ?- 㿐. $* @@ / `   "Ԣ> B c``&2  >a   aP€@a  @ @l> D x >`  ?* `c`[@<?Lp>!L@> 2#h?6 !p> D d2: *"@ *` @ 2 @#@   2: 2?  *`" **  * @`8 > @"  Ɣ` ?* zc`@ @ >` ,㿐. $*  `  /`> Ð  u > W> !`􀥀2> #`2>` >`  | @b> D xc@ T`N> 2#h ! > D d2: *"@ *` @ 2 @#@   2: 2?  *`" **  * @`8 H  *  H 0$@> Bc`@@ -zܒ "% ` ? -` @zӒ "%@   Ҫ@> B``&2  >!P €>a  @  Ԫ@> c  `> B`> B> 㜐`` >`  `>` `?,@{ @ t> Ba  2> 2>!L@> 2#h?, ! > D d2: *"@ *` @ 2 @#@   2: 2?  *`* " > D*x * @`8<  @" H /f * '  H 0 Ф@> #`2<` <`  | "> Bc`@@@ 9-> #`./`./`>`@  > 㜀 > W> W`Ю@`ж@`z "%J ` ? -` @y "%@> c   0@"& 0 4"& 4㿐'P.$*  Ϻ / > 6  ` 2> *! "Т@> > B#h'@2@ ` PP€@  @m` >`  ?*   ]5> B<N  >!L@> 2#h4  !5> B> D d2: *"@ *` @ 2@ @#@   2: 2?  *`* " > D*x * @`8 <  @"   p` `?* z`@@ >` `3.> #`/ /  P* ! Ң`/   z!> Ր# ?& ? ,  " Ң`P(*@z@y "# &$㿈`  8t` p0H /f4'* ''    H 0 0Ԋ@' ?'9>   4- $* @ 4` ?> 1! @* @  2?> '!@> W ,@  # @<  |< "@x "$@ ? - @x "%@    Ԫ@>aL€0 Ҫ@# >  Ъ`c в`c> B`#h< `< `?.@ֆ@>  !`Ք: @' Ԧ@`T# 2>` >`  | @J"> [#耤2> \ > #> W` Ԫ@@Ь`д` ?)-  # `Ю@`ж@`x- "v$ ? - x! "%#   0@"$ 0 4"$ 4> W!& 2/ && & Ҫ@H 0 㿐 Ȕ0[ Ҋ@'H /f@* '@ 9> B+>  -/6`+ @  $*`c6`  ?`+ + `:`* @ > "!8 "o+` ` 2`f> W` c  >`  |>` @U> B "`@ @J@ "  Ҫ@@A@> W"'%@`$ @ $`$`(>aL $`(€Ц@#`@@퀦@0%@c`+`2 Э`> B2 е`> Bcc` `>`  `>` `?@ *@ > B#`Ђ@ Т@@ @@ @ t6`H 0 Ҫ@㿘Ī> B#` > [c耦 .@  !!`  @6`6` `?H /f * ' +   $*  `2  > ! H 00 > W> !  H 00x +` " > W`   > #` >`  |>` @ @Q*@F&@@@   Ъ@@@ @= 2+>!L@%Ъ@@> c    Ҫ``  Ҳ``` >` `>` `?.@@ @.@ @H 00  `" H 0㿐` 8`  0H /f4'* ''   "H 0 0҂'u    6`- $*  6`` ?> ",@ ` 2?> "(,`` " Ԣ>aL€p`>` @   ":> "H @@ z@ `0> [#耤+ -, !`, z#> Րc  %@ ? ,  " ("` (-@z@u "&c > W!`2 ` ?& &&"ҢH 0 㿘> [0#> \`(` `-@"H /f@* '@g > W"> 6`c+   $* 6`@ ?+ + :`* @> !8 ` *@ `2: " Ң> Bc``@$&:@ %$*+> B> W" >`  ?@*  @ c`( $(` <2p>!L@p` ?@*  zc`@@ޑ>` @ > H 0"㿘¬.> B#d> [c> \ ( .@  > W` "`H /f * ' 鷒 " Ң<  2p>!L@p Ң`"⢀  ?` "`|H 0㿐> W ܀`>`  v (  A> Bc`> 2  h6  '> [! > D d`2: *"@ *`@ @ 2 @#@   2: 2?? * > D"@d+ *`  * 8 %> B'> [ ` ?6 *@   @耦   @@Қ` > Ր"h@㿐6`, $* @6`@ `?6,` H /f * ' > W  􀢀 f@6c #@  H 00Q > 2#h?. 􀢠! > D d2: *"@ *` @ 2 @#@   2: 2?? * > D"@d*`+   * 8    Ԫ@>aL€  ,  @ @`  (> [궐"l >4  >  - \ c?Ԫ@` Ю@`ж@`> B#`?> W @  Ң @H 0 㿐66`+   $* 6`@ ?H /f * ' > c   0 4" 2  :  & & 4    & 0 2" "q  "/> W%-  ?4, @@> W  "*q   $@ , /> W - > W   c 2>` >`  | &    Ҫ@@>a  @   Ъ@@c2 ֪`> Bֲ`> Bc`#h>`  >` ?* 6i #@  H 0– < ?& <T > 2#h?, 􀢠! > D d2: *"@ *` @ 2@ @#@   2: 2?? * > D"@d*`+   * 8 _  >!L@  , < & < @ @!c   Ҫ@0  Ъ@@c2 ֪`> Bֲ`> Bc`#h>` `>` `?.@@c 2>` >`  | $H 0 㿐`+`(@@@?> Bc`> 2  h6@  ! > [> D d 2: *"@ *` 2@    2: 2?? * > D"@d+ *`  * 8 > B > [c`?6@* @ ! @# @㿘> [#ٔ@㿐@?x*  `@`<@C> Bc`> 2  h6  '> \.%> [! > D d 2: *"@ *` 2@    2: 2?? * > D"@d*`+   * 8 )> B'> \.%> [ #``6* @(  @"@@  @#@`  > "    $ "  $ "㿐=6#@> "ʒ6`* @ $*` 6` !H /f * ' >`  ?*  `2_  @<H 00gNp> 2#h2` 􀢠! > D d2: *"@ *` @ 2 @#@   2: 2?? * > D"@d*`+   * 8 <  "Ԣ>aL€ p ,   7` /@ Ҧ` ?*  zH 0 㿐<6`,  $6* 6`@ ?H /f4* '  " "n  /Z"$, $ 2> Ր#  , $   ? z@`  (2   z@- @#@> Ր#  2$@  , -  , >`    ? z@`Ӑ 2   z@v >` ?*` `e ?@<H 0 < ?s& <S > 2#h2`􀢠! > D d2: *"@ *` @ 2@ @#@   2: 2?? * > D"@d*`+   * 8 M  >!L@  , < & <  7` /@ " Ңp Т` ?*  zH 0 㿐`x* `  ``> B#h> 26@ #h+ @ 􀢠! > D d2: *"@ *`  2 #   2: 2?? * > D"@d+ *`  * 8"> [# "@㿘> [#T@> W  㿘 p6`* @ $*` 6`g ?*  > W  @ B# @@  > #`2  "Ң0Ь@@؆@' 1> #   "Ң#Ь@@#   Ҫ`# Ҳ`#> B`#h>`  `>` `?*@؂@ @  > #`2>` >`  | @  > B#` ? + + @ @ &     $ 3 ((  3 ;  > B h> 㜓2*@?+ /@" 㿘 8 & `㿘 8    㿘 8 & `㿘 8  ֐  㿘 8뇐 & `㿘 8  y  㿘 8o & `㿘 8  a  㿘} 4> B#h?4 , <> W`@> B#`  Ф@㿘)>!  4 `4b> B#``#4 ! (S`> W4 < Ф@c`ِ>!L@ Ф Ҥ@㿘> " 4` %> > W > [# $$!>! > B#> B#` !4@ *   0Ԣ`z@!> "#`" 0Ԣ`> b z㿘> " 4)> `4`-> +> !> W #> [%"  wc &c q%b$%#>a > B> B#` 4 a ,   Ր a4*` "  0Ԣ`z@b$ 0Ԣ`z@> "$!> `O" >!L@" "  0Ԣ`> b z> b$ 0Ԣ`> b z㿐> #`2r" Ң h> D x> [#@  "> 2> ِ"#h4  0!'> B> D d2: *"@ *` @ 2@ @#@   2: 2?  *`" ** @ * @`8`   魔  騔 " ?  Ф`|@<2`>!L@``"0f e> D x &> 2> t##h?,  !'> B> D d2: *"@ *` @ 2@ @#@   2: 2?  *`" ** @ * @`8`   ?: ,2`>!L@``> [耢2$$  ` *` (`"8> W܀@:88> Wx" "@㿘> #  >& 0 >Ң㿘 H /f * ' >   >徐0!`@> #` "Ң0 Ҫ@H 0㿘> W"> c * > W`> We * > B#`  > 㽀> #`  "Ң"  Ҫ@"#ʠ'> Bc``> W* > c?$  ' # # > W `  * # # > W"@#'> d$  " ``4  ?'> d' @$  `" `4@  ?2' (> > ["t/> d   ?? @$  `" Y`4@ > c A> W  1> c  `> W`> W 7> dЄ' @$  `" &`4@> Bc`? `> > c ` Ҫ` Ҳ`> db"㿘H /f * ' > B#d>. H > c  " @㜀  "Ң Ҫ@㜀 > [#ߤ   H 00/ 0Ң`{. 0Ң`{㜀 8>ք H 00Ф.֤>!H €㜀  "0@H 0 㿐> Bc```@ 3"`   @  퀦   2 >  T`"`&&> > "Ȕb > V @.  > #(>  2 > "` $!0 !,#  "t' e 0; q  05 "' ؀ 倦 0+ $ * 0% (>  >    0   0 0  0(??"q` 8 4> V"`> > "@b'   4> !4#' ږ @3 #> V1> ֐ӎ Ԑ'  Ȗ   Ö !4  > U * hC!> Uc8!$!4> U#T`2 '    q#>a !4$a &@ |В #> V > ` > -#8H`  @ | ` "$`> #H'@  H`  @ | `X`` @ | ` ?> #Xk$`!8 Ԓ "Q'  C #>a> #hg!4$a!4N#> V  / > #'  & '     `'&&  #> # `'&&  yߘ#> V!8 $!8`&&ϐ# `'&&  yȘ#> V1> 3> { 쀢`  ,(!@ z̐  !,!b䀢`   ,@ $b*@ $ ,Аf ! " ,9  {d 쀢`  ,(!@ z  ,  >  "= !.`@ >!@*&㿘!,` ` 2 x  x @ 2??  @$` 㿘!," 㿐> B#`>  ` "> "`  д> W ܀`>  n @ @   @.1 2!,H/` /> > #ؒ> ؐ 8 ">  >( @K>  T`2H!,=# > 2cP) 9!,$!0  @  _ &)`P`  Ԁ   `>@"@ ȓ2@ @8&  "   `8 ,`` !,   ``H/` /> >  H#> m 8'`n'`@'    x`a1> V#> %> z^ 쀢`  ,(!@ y  !,!"䀢`   ,@ &"*@ $ ,А2 a " ,  z0 쀢`  ,(!@ yj  ,  >  "  !,@@ >!@*'@㿐> B#` >  ` " > "` Ѐ + `` `>!t @ @`  `@  ` `  y @ #`> Vb耢p @"b$Ђ`  i`#Ђ` `@.  @`  @`2Z!,`3 2!,H/` /> >  p<>  8 ">  >( @8>  T`25!,=# > 2cPߔ &!,$!0  Ӗ Ԁ   #`>@"@ ȓ2@ @8&  "  (``"'!,   ``H/` /> >  В > 6 8&j&  wc`a#> V%> '> y+ 쀢`  ,(!@ xe  !,!b䀢`   ,@ $b*@ $ ,А  " ,Ґ  x 쀢`  ,(!@ x7  ,  >  "֐ !,@ >!@*&p> Bc``> ֐ "`@ @ >  P> #!, ">  #@" > !$!0, `0 Ъ 3   0`0`4  >    `8  .  `* )T2؀$`H> y!("-`@  \c*    @`2O T[hH *   @`2`4T[U`4'' ,@Ш??, 2 Ѐ&`0 &`4  `    @*@`&@&`  `- @`@@&@&`&`0&`#> V%> '> x 쀢`  ,(!@ wI  !,!b䀢`   ,@ $b*@ $ ,А  " ,  w 쀢`  ,(!@ w  ,  >  " !,@ ` 2@ВZ@>!@*&@㿘!0 !> V#> '> w 쀢`  ,(!@ vؐ !.!"䀢`   ,@ $"*@ & ,Аr a " ,E  wp 쀢`  ,(!@ v  ,  >  % ԔJ!,@ `   ,   B Zu 㿐+> W)> W!> B%> ['> #> [` #`%X!€c| #`@㿘> 2cP@F 㿘> B#`` . b  > U"T`2&@`6  &@> 2cP @% d  㿘> B#``@ .@ @> U"T``6@ ݔ dh 㿀> V"`)> B#`#"#` @@8 < @ H/` / "> W?`@"#\ #`#`@#d?0"> W`?`@"#\ #`#`#d@ H 0`; ??-'> W%> W9> B7> 5> [ #`ah > 㜔* `'    @ ?#`? 'ܲ@ >a 2aH€㿘> B#d.  > # . 0> [#暔H/` /> W`Ж > !H 0>a aH€㿐 0@2 ,> !> B`  H#`> 2& L 8 $@ P@  @`#& H+> W)> W1> !> [` >Ґ!!`  ' # @ ` @ @ 㿘 0@2> B> !#d> 2 H8 " @  cP  L>& H& L   @ <H"@ 㿘>  !, a,H $`> "`" > !" Ւ!4>!  *  * aS!&a4!4”!%&a4% @ &a0 P& H $  & & 4& 0P$  " >( 8 $ $ $$ 㿘!4  #>a2Ð$abג *S"!G 8 !\&66&(!0 Pw!,!4`'>! 2!4 !4f!@f͒!"(H ''   '#\#`#d#h#l H? !\ #\ #`#d#l#hH.   &㿘  ?`> "@oؔ   > "@oє  0> #`$```N` s# 4@#  # 2 4N` s24 4*,   "$`㿘< 2 #&< 6   " "    #" @&& W&8(' D' T' @( ' 0' <@ 2 H" ' 0 >A1> 7""@2 , ", 6"@2@@ђ! !W@@ 1> "(! + @e"1> "@ 㿘`8 "; `( !25 @, !W@2- ` 2) V "  `* @ .*  @   2  @   H ?5! 㿘@ ( H&"$ D$ T$ @($ <$ 0@x㿘D< *  @`8 *:` `( 4 T @`2 0@22 $$44 n@i < $@.  $4$<`(  W2` T`8@lŐ$@0?($0㿘"  @`@ *  1> "P!W&`&@"&`  &` &`  &`(&`$!&`,!&`0!&`4!"!&`8!&`<!6`B! &`D!> V6`H!6`J6`&`&`!` $ @ $ ,  , (  $ , 4 ` a " "*   gG#ꀢ@216`   @  @`@  2#6`> V"  a?Β$  $,  @ `, (  $ , 4   6`+6` 㿘 ("2  , "  0 x  &@ &` &` $&`  H6a F 6 6a B6a J6a 66a F6a 26a .*`*2 2`6aa `@l O@k$@$`6"6a    `     `@ @ "4(&`gG#&`! ` @lV @k$@$` ```Ȗ @ b@`@ &` b``  " "  &` @ 6a@`@ 6a 㿘 @- @"+ >?  @29?@c &  66  F6  26  .6   J6   B6  H6 F6 6@cŒ   8 . ` @k " 8 "@k=&& **`@ @   }4??(@  ?`   * 㿘`=>#ax :N.   㿘> W ` > #`@> H#@?㿘? #> \> #"` 3 > V @* > -#> b| #> \> ##> \`h PĐ`H`P `!> W  `A$ M <  `H$  ` P 㿘>  `l€㿘> W˯ ā㿐N `?#> \  @ <=#: 86> #+>    "'c #>  %> )> .````.`    <=# 8є!!!! !!!!(!!!,!,!,!,!,!,!,!@!P!\!t!!!!!,!,!,!,!,!,!,!!,!,!,!!,!,!!,!!,!,!,!,!,!,!,!,!,!,!! !,!,!,! W" Ƴ @ > 9#c ` , 0~#0p70~@2 8   2  2 @  @ 2 @ 2 ? 42 @ @  2` @" ` ` 2@2`> -#> #`L .L@ ,2&`!/-> +)> '> L a p " ݐ#ِؤ*LL@ ؀ ,> ̐#L` Б* : `Eܓ*`>{  €> W4  > W  *> W4  4 > #4 > # `¤?> #, > # '?4 , > @ #??,* > , > > v 4 >  4 >  k `> W * 4 | > ^ (L`72x4 >  8U `q> W4  |?>  @I, L`82c> B P^> = XY4  ` >  4 `P> W4 "h- > W4 " | > % hA> W4 !d> W4 >  p, 4> # .> # ?(> W4 !d> W4 ! | > #>  >  >   >  >  L > ސ L  >  ְ㿘/  㿐N >  @k $ \ > \#(&a4&   /!!!!!!!!!!!!!!!!!\!\!\!t!"H"H!!!䀢 >}H*            ? ` ` ` ``  @2 `@2 `2 @2 a2"b2$d2(h2  ` `2 @2 2!2"2$ 2(R "  "2@?? 2@ 2` "` "` "` "`S  " 2 ??2  2 2  ::  :: "R "  "2@?? 2@ 2` "` 2` "` 2`S  " 2 ??2  2 2  ::  ::S "(`;  2T J  (< 2 0A  $ 0`@ C1 2/ 0V     $ 0    0  B@ B  B 2?@ (?  0'= 0 ,?`$ 0}p 0㿀@j '`" '> @@j  `> @@j  `@''4y / @2+ !$ `2%  , 2! :  2`0  &`0V` `2 `0` `a `0`,?`&`0}`0 㿘㿀@j '@> @i `&@'''4(㿘㿀``  8`  @ @ '?'8:㿈@jN '@> @i `@''8x㿀` ``: @'?''>㿀```@'?''>㿀` ``: @'?''>㿀```@'?''>Ԓ@`' ` '>} *` €`''`':U  & ':E4 4` `@'44'''4:4` 1@i'00@i `u  |Pq  r @?':谒 h[  b`0 @i',,@i `'E $ LA  B9谒 <쀢 9,  3` $(*`   N0"`@'|'xx9s | &P` $  8@ N㿐  `b{&& bbb 09 4 b~0b| - @ &*@ @ ?!*@Ŕ  2 "| "{    㿘` 8@ "S   ?M # @b +>""><#>9   03" ">!>( 2$ >! # #T T "t  0 $ 0`@ 0 ,?`$ 0{ 0""""""""""0" " " " " " " " " "  "`"` "`  "@ "` 2` 2` "` "@ "`"` "`  "` "`㿘 &`, 6`0 &`4 $&`8 (&`< ,&`@㿘Β ,&` 06` 4&`  8&`$ <&`( @&`,@h+ ` 'L``` 'r'>"*` €` `"b'``]`XU'` "O'` "H'` "A' ' @@gL"@耢 9P@ @ 20` T& ''L@gђ @"` T 2P @ 2 ƒ 㿈` `'`''㿈` `'`''㿘@ 0  0 W 㿘 &`, &`0 &`4 $&`8 (&`< ,&`@ 0&`D 4&`H 8&`L <&`P @&`T D&`X H&`\ L6`` N6`b㿘 ,&` 0&` 4&`  8&`$ <&`( @&`, D&`0 H&`4 L&`8 P&`< T&`@ X&`D \&`H `6`L b6`N㿈``'`'` ''Β㿀``'`'` '`''㿐``''>㾰@g `'`'' \@f`` *'C` ` 2@  '耢 7 \ 2/xe`  p%`  x' p`  px' 2n \ 2 Q 㿘@ 0 o z 㿘+ 6`4&`, &`8 &`< 4&`0V $&`D&`@ (&`L&`H ,&`T&`P 0&`\&`X㿘 ,&` 8&` <&`  0&`4 B6`$ H&`( P&`, X&`0㿈` `'`''N㿐`'㿈` `'`''@f7 `'<` &' 8@f1<`` '`` 4`` &`@`  p 2R 8 "`E'`?` >># *` € '耢 0` *  8 #@[`  p '쀢" ' "'  2  'T 㿘@ N0   N0Y b gp㿈 "``h耢 //77X  "@""""""""t""""t"@"@"@"@""@"@" "0"@"@"@"t"t"t"t"t"t"H"T"d"""H"""㿀@'` '@eT '@eS ''?'GC   㿀@e< '@> @dw `@'''B㿀@e% @'> @d` `'`@''B}㿐*@` Ԕ &㽀`֤$>  #`  ?'6@ `''7@c "@  @ `@"$`$@ > Ő!0x`Ƥ$>  #`  ?'6@ `  ??7@bԔ"@{  @ `@"$`$@ > !H㿈 9 @ >`` '' @gX`0?"`0`,  w`0 ` " &㿈 8@ >`` ''Ԓ @g1`0?"`0`,  vސ`0 ` " &x`2) `2`#  `  `: ( @> Bd?'''''`@*@ `@ *'ؐ˒ذx`?2' ``2` ! > B  `( `@'#d'''?'`@*@  *'ؐذ㿐 ^( @@8\ : (`;Q`<`   @;֒ @=:   0" 0`, vJ`00Ґ` "$` C$`  0" 0`,  v5`0 x @c'L'> LܔL@bޚ < @ L'''/0''0+㿘`?* `@֒㿘` 2`# @ `+  * ``Ò @!<>( 6"> 2"> ."„*"> B`&" #" < " "> \"> 4"> P""  "> Bl"> Bt"  㿐@   2@ &@@ 2` &@`@''@k㿐@   2@ &@@ 2` &@`@''@k㿈> B c``@   Є(   >` '`$@( 6  `* `  * `'##`#\ ?&? > !`0``@ đ: @ Ԟ``@ đ: "@$ İ (@b '@b H''_ [K H T#> ')``@U@@U'``@U@@U?''_^ 2# H ,``@U@@U'``@U@@U'~[``@Ux@@Uu&@ x@    0D7 = 0?   . aF . 6`  &3 @b  'ܒ @b `*   :? ?ʔ  2 '']   `&   $`А &  `&㿘W" > !T "   4  2 4 㿈@`B>#*` €''Y3 "&!$3` "!$ "* !$   `4#&Y ` " !$ 2!$ !$`  &``''Y 㿀` "`   N0!2  NА"@&  ` }~`@'''$  N㿘@ 0   0 N> #p'@UÒ  'p 'xN 1 4`'|!@  ''``>`  ''t 2 > \>`> \c #@'    #*` `'  'tȔ c > {!㿘@ " !$  " T ? ` &`&` T ^ `" L 1 4  !$ @ 2N LL 1 + 1` '&!<` 2g` 2c  X " `U H ` $ `@ 8 & `4!< !@] H C0H*`:  2 L , 2 L(` ` " L`2& $ ,&!<*``I`+ 2`2` # @2&> !  q " TC*$ XaÒ r  ` "  㿘  D&@ &` `$&`  &`  &` &` &` &` e&` &`4  &`4  `4 &`4&`8`<S `\@T @㿘  D&@ &` `<  >`    >`  :>`   >`   >`(   >`0 *&`8&`L  &`L  `L &`L&`P`T `t@T~ @8> # '@_'@_ޒ!@>  @_@'''Ւ H! 2 m` c > z!8> # '@_'!@_@''' HZ! 2 ;`U c > zs! > # '@_s'!@_r@''' H(! 2 8`# c > zA!Ёp@_F 'Ԑ@_E @_A @''''  2'ܐ''v      ' &㿐@   {)@֔ 㿘"` N 0  0`  㿘 㿈`'`@''1㿈@'''Yג 2 Yw  㿘X㿘 0  c:"+"+ "+L"+L"+L"+L"+L"+L"*"*"+ "+,"+<"+< 㿈\ ?^  2`  ?倢` >"\*` €                   7 -2 0Q찒  040! 2` 2 > \#t""`(@#&\, ?",`0?"`0`,  pĐ`0 㿘 (@H N 1㿘  R` "`(0 > \#t"` 1 Lΐ  ?`" "" $ 㿘@R > ]   ?: *` + +@   `+@@ &@ ?㿘@R} > \ # ?+ +@@   :` `* +@ @  &@ ?㿘 `&@ &`  &`  ` &` "` &`@"` &`@@"` &` "` &` ` @&`㿘`&` &@   &@   @ &@  " @ &@  " @ &@  @ &@  @@ &@  @@ &@"@ "`"`  "` `"`"@ "`"`  "` `"`P@ P @], `` '@]'  @] آߔ 25ȐDڔ "@( @> ]`* @'''[2 2 Ȑ ؐW  h@\ `@ '̐@\֒  `@\Β  2/ؐe "'" 'А'\Ѐ 2ؐm Wh  H@\ @ ` '! ?& > ],`  b"P  h`a"`~ NUdEu N@"h!p N   *@':'@\Z @\V `'А'''@Pޒ 'ؐ 2N Zv ?&D  = а 9&*@'' *@ ''[)@\  ''''@P 'ڔ 2 Z=     *@* '[㿀`  a`  :` 4   .̒H/` /@`"a``  ?ab  $a*@$a?" @$aH o@㿀@   0'` 2!"   '`@P#   : * +@& `K x@ <  eܐ'[#㿐``> ] *` @''[f  &@   N $a ! @k` !x`!x "@㿐!'Z";";(";X";4";@";L㿘`(> ]   > Ւ#"#"` ""> # " >  2 | t2 | x2  |   "& ͐&   2 㿘`(> ]  > Ւ#"#"` "#􀢠#2| 2||`"`"|"@ K9 02㿐> ]   > Ւ#"#"` "  If  h$ x$ t$$   K 0 , , > ##`$ | |"` |"$ " 㿘`?`> |*` € &`  &`  &` &` &`  2 2 2  2 @2 @2 2!2" 2(@> # 0'  H&!W  R0!J > !`'  `2` `` 2 ' є 2*В @N0@ W7   2 @   > tː"("L"L"L"L"L "L("L0"L8"L@"LH"LH"LH㿘@NX ?  2`  ?**&@ <&` 0   &` ?&` ?&` > &`  `X  3   * * &`$ 4b8&`0  &`8 &`< &`@ $&`D (&`H ,&`L @&`P <@W&`T㿘@N ?  2`  ?**&@ < >` 0 @  &` ?&` ?&`  > &`$ `h  3   * * &`( 0b8>`8  &`@ &`D &`H $&`L (&`P ,&`T @&`X 8@W_>``㿈` @'''@㿈` @'''@X㿈` @'''@㾘> # '@Y '@Y  ``> '` @XA`''m 2! ` 2h#< 0 2``!`  c > sÐ"@㾘> # '@X'@X’ ``> '` @W`''J 2!q ` 2hܒ< 0 2``ڔ`a  c > s|"P㾘> # '@X|`''@Xy `'+) 2 ` 2h`-  c > sH"`㾈> # '@XH@''@XE `'& 2! ` 2X< 0 2`@g`  c > s "p㾈> # '@X @''@X `'& 2! ` 2Xp< 0 2`@(`  c > rʐ"㾈> # '@W@''@Wǒ `'*w  ` 2X1`{  c > r"㿀@L. `d   㺈> #'%@L> b!@K> b/@K!> b!/@K> J#/#> 5J(2  J J* ) * JJ#2 J J* :  a*@Kj!@/%c > r""㿈@ 2`! "'>   +  N0l"!> 54> 5> "; ! "> !!Z N"> C" N0R> 7"5"3#1!> ."> +")!> 5&!$"Q$ 28` '#\  ^ ,Q 2'` '#\  ^n @TK `&  `/   `}㿐` N@' `@'' Np@V 'Ԑ@V '> @Ԕ@Uš `@`'ؐ >  ''''7  "0'ܐ'}؁㿐@VZ '@>  @U'k? >(             ?㿐@V( '@>  @Uc`?&` & & $˔㿘`?&` & & (ڔ"W0"WH"W`"W"W"W"W"W"Wx"W"_"`"`"`"`"`"`"_"_"`|"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`"`ȝ @T '@Rx @T'@T `' "##v 2  ` 2 <  2 2  '"t    `2`2`" ` ` 2 (*  2 㿘` @@I. .`. `6 `& 㿘` i@@I j` `. @* *``2@".㿘K  (&@R@ "      &`   &` &`&` &`&`&`h  0     2(˒Ȁ   N '؀ 'ܐ  '' @''' ' ''''㿈 ߔ 㾈 "8   ʠ 2.  ( ''ϔ쀢 " &  '   N  ( ''x'|'t  h ,0    , 2)L耢    N ''̀'Ȑ '' 'В @''''' '''k ,㿈   X  2'۔㿘?"@` &>!8*` €"ՔZI  hȐ@G ,,8(   "  2   ?  ?'' ,''''&''''' ,  > #' "`  p ۤ 2Vp "P   K Nx 2 _0xp ) jfOr #`r 20'@R'\\@R 2 '`'d'h`錔X `2 @G^!  't'x  'p   > m"㿘``  `` Fs > #'b ` 'h@   N'H j'Hp@Rw`'LH@RvLL@Rr H9  2k`"'P`" 'P_ N`` NW'T'XP HK'T'XP H@>  28D  1DH@`*   #@   N`[D 'd`]pD 'dhhD Δ  > l#㿐 b'    && ` 2 % ?   $ 2 ''̒! 2 '$_ 2?& & 㿈''J㿐'O㿈 ^  2%?c @ @    0 Ȕ ? 㿀? `]&>!`*` €gQJ ' '!䀢 2?` @ ?'@ ` ''! 2)`  `4''!  &Ag j 㽰> #`' @ 2`0  $`0`  P 2}`0`?'T` ` 2p`00?'d TPb X 2]`0  V NT 2S`0" T XE&    2 jp j@P`'@Pl 2*`0P %   N!`0@'D'@'HT@` d h'(','@' '$''0'8 鐘&`0`,?`$`0b`0 > kY#㽠> #0'@D!@ A 2 0s  % 0`  0 2a 0`?'4'0` @ 2S 00?'D'@ 0G ?@?A N@  ; p j@P'@P@P 'ٔ  2% 0``"@4 ``0  @ R @D0   ? '4'D''0'4$`'h'`'d`Y 2 0 2 0     '0'<'8'@'D@  2 N'4 ('4p (?0'4'D'$`   ?'0'4'D''4$`@'X'P'TP攔 2 0$`^ 2 0   ( '0'8'D'4'<'@@  2 NŒ'4 '4=6@" 'D'H'4'4'@ (?'4'D`'_$`0 $4 #! $'44!!'48 4 2r 0@  k NHpH@ '''' @''' '(鏘 2O 0 2H 0 '0@  2? N'4d '4fp0 N'0'D$`)$`` "`48ѐ 2 0`0ʔ 2 0``@ 2  0` `  2 0& 0 ,?`% 0ah 0 > iː#("l"l"l"l "l("l0"l8"l@"lH"lP"lX"l`"lh"l"lt"l"}"}"}"}"}"}"}"}"}"}"}"}"}"}"}؀!,"^ ! n"Z  2"V  S`Q K< L` "H  5 C` 2 >`)`": $"6 "X' 1`'$ ,` "&  `% `           * `2`` 2``2  (>(# ! 2 K n   !,"X$' )` "#%" !㿘  " .`  " .`  " .`  " .` !   " .`  " .`.`  .`!  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`  " .`"  " .` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@$@" =&@(@( 7&@@@$ ;&@ "@@ *@&@  `  ?&`  `  ?&`  `  ?&` В `&`( |&`  0 " a  0c b&`  @`$ ;&`  `( 7&` !` `*@&` "` `*@&` $` `*@&` ("``   *@&` ~&`$ `  ?&`  ` ! >&`  `   ?&`  `   ?&`  `   ?&`  @`   ?&`   `  `  *@&`  !`  ` *@&`  "`  @ ?&`  $`  ?&`  (`   ?&`  @ `  `  *@&`  @`  ` *@&`   @` $ ;&` 㿘  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` !"   ` 2.`.`  ` 2.`.`.` !.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.`  ` 2.`.` @  ?&@ @  ?&@ @  ?&@ @  ?&@ @  ?&@ @ ?&@ @@ @ ?&@ @ ?&@!@! >&@"@$ ;&@(@( 7&@$@ @*@&@ "@@ *@&@  `  ?&`  `  ?&`  ` `*@&``  ?&` (`@ &`  #!" ` "#`0 ` &` $` @ ?&` (` ?&` @`! >&` @`" =&` @`$ ;&`  @`( 7&``*@&` $X`@&` `   ?&`  !`   ?&`  `   ?&`  `   ?&`  `  ?&`  `  @ ?&`  `  ?&`  @` ! >&`  @` " =&`  ` $ ;&`  ` ( 7&`   @`  ` *@&`  @`  ` *@&`  $ `  `  *@&`  "@ `"`  ("` "` * $   2@ ` 2`  2` *`2` * $ > # '  "      gp , hx `@ @> $ޒ   { $v  `@ 2m` %```  $ 2X   2N] C Ē?#`>!*` €      @&x`h@  y  2 `g@ > d#8""""D"D"D"D"D"D""H"D""8"l"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"" "D"D"D"D"D"D"h""" *@ *` *` *` *` *` *@ *` *` *` *` *` *@ *` *` *` 2` *@ *` *` *`R "` *@ *` *` *` *` *` *@ *` *` *` *` *`  ?`#`w&>"*` €`w@ 2Ͱ  2ưy  2 `v`c@ `@ n ؐM  2|     }`@ xȐTC "  2h7 `Y`t@ T`   2DC `u5@ 2 +ޔ  2$ ~ " 8  }    }   ~@ "" "("T"T"D"8"""T"T""T""t"$"8"L"X"l"l""㿘!0`(`'Lz K; @<\!x?&`( $` L$` `$`  $` $` $` $` $$`  ($`$ ,$`( 0$`, 4$`0 8$`4 <$`8 @$`< D$`@ H$`D L $`H&`$$ &@㿐 $`(!r`6 J @ 9!0   > y#H@ `(< @ * # #  #  #  #  #  #  #  # $ $# ( (# , ,# 0 0# 4 4# 8 8# < <# @ @# D D# H H# L@ @  `7?" @&!?> \*` "@"` "`"`@"`>l*5 "` . "`  0%   0 "`"`>P(   "` "`    "`"`㽀> c>  '`$ a0a aH @'䀤 a*@ " aa#a  p= ?p! ''''d'[ ?x"  ?q  "a(J  a($H$$$# > a#p㿈> \`#(@a05 ?``81 >!*` €> x#" > x|# $ 0> xt# b$ 0*`" *  * $ 4bw$ 0$ 4  `$ $ 㿘@> x͐# 㿘c㿘` `   `!" ! ! 0  C ƒ A > _ d&a4""""""""""Ԗ       @  " $ "@  2 "` 0"! @0 0@0 "#@2$2(  @ > `"`(0"`$"`( *!   2 @2 2 2 @2 2  "` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` " *` ! " ` *`"  `*`   `*`!㿘       @     &@  &`  !"   0 "#0   02@2222 2@ &` 2  2 2@&2@2 22 &`  (> `b & ` &`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`.`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  `   .`  " `   .`! !2.` .` !.`.`㿘 6@  6` ` 6`  6` 5.`㿘&@  &` `&`  &`  $.`> # '@ 20ɰ  $0`2 )  `!" -!!"C`d`a "` a_k P`$`d"` !M x ":`l  -e% %"Ӡ# %  "~`  !0GNe"`!wC=` `&13!0!(h.!,( -!" !!!)!( `  ` !2!1  -0 !%0"   .A"`PӐݒjג/ -ĐȒ0 !0!! &``D  20D "'DD  @D@ <'<  '8 `b@8`h@ 20`w  20g77@w`h@x 2o0xp'pz`'t^ dv\&``w@4 `W(`"U0`< 2Q0` `"K J0`4= C<&`?  `@ 2607` @2 `:` ! $`   20P `@ 2 0( '`` @` $ 20``  @0ϔ  20f@00`,  20`_@,0` 20@ 20` ` 20@ 20` p` 20!@`w 20~@ 2{0`n t0`a 2m0#@ 2e0`X ^`K 2W0!@O`= 2I0@ 2A0`4 :`( 240!@,` 2%0@ 20` ` 20!@`~  20@ 20`~ a@࢒ 20 'X'\'`'d'h'l't'x'|'''' '$'(''H','4''8<'@''`XL'p'//'''''''~ `H~ 20H?L'P'T'X'\'`'d'h'l'p't'x'|'''' ''T''D''' 'H'$'(',x'L`'0'4'8'< `/2   /` `/82   /80"aП@ 2>0K"a@ 4` '((~& ,`` '$``"'$ 2 '$ `@$   '  - b}@ ޔ0,?`$0R0 > [ R "  "2@?? 2@ 2` "` "` 2`2` S  " 2 ??2  2 2  ::  ::S "X`?` O> *` €> `#p` 0 @ ?*@ @9&`@?'`@''@? `'Ȓ}z  :А}v  0 *Ā '}a  !}`}^  -``> `#p 0  ?. "L"X"h"t""""㿘@ ?"@!^㿀@?] '@> @> `&@''' 㿐@?E '@>  @> s㿐@?3 '@>  @>n@B㿐@?! '@>  @>\@B㿀@? @'> @>J `'`@''g㿀@> '@> @>2 `@'''P㿐@''˒> #`'@> ',    ` @@&`@ |1 2}> `P@<  > ,@>  &@>  X|u  "df``@ X&`  '0 @>~,  > `c  ?8'4'@'D'H`p'L L 'L'PL`'T@'L'X'\'`4't|  2` 0| X 2^ > Y+ h㿐 ''g㿐!   @{'㾀Ԥ$> `#`  ?'6@ '7`'7@<%!@{̔  @ `@"$`$@ > X x㿈 \@ %( <`  `>`' ' @@ 0" 0`,  PP`0 ` " &x`?2* ` ` $ @*@'䀊`'؀  > Bcd В@*@ *'`` `:'`?''<ذ㿘`  ,㿐 @ޠ I`2`    "$ (`) 2 ``> a *` &``  `  А `  {` "` $ `(``˷ 0" 0`, O`0㿐 7b @@ : (``<`   @ @t   0" 0`, O`00 ` "$` }$`  0" 0`,  Oo`0  (#> c'@1l e> "{ > "{ > /"{ > ې { > 5!{ @z ec > W 㿘`  @ 4404㿐@< '> @@;њ `    K`2`2` 2`&`. 2. 2+!$ `2% , 2! P  2`0  &`0V` `2 `0` `a `0`,?`&`0NҐ`0 N㿀@0Ғ `z    㿘!$  ` ` `|`x  = &   " &    "& &  X @@0 $ ' ' ' ' '  @' ''Вy'H@; '@>  @;'@ @''''' a X  D    <>*@$ D`㿐 3@ !`( X  D``0?"`0`,  N.`0  > <*@$ D` 㿐@; '> @@:͚ `< @@ 0 @>8("> " <" ">  " "„"  㿘@   "@@D/㿘@   "@@DA㿈@> a t 6 > a 4* " ` '`'`''$ 㿘5L > a`x @  `x@@"```@ @V 㿈@`> $` ;`"B ` ',`  '@ $ $  !* 2$ ! "!  $ ! "   $  * `$ x 2` x " ?!   $ 9N 㿐4 @''O@6 % * @,`@@-̣,`@*` ,  ', @- '`H* , `H`@-, '`* , `  @-, @'x0 㿘!?΀@.`  && "@*`" * *   {2 @{@6_ ,`h H( h(  *H 㿘> a `" @3!  @ `> #'>  b '" > a,  ` @3@ 2`@`@2 2`@` 2> "ld> > b@7``'`'Ā  > %> ,7>9>;>L  -`*` :`*  L?Ѐ  l<`l9&``&`0`4 &`4 ` &`t` &`x`  &`|`6J`4 @ K ~`$+  + 4 &@ @ $ @   `@$ @ *@@̒    @Ȑ  `@  *"@ *`" *  *  &!: !@,#,` " ``4 2` * $ ``$`4 `8`+   "`4㤔 U\ " UW `&`&`?>a$&`&`Đ ޔ > # > T#㿘0    4 g@ ` `d `t %3 *` *  4 `??P `? b?*`?"@" 2  8"*` *  4@ @  b? ? `$ `  `* `b* " 2 ?"  " `  "$  `*@ `! | 2`*` *  4 `m    "" "  `*@  x `(2`* *  4`  c *@  "`b"  ] *   T"* *  4@ 8@   c*  *    ?#     c*  *  ` ?#  ,` 4 , c (   # ,`# (`*`* ,` $ ( , "  "     *   ? #  `*@  > #` x 0x 㿘  u 0q > ##Ĵ,*  4 `p _  $@)> ##)>      @    $ @   #h `h*`@ €  $@ݔ Ho o ?$ H 0   `h*`@ €   > c0h   `H (`Py" `p `h *$`p @ 0,$ 0 4  "0Ho o ?$ H 0  "0I 0 P >    `? 㿘&    +> >> c$ $ $`$ %  &$`$$` ?"   ,- * 4 4 &@ `@" $` &`0>  > #`cPi㿘? @2  `> b`2  `*@` `0, *  4@` p b$ l"$ p#  c$ $ $ `  $ ` @  $ `   $  !%$ $ $ `$`$$` H /e * & @ h `,`*  @   @  *@@C  * ` `2 p`  p &$ p ?#$ p$`I H /e `H 0 p =8$ p* & ``   p " #> $ p !ch   p "H 0 h> ##*` €㿘> b   *6 .  *  4@ > # h#*`  €H /e * &  @ p  @9 H 0m 㿘  > b 6 . *@ *`@`<> # h*` 㿘  > b 6 . *@ *`@`<> # h*`   > b 2 * *` (<㿘> b   *6 .  @*  4 > # `h#*`  @ h ` ]@ P `y@3`x@0O `z@!`{@" F  k@ "+  j@*\@07 l@m@".    $ # 0$    @ 0@ 0@ 0 @} &  &/x "  $ l> b0*`( (4H4p(p 2 "p " H 㿘 l> b ` `2`**`  *  4H /e4 p* & p V  H   & pGj Hz  H   t H$ , P$ ( p & p H 0 H(  h(";`"' 0TDQ l2 m2`@2` 2` "a`@6 "2`@00@22` m*2` l(0! @ ` m *` l *0` @ ` m(` l(H  㿈 l> b `2 * *@ *``4`(      ܖ 2 `$   Җ耢  H /e * & `(    S`(`  v r* * `$   | x* * @B   @? `@ @ @ @ "`$2 #!"  " "" *@`@  " *@  * @   @ N *@ *`@@2  "`` *@ * ! * H 0 >    `? 㿘 &   ! `l`T `4->+>  4$ $LXL bx   P P` P &`0>  > #`> #peْ㿘?2  > b`2 _ *@`"Z `06V . *  4@H /e4 * &    H 0;  & H 0$& @<?& @9  && H /e * &  h*@@A   @>   * H 0 &   > b 2 * *` ( < 㿘@c㿘@]㿘> b ! *`6 .  * ` 4@ #  @&=   @28 #83  &/ $$ + @$ @$$  &@ &@ &H /e * &  h@* @ o&H 0  㿘?2  @> b! 2`.  `*``*   4   @ 8   !   `$ $ J  T @@` 2  7 QL  H  $%`H /e * &   8 J$ > ! B H 0 "` 2 `% ` @8` 6   2`H /e4 * &   J   ?$   J 8  ?$ H 0`  %` &`"# 㿘  D1& 㿘  D)& 㿘& & H /e * & 3>  h*@ r * @Œ   @”   * c! B  h*@ *@   @ @   @ H 0 &㿐& & H /e * & /3>  h*@ aѐ" | x*   * *@ @d   @a H@Z   @W   * c! A  h*@ *@>   @; H 0 &㿘  . "* > @$* 㿘  1> r @$#耢  @$#㿘@   `@  ( 㿘``@) > @)#Ȁ   㿐4`> c!#0􀢠>  c 080 g &`> &`t `(Ҕ &`l`t> `0̔ &`p 2%&%"%&`p`  &`|&`x k &`*@`@(``L``<`\`0 h@  hk  *p` *hq` *(a` *hb`*(c`*h@`*(A`*hB`*(C}`p`l `#\> b 8>`̔ LM > bLG >c,&`L&`PՔ?>"&`<&`@͔?> &`\ &``Ŕ dI>̀ `?㿘&  )> r>>"b $ $ &@$`$`$   $` $$` x,* *  4@,`0  $*z &`0>  >   xbO㿘? 2  > bp`2  > baD  6 p*aD @ 0+   *  *  4 p W$ l"$ pA#  c$ $ $ `$  $ `$ @  $ `$   $  !%$ $ $ ` $`$`H /e * &  ` *d@( `  *d@Z P*`$`2 p`(  p %$ p ?"$ p$`H H /e `H 0 p =7$ p* & `   p " #> $ p !`k   p "H 0 h> ##*` €㿘  , > bap* 6 . *  4@@ h> ##*`  `€H /e * &  @  p   @ *hd*(H 00 㿘  * > bap* 6 .  *  4@@ `h> ##*`   @ l d ]@ T `y@7`x@4S `z@!`{@" ,J  k@ "+  j@*\@4; l@m@"$2   , $ , *(d  *0$  @ 0@ 0 @ &@ 0  $ &(q "  $ $ H( (d"5``0O?LK 0  (2a@2`@ 2` 29`07  + 0 ( `+ 0  (`#("`+ 0 (`@ (` + 0 (`(((H  㿐 l> b ` `* p* 2`*`  *  4`(    p@ 2 `$   p@  H /e * & `(    X   *hd`@ @ @ @ "`$2 #!"  "  ""  B*( @(`@@  "  D*( @(  *h  H@(  *(   *h   *(   G*h   @* *( *h *(`(` *h9 *:`$ "   *h1 *2  @( h( @$ (H 0 㿘  *@ > b!p*`6 . @ *``4 > # h*` 㿘  *@ > b!p*`6 . @ *``4 > # h*`   (> bap(2 * (4@l> b* ap(0((4@H4p(p 2`,"p`, "`,H 㿘 l> b ` `* p* 2`*`  *  4 H /e4 p* & p" V  H   & p> Hr  H   H$  P$  p & p *(d  *H 0 A0(( ( z4* x*" 2   ",",  ("@" ` A0(((`46`*`zx*" 2  ",",` ( "@"   (A0(( (4, .  *({  *({, ",,  ({ ({,",? `" " ({ ({ $ " , "     (*(,߆",#@  ( A0(( (4 @ , " ,"@ ((㿐'   ,w ```P@2?@?<   lv  2?o@?   lu  2?@?<   > #` l 0k 㿘`   0 > ##IJ,* *  4`p` o  @!> ##    @ $  $  @  `h *` €  @ Ho o , $ ,H 0  H /e * & `*(d` (H 0  `@$ ( `h* € > ` [  `H `P" `p `h $`p*@ @  0,㿘.`@&Г. 2?#@2..  > `?㿘 | @& `&`0>  >  > ] ȁ   㿘@ 㿘@   㿘a"  ``> \א . 㿘> @#[``?㿘8 0 &`@@ `@< @ @ (@> 0 > \ 0> \!0\!@2㿐 @'  lH  @`@'   > !\ !` @ "l. @@ ?"@ @ ( @ *`㿘?> bȑ2 `  6 ȑ. @ 2N <  2  m$& 4 . <& 0 㿘?2 > b ȱ. @ 0 @Ɛk d k d 4η , <㿘 0 "B   @ `  ` kː#   @ ` 2-  ` " 8'   & 8*` @ ` *` @ `2  @k#  $ @ @ ` "  `` *`2 0? & 0㿘?2 > b ȱ. @ H .&$ 8$ 0 ` 0@&` $ 0`$8$ 2 4  㿘> @"E!H 2 ]@ P> aXzc> [`> apz[> @")a 0> [!0   &`P<   &`TH  ܖ &`XT  ֖ &`\`  Ж &``l  ʖ &`dx  Ė &`h   &`l   &`p   &`t   &`x   &`|   &`a4 " '> @!ΒaH 2'8 '> ?az@`P* `&`@&`< "`<@`P`8*  "jՐ d@`0\Ԓ> [!g!D8 `'` ''>D 㿘 @#> ya 2  & L> ! Z05 @$& H La @yw H (`< * *    L`8  @2 `   " `8 L@ ` "   H&`<㿘`>  Z!؁ 㿘> @!=#(`?㿘4`> Z#00w > #PZ0n8  0&`0> &`DZ#p`0.`y  `4`#`    * >`0  >"d&`4 &`8?> cF`P &`P@<`T``L `> Z\#`L> # > b"%> #> 逎"6, ZKc6 > ZC#`P &`P@`T``P @&`P@ `T` D`0*@㿘  0 *  | }@  ? ?   P "ǰ T  H @  T "  > 5 { "> 0 {>  P & P {#Y  0" >  {#Y  . ~? .   & T ~ h . ~ * ~ @2 0& T@ 0  TYϒ  0 T 2L | P. |  . } ? & P. X. }5.    ?    ? & P. X. &. }   ?& P@T  } @ ?& P@K  }  ?& P@c   }  ?& P z@Y  } "  | 0 `"* 0  | } `:R 0 N`. | X @@ | }2 T  ` & T X. { 0 @ *@6 0 23 0 X . {-& T`  !   **X*Y*}*ZL@  y2*Z *Z !   **X*Y*} $  * * X* Y* Z* }㿘 { "  h ! "  h0B9 $"> h0= i*  9& L i,  >  HY   >  `Y  >  Y   P L `& P>  >  >  X  P  & P h Y Z @. x. z㿘> b"`$"`   `H/` /P `#"P hl ?H 0㿘> b"` "`   H/` / z P*z "Pi H 0> b` ` 2z 㿘> b"`2"`  .* Ho o y  "L  L @ *yH 00 P `!"PH 0> b` ` 2y  0 c 0" 0(㿘 0a b   gʐ   0 `  * 㿘> @ 耠`? 4 0S #> `v@! 4>  W 0e` vs x`<`0`T?   ? " >Ő!&`<&`@?> WА! Y> !(Wɒ &`T&`X>Ő D ̒> b"&`L ,`* *  \@ ,``* ,@*`&  ` 0&` 4 & & & ,   "@    & &,&&@`͑,`㿀> a8' L>''''A & @a0 ? ?(? c ?ߐ c 2 (2 `   @& 00& 0㿘 > ,WM!@  #  # # # #  #  # #@  "> Bd @*@" """ # ` *`  # # \#@   ?`((2` 0㿘   2f" , u2`f   ?Ϡ 2  @ 2@f 2@f"  a0(2 %` f d `   ` >  `!P ,Vƒ`00 @T  )  2 2@㿘`>>  ሔ`P  > !T㿘#> Ho o T 2H 0  T a 4 0 T & T& XH 0  > !Vx ** *  *   \``>  0``@"00` "0@" ! VO = 0㿐   \ @ "  2@4  \ `" @1  4㿘  X  > b""Ho o X""& XH 0 6 T  "t. >  V" 㿘   0h    , , 0! >  ,"0U`0 $`@ (" (" $" $" (㿘 > Uΐ"h 㿘 D *` `? c *2`  > `U"x> bb& 4& < <& @>Ɛ"`  D$ $@`` 4㿀@ @ @ > b' 4''>Ŕ''? O&    *  2  *`` 2   ??@*    2 ?? *`  `2  c *  @  0  2   *` ` ? c *2`   `@  `& 㿘`>> "␔`8 > "Ss㿘#> Ho o < 2H 0  < b 3$ 0 < & <& @H 0  `(*`> SF"Ȑ *  *   D``"  > @H @ S."Ȓ 0㿘    2"> S #("Ho o" @"& @H 0 4 <㿘   D` `*` ``? c *2` `  ` `c*     0     `   ` $` (`  ` ?$`(2 2 $2 "2 !2 2  2 `4㿘?# D #    *` `   @ `*`2@     "! 4   *`` 2 *@ 3@   2 >  T#X 4`" 4@  4?< 㿘`c deZ4%Z@#c)!@O"@ @"@ @"@&`d  &㿐!,ؖ* *` @ #` `"   @ .`  *    ?# 2 + @ 2   *`@  `!2  $""" ""  $`# ` (*` # # # \#@   $# 0 # #  $# 0 #  #@㿘  *``2 @" !   @*   "82 @"  @*    '2  *` `  ? c *2`    ` *`  ` ?# 2 *@ 3 b   *` `  ? c *2`     ? *      * 2`  3@@"  ?#c  *` `  @ `*`2@   ` b!? 4 .  *` `  ? c *2`    @h 2 ? ?   *`  ` ?# 2 , @6 㿘  *` `  ? c *2`      *` ` ?# 2 *@ 3@  $*` `2 @ #" " " " " 㿐>  a@b@>  T`', b0"* @> > P# 0 㿘> @#`?㿘0 &`4`&`8&`0&`4 &`8&`&`&`P&`0&`x&`D&``44> R:#0N` > R4#0H> R0 0D `Ĩ?`h0``  x   `ꀤ``&`T&`4%@$&`h&`` ` `S>ǐ @&`&``{,?> Q 0>ǒa&`&``{ ?> Q 8 0" D 0 2`@8 (D0 (㿘`@[`?㿘> Qǐ H>&`0 8&`4 &ah&a`%3&al㿘aX@   "  $  < =  2 㿈 0&!X (@ 4@ 0 ,@ 4@ $!T 2T !X > bN #<`"!X@ΐ!X 2!X d    2> OĐ P@~ d ?$ `$ $$  $ $ !\ "&!\!X   $ $ $$ ($ T$ X  2$ !X  8)>'>!P#p'!R77':ؒ耢 $ $`  2!P`?㿘!X #>   "  $ " ;   $`hQ  $ $  2 㿘!X   "   $ "  S 8!@ +> >  '> 뀤`ࠒ`,``Pѐ`,```PȐ`?#@*`%`"> > P > P @"2> >  ؔ > P ?#@"> > P > P `> P >  P P`  +> >   %> !> 뀤`!Pz``  `Pp` !X" 2 `  (  㿘 ` "& (> N!㿐 ( 2 > N!Had  "ad `0(€`4 `   & ,0& 0@& @D  " & DH& H2 ` !X` " D "@  @@(,2`2$   ,0 4 2m   H 0 #\  4 D  "   0 4V  (aX ? `@   T ``   (  @? `     !X "& `  !  L P"  , &,  ʒ  Nƒ  ”   ?  `#`_E& `  ad? "ad `0,€`4 㿘 ( 2 `> MԐ!H 6  ?'& ` & `aX` " D"@ @ *@`@8 `0`4  H  , 0€ 4 ad? "ad `0,€`4㿘 0 4 " G !X "C   "?  P  & P& L L@8& L  P@*& P L  P" @ .`@6.` (  N$           㿘` !X`"` `  `T  2`\`\ 4``2`T+@ ` !``> M!H /e * & ` $`T$`X$`\ 0>  4` "a`H 0H` 1` !``> L!H /e * & ` 0 $`4` $`T$`X$`\ 0>  4` "a`H 0` H /e * & $`T$`X$`\H 0` !` t  v  m o 0 `  0  4㿘 !Xy "v   @"``T  2`\`\4``@2 \ !``2 0> Ln!$€ 4+ ?-  & T& XK"!`/ !``> LU"H /e * &  0 $`4 > 0  4  "a`& X& TH 00H /e * & & X& TH 00 0 $4㿘!X "  T "   Ȓ  "  T@ X  "  ?   2 T#= #> #> #> #> #> #> #> #> #> #<#;|#;|#> #<#A#A#A#B#B#B0#BD#BX#Bl#B#B#B#B( 82?<" 8#"2'"" ""2''" !X"$'>ђbX@ ?a 2a㽸'D 0D$ 4'H'L '$D> "@,#\ Ԑ  $  €D> "pM0?0}  ,€'$r  'ؐ '''(    А\@#\; @'Ȑ 'Ȁ  Ԑ ' LH€ Ԑ '\` `'>ΐ *` €̀ 'Ȗ Ԑ Ѐ'(`?`\ܒ` [ `* [ `* [ *` '(̀ [` @[` @ԕ*Р [ؒ` @[Ӓ` @ԕ*В`[ˢ@ ܡ,  @< Ԥ cА@#ה   @ @ @ @D> "L̀ ?@  [` @"2L4 В`[@ ` `?%?В`@[ܒ` @[~ `*@ [w `*` @[p `*` %֨ LH  { €,( `"-`  ,#\ $Ԁ`ԑ2 'Ԁ`  ''( + WU/ 0@ 4* "@   ,#\ $@`2@ԑ2 '@   'и А[  `'Ȓ`[ `'Z` @ ԀCВ`Z `I2 `Z `S2 ̐  ' €$㿘>   8K" 8`  > K"  > K" $> > K# K# >  K#8 @ 5>  '> %> 뀤`"KyHKvP``  `KlX> #`Kf `",@> K]#`` H>ΐ *` €> KP#C> > KK#>> > KF#9> > KA#4> > K<#/> > K7#*> > K2 %> > K-  > > K( > > K# @> > K P> > K h > > K x> >  K > `  K `` "`> @ J   " >  > > J   4J! 4J! 4> J!( `!->  > J!8  @ 6 8> !P '> %>   `h` Jɐ @   8 "1 T> J!p 8 @ 6) T> !'>  <   > !`h D   ?> !h@J 8`@    T`> J!J `> J!  > J!  > Jy!  > Js!  > Jm!  > Jg!  @> Ja"  > J[" !> JU"  "> JO"0 $> JI"@ (> JC"PJAX X 2;> ``2@> "XJ2㿀 "B  "1  + 0 " 0 !"~  "V 0 ` `h! " `h   2 `h"! `ha "a$&@ &`&`l&`    Y`  @ `h"  Y`  @`h" ` *  `h ,`!"  ` `f  c  `X@  @`2`h0W U  X`  @  X`  `h*` 2!  X֒`  @  XВ`  `h*` 42! 1`l  ?2&`l`l 2&  d   &`l> Gې"@  d@?`l"``l&@"`l" `l"`l"``h`l!$"`l`h "a$  X`  @`l"    X`  @ < 4`2@  `l 2(  d |  &`l> G"@ Q d@?`l"``l&@"`l" `l"`l"``h`l!$"`l`h "a$`l"   XL`  @``l"`l"   `X>@ ,   `l*@   " `l " `  `X(@ ,   `l*@ `  "> bclU \&`d }   X` `d @ ?  @ \    2`d> G&"Us \%X`lX`"`l"`` % &`d` `U_ \&`d"   Wܒ`    %`% @  %  %  % %   `@W ` @ ' ' ' `' #' @ @W `` 5  `@W ```5 @* @W  ``  2`  2`  ג@Wi`  π %`% @  %  %  `WQ@ ` @   ?%  @ 0  "  B 0" <   `W/@ ` 1%  @W%   W `*`@  % `@W ` @W `*@ W `*` @W `*` % "  @"  B >@ `V@ ` @3%  @Vݐ   Vא `*`@ !%  `@Vː ` @VŐ `*@ V `*` @V `*` %@` "@ @ h *@%% %쀢 9   `V@ `  ~? %`@% @  % !%   `Vx@  @  `Vq@ ` *` 54 * 54耢  耢  @ %8  `VU@  @  `VN@ ` *` , %<%@~%D2,  %8  `V;@  @  `V4@ ` *` , %<  `V(@  @  `V!@ ` *` , %DR%@ `V@ ` @   %8`ha r2a  ` 66 28`ha 2a8 @. \ <  `U@  *`N%  `Uے@  @  `UԒ@  *`8 2   `UȒ@  @  `U@  @ *`  U@  *`  `@U ` @U `* @U `*` @U , %@<" `ha 2a\ @  `U@  *`N%  `Ut@  @  `Um@  *`8 2   `Ua@  @  `UZ@  @ *`  UQ@  *`  `@UG ` @UA `* @U: `*` @U3 , %@@" \  D  `U"@  *`N%    `U@  @  `U@  *`8 2   `U@  @  `T@  @ *`  T@  *`  `@T ` @T `* @Tې `*` @TԐ , %@D"8`@خ 䀢 / +  `T@ `  q %b%  $% (%   %T    @T  ` 㿘9> c#    ` !P2!R@2?#@`!P?2!@`@ Ґ 2!D "@  2|`@#> b#<`!!X>  E."Ȓ!@@ +>  '> %> 쀤`"E E``  `Eb!X"&!\`" `X  2`X  2&!\&!X # d \ $  3 \Q$`X`X"$$   #Q d$$ \   ` \Qq$`X`X"$$!\"&!\\ > dd   @@  `2   `  㿘! @ 㿘 "X>Ȓ  & 0@ > #D 㿘"X0 "X aR%b 5 =    㿘"X 0@㿘"X㿐 &bX ΐ "8> DE#(8`" > D>#H `> D8#%b ahal  2  b@0 4@ 2  > D#0`  b@0 4@ > D #b@bD&a&b     b@bT > C#0<> bH#CbL%b %t%V .b>  >ؐah 2 .b> 2 > B# >&b8> Ș  ؖ &`0> C (> C H ڔ㿘 "X  `0`4"T"X"@ 0 €4㿘 LH /f`* '` `"80>"X"X>  & 00 @26"X5 0"XH 0 㿘 2     @ `R@  @.@  `R@ ` @`,   㿘?# #>  !@`P@ `P   ""`P`& "#" "@  2@  2`P @2  G  $ 㿐&b  .%> '>  ``     " BP XBx X   `0b `4@   > BҐ" X 2 2b> BȐ"#?b&b&b&a&ahp > B# b &bpb   fb̀ > B#00   XbȀ > B#Pb> b#pB  GV ,?c* %> !@P@ P   "!P`"`" "  " @ 2 @   P`  `"``@ H0 @\G $H > B2#vb"` `@  `@  `@G` "a@Y 2\b>>>>>> `Ж#К`| &b&b&bx&b|&b&b&ba *a ` P2b ` p2b>>>>!̒ahD&b&b&bx&bb? >>>>>>"bȖ!bt&b&b&bx&b|&b&bb>> # ߖ &b> AƐ#> AÐ#  b `0`4bb `0`4b(bВ 0 €4?&b́㿘"̀? & "а  `0`4"" `0`4""В" 0 €4㿘 8H /f`* '` `"80""> t &"0 @26"""БH 0 㿘 "> U &""> #A7 㿘"""Ёp` B "Д   0  4 > #A 1"Ж  0 #\   4؟ >  A " ؒ @. `"Т `0`4 "В 0 €4"      " *@ "  "" p"Д  0  4 >  8@ 0/"Ж   0##\   4؟ >  `@ "Т "* " 2 *"` 04 "В 0 €4㿘>   `# ! "  `" @ 2  ! "   `" @ "$   2 `  ?# " 2   @ "  @2     㿘@ 㿘%`&@Րݐ  > @""a` 0@  4 @ @@  > @"N@    @  > ?">@@ > ?"@  @a&a@"o&a&aȀ` &a&a&a`2`d2ao `4`ha  ?<#2>> # ߖ &oj0> #?’` ` `0 `4@  ` 0b @ €4$㿘؀ 0ğ!""$   0 €4" 0 €4PÐHF0> #8? 㿘 0H /f`* '` `"80!!"> t &/m0 @26*!!ؠ" &! /H 0 @@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   &    "  $*0 ` + +    "* 2"* @(*`  *02 @"@ @b 㿐  `   ` @``>  L b    ?2    *2@ 2  &  4 @     `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*㿘  `   `  @  ` " @ ` ?  2  H;j&. cv" "" " " " 㿘 . 2  ?&   &  6 @"@   & @@C  ?@? @ ? @  &@x@㿈> #' @>``2  ?7 x 8" > d`   @(  @^ Xc > %#PP    @'@"'5ک/@ @  x@@@ 0`(` @/@:1@ #V@@@ 7`/`    ۺ@)@@ @ 7 /  Ĕ(@0os@ "@ 1 )  /@ @ =_#@ @@ 0`(` @̔/@@ "*@@@ 7`/`  @Д)@* @ "@ 7 /  Ԕ(@?Q@ !@ 1 )  ؔ/@ `&@  ؂@@@ 0`(` @ܔ/@"=@ #@@@ 7`/`  @)@?֒@ #@ 7 /  (@"W5@ #@ 1 )  /@ @ !"@@@ 0`(` @/@?f@ !@@@ 7`/`  @8 @)P@ #@  7 /  8 m@  !@ 1 )    =!b@ @@@ 0`(` @ @0,@ #@@@@ 7`/`  @(@@ @ "Q@ 7 /  /@:m@ #@ 1 )  / 5Ē@  ]@@@ 0`(` @)@@  S@@@ 7`/`  @(@@6(y@ "@ 7 /  9#ȸȔ/@@ @ 1 )  / xs@ !@@@ 0`(` @)@0@ #ֺ@@ @ 7`/`  @(@@=5C@ !@ 7 /  /@V@  @ 1 )  / *x@ !@@@ 0`(` @)@@ ?;#@ @@ 7`/`  @(@@@ "ٸ@ 7 /  /@#J@  @ 1 )  ?@!B@@@ 0`(` @@!}@"@@@ 7`/`  @@gX@!"@ 7 /  ?yN@ @  1 )  )/@"D@@@ 0`(` #@@Ȓ@@@@ 7`/`  @@=Ғ@#`@ 7 /  /@ p@ 1 )   &ߒ@"Ƃ@@@ 0`(` @@:I@#@@@ 7`/`  @@5;̒@ @ 7 /  "@!@ 1 )  6u4@ 9@@@ 0`(` @@9@!@@@ 7`/`  @@蟒@ @ 7 /  1+@"e@  1 )  1= HbD@ @0`(` @0@ʿc@ @7`/`  @7@*@c  7 /  7?$@`9 1 )  1V֐aÐ@ @0`(` @0@#3`@ @7`/`  @7@?@`} 7 /  7!a@aѐ 1 )  1bO@ @0`(` @0@?9b@ @7`/`  @7@(P@c 7 /  7@a 1 )  Ȑ1=ߐb @ @0`(` @0@/Nb5@ @7`/`  @7@ b@  7 /  :ᴐ7c@ 1 )     @& & & & @> @  `*@ 0* @*  @* `      +` *`  (*  ! `   @* * @ * ** 8㿘 '> G    &&@"  @ @9`.$> 9#h?٤!> 9#h?0Р @> > > 9#p0Ő#x9|. J@   J@J`  ?*  8 B  ?*@    2@* *@ 㿘  `  `  @/# @*   & &@&&`H=H9`"   ` 㿘?#@6 6`H ` : & $ @$@&@ HH2   *  , " 4  "@ ,  4 `@ -` 5``@`  @@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  'D'H'L'P'T'X2J  J@ `2J 㿐@"  `  ?2  㿘@  H 'T> d!(@[ T ;9?T2 7耦(7耢 2: - 4`44`44`4`ؤ45 5 ȕ4'5 5  A'7' `@#`@`*  @@`*  @@`*  @T  @T :-`-2 ,`- ֓2`    `" ` '``? '8  đ. ?2@ Đ"  * c'Ā@ '.` @ '   @ @?  7 / @   7@', @@8 '*F 2 . 2, @ ( ?#   ?;@#..  ?F$$6`6'@  @"6``4@  *. ?  @26`@4@2@ / T$   . " @?* :@ @2. 4@*  *`@ T:@̑* Τ Г*`@  +    ?( 8 2 + ( 2@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  ?* 㿘 `"@ J@ "@ 2N@@  @ *@`N &*@ J "  * 4 ?: :  *2@ :    4  * *  @    2J@ "J`  2J@   88 @@ @   `@ @ "`"  ?*@    2@* *@    (+  2 2 " 2+J " ?+ @ @ ` ``z  @Z( 2 "" 2 @  &H/ /!?"@! "!H  H/ /!?"@"!H  㿐 $!'! ` `'?  @  ?   !  $!$!$!! @$! 㿈@` $` `2`C  .,`  '@ $ $  !* 2$ ! "!  $ ! " ,  $  , "   $  * `$ >ɔ 2` > "  `$  㿘``@   㿀@ '?'''@Β '” > @  p$'*`  , `*` ,@$@$` " >R>  xL@ /s `@?L /2? @ ''', '@' ] /3, @ '''''1 N''l'h'''h Ao 7gx /@ `@`$ `'@ $@=  ' ?> ' ` x0x    @ 2  *@  22" =!` = 8 "(> # t'@ ݔ )c@ "O |  b@ ":  @"? O?@ "" hJ?@ .!> d |@ ??@ :? ` @` @5 `@"  )`@&`}@*&? `@y`u@"?  j!0?" . j!0?" .`.`@ .6  ' ' ' ' ' ' ' ' ' N'䀢'耢> d!ȓ* 'N4 '耢> d!ȓ* '/@/V?c?  & t@@  @     . . . . . . ** * * . *N  * * * **** . . . . . z. ' ' ' ' ' ' ' ' ' '@n'  ~@ "8  }@ @ ?# *` * * *& t@9 `#@B: &> d!,`0> !17 ,  %& '`& `b^Ř &     2 4c&? c > u!(㿘` @ ````  "  @ ! 2  $2 "   " `t # ` 2@@` 2 `2, @ @  @(0(0> d a, > !80 t@``` ` `" ? `"  l" `@ @** ߀` * , :`$ >! `@"    * * @?  @#  @" <" @ "`"@"`"`  t@`` ` " "*@*" " @2 wh @@` (0*   `  @`*  `` ` @@"`"@"`"` 'H`@ 'l'd'h `(<  > `  `-p @8@*  ` `z d`  d''''''''耢? d 'd`ؖlhd o%@`k dRh N 4I`@D`$@`;'h`7  42`2@뀤`0+2=    D  "!  ` h ? 'h D$@` h `@̀ ` l "z` dH:d `  `  אے  2@ "` 2` 2`  2`  2` 2` 0? 4"`"` "` "`  ("`( @"`0 <"`4 D"`8 H"`<㾰@ D'8''4''<  K  X’`9 @㾰@ '8''4''<א  Β)  X`9͔ @ @ 2 0  $ 0 ` 0 ,?`$ 0k 0Xz `9 @㿈`@: '?㿈`@: '?͜x``@: '?'ɓ&㿈`&@'''V N` հ  @ 'x` 2`( 'x'|| <  'x`` '''`' '''' |?X`@ 't ؖ n 'x@: `%@8؄????'''  ' | K 'x :` Ȕ$    *  'x'x댒 | ԁx`G`耢@x> %!Ȁ`ؐ????|@x 2v|x )`耢@2` | @ "`  X`< "` ` '| | "(b:` T|t8 `'x"@& 0" 0`, x K`0xh@``` 0& 0#``'`'` ''N` `'`''OՔ ` `'`''P`@``` 0-`  0(` `'`''Sn` `'`''S`'S4 ` `'`''UX@``` 05`$ 00` `'`''IՔ&``''Jg``'`'` ''JΒ``'`'` '`''K㿈@ '''b㿈` @'''L㿘`  6`>6 && & &&&&  &$&  9 (D&(,<&,0 8&0TL8 Z8 ZH> #@ @''''''{ 2= X``D` 2 `7k! > !㾈> #'@ 2'#`( X``D``0?"`0`,   `0 #o`70!# > N!㾐> #`> `b\b\'@ 2  9 />  X `(!6  D ` )6! av\ΐ` $ &&g#& # > !؁> B` "x`> " `J `@'` ''''`  '`   '` ! '` ( '``: '?Jh؁㿈` ''@#\  S 㿈   ` '@#\ A > #P'> b 쾰> bp칔 > b 촐> J#ϖ#> J(2  J J* ) * JJ#2 J J* :  b*{ @6 # > 4" 㿀> #') ` 5  " `75   # >  "8㿀> #' `5ɔ  2 `75Ɣ   # > "P㿀> #' `5  2 `75   # > "pp` ` `'''@''Ԙ''' 㿘`  "` 8` 5b  7#3 (`*` D ` @'*5G `@'쀢`   ``56 ֒ p`` ` ''@''Ԙ''''g؁8` 5   (#$ (`*`  4*  ` '@;'珒 㿐@`(  *`  '#'@ * @` '#'`4Ȕ 㿀`4    : :`?@? > 8" > < "㿈` ''@#\  k p` 4  @?# @"?`"` + -0% -0"4`, -07!? -0 ``2`  ''''#\' ܘ o s` ` `` ?'#\  `  '#\ ܘ Eš V` '#\ ܘ  J%> \ `> \!x P `P& > b$@jː  `& $> b$@_ $ `$> 5$@aS `$` `' ܀8'ܐ3 ܀ ````3?  &``3Ք 㿘= @> " < 㿈0   ` '@#\  vm_map_lock_read: intrsafe mapirqfunctionsocketcontrollerdrivevectmuxconsoleoffsetslotluntargetphychannelleveladdrgifsystraceksymsccdvndtbptygrevlanbridgeenctunsppppppslbpfilterlooppfsyncpflogpfPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sTarget %d Loop ID 0x%x (Port 0x%x) => Loop 0x%x (Port 0x%x)Target %d duplicates Target %d- killing off bothRetaining Loop ID 0x%x for Target %d (Port 0x%x)Retained login of Target %d (Loop ID 0x%x) Port 0x%xLogging out Target %d at Loop ID 0x%x (Port 0x%x)Command Error in PLOGI for Port 0x%x (0x%x)Could not get PDB for Device @ Port 0x%xPDB Loop ID info for Device @ Port 0x%x does not match up (0x%x)PDB Port info for Device @ Port 0x%x does not match up (0x%x)Target %d (Loop ID 0x%x) Port 0x%x dumped after login info mismatchNot RESPONSE in RESPONSE Queue (type 0x%x) @ idx %d (next %d) nlooked %dHBA attempted queued transaction with disconnect not set for %d.%d.%dHBA attempted queued transaction to target routine %d on target %d bus %dHBA attempted queued cmd for %d.%d.%d when queueing disabledSCSI phase skipped for target %d.%d.%dLoop ID %d, AL_PA 0x%x, Port ID 0x%x, Loop State 0x%x, Topology '%s'Fabric Nameserver rejected %s (Reason=0x%x Expl=0x%x) for Port ID 0x%x(%d.%d.%d): FIN dl%d resid %d STS 0x%x SKEY %c XS_ERR=0x%x%s CHAN %d FTHRSH %d IID %d RESETD %d RETRYC %d RETRYD %d ASD 0x%x%s RAAN 0x%x DLAN 0x%x DDMAB 0x%x CDMAB 0x%x SELTIME %d MQD %d%s CHAN %d TGT %d FLAGS 0x%x 0x%x/0x%xGeneratedNVRAMbad underrun for %d.%d (count %d, resid %d, status %s)????21002200230023121240bus %d is in %s Mode128010801016012160LVDDifferentialSingle-Endedunknown mode on bus %d (0x%x)Unknown Chip Type 0x%x10201020A10401040A1040B1040CDifferential ModeUltra Mode Capablechip reset timed outMBOX_BUSY never cleared on resetRegister Test Failed (0x%x 0x%x 0x%x 0x%x 0x%x)F/W download failed at word %dRam Checksum Failureskipping f/w downloadBoard Type %s, Chip Revision 0x%x, %s F/W Revision %d.%d.%dloadedresidentFirmware Attributes = 0x%xInstalled in 64-Bit PCI slotLast F/W revision was %d.%d.%d%d max I/O commands supportedCannot setup DMAfailed to set active negation state (%d,%d), (%d,%d)failed to set tag age limit (%d,%d)Enabled FW features (0x%x)Initiator ID is %d on Channel %dInitial Settings bus%d tgt%d flags 0x%x off 0x%x per 0x%xbad frame length (%d) from NVRAM- using %dbad maximum allocation (%d)- using 16bad execution throttle of %d- using 16Setting ICB Node 0x%08x%08x Port 0x%08x%08xNot using any WWNsisp_fibre_init: fwopt 0x%x xfwopt 0x%x zfwopt 0x%xisp_fibre_initF Port (no FLOGI_ACC response)F PortN-Port to N-PortFL PortPrivate LoopFirmware State <%s->%s>usec%d: 0x%lx->0x%lx enano 0x%x%08x2Gb link speed/sisp_fclink_testConfig WaitWaiting for AL_PAWait LoginReadyLoss Of SyncErrorRe-InitNonparticipating?????isp_pdb_syncgiving up on synchronizing the port databaseRemap Overflowisp_scan_loopNo LoopFailed to allocate IOCB bufferFailed to allocate XCB buffertimeout or transmit failedno fabric loopremote device not a target%xSNS Failed- %sisp_fabric_mbox_cmdGID_FTGPN_IDGNN_IDfabric too big for scratch areaisp_scan_fabricRegister FC4 types succeededisp_register_fc4_typeAdapter not at RUNSTATEunsupported cdb length (%d, CDB[0]=0x%x)Target %d does not have target serviceRequest Queue OverflowRequest Queue Overflow+out of xflist pointersSTART cmd for %d.%d.%d cmd 0x%x datalen %ldisp_startUnknown Control Opcode 0x%xdriver initiated bus reset of bus %dTarget %d on Bus %d Reset Succeededcannot find handle for command to abortMbox Command Async (0x%x) with no waitersinterrupt (ISR=%x SEMA=%x) when not readyoptr %x soft optr %xResponse Queue Out Pointer Unstable (%x, %x)bogus intr- isr %x (%x) iptr %x optr %xQueue Entrycontinuation segmentinternal queues fullbad header flagbad request packetunknown flags (0x%x) in responsebad request handle %d (type 0x%x, flags 0x%x)cannot find handle 0x%x (type 0x%x)cannot find handle 0x%x (status 0x%x)asked for %ld got resid %ldRequest Queue Entry bounced backunhandled response queue type 0x%xisp_intrAsync Mbox 0x%xRequest Queue Transfer ErrorResponse Queue Transfer Errortimeout initiated SCSI bus reset of bus %ddevice reset on bus %dextended message underrunSCAM interruptstalled SCSI Bus after DATA OverrunSCSI Bus reset after DATA OverrunTransition to LVD modeTransition to Differential modeTransition to Single Ended modeTransition to Unknown Mode 0x%xFast Posting CTIO doneLIP destroyed %d active commandsPoint-to-Point modePoint-to-Point -> Loop modeLoop -> Point-to-Point modePoint-to-Point -> Loop mode (BAD LIP)FATAL CONNECTION ERRORLooped Back in Point-to-Point modeUnknown connection mode (0x%x)Unknown Async Code 0x%xfast post completion of %uIgnored Continuation ResponseUnhandled Response Type 0x%xSelection Timeout for %d.%d.%dcommand incomplete for %d.%d.%d, state 0x%xDMA error for command on %d.%d.%dstates=>%s GOT_BUS%s GOT_TGT%s SENT_CDB%s XFRD_DATA%s GOT_STS%s GOT_SNS%s XFR_CMPLT%s status=>%s Disconnect%s Sync_xfr%s Parity%s Bus_Reset%s Device_Reset%s Aborted%s Timeout%s Negotiation%stransport error for %d.%d.%d: %sbus reset destroyed command for %d.%d.%dcommand aborted for %d.%d.%dcommand timed out for %d.%d.%ddata overrun for command on %d.%d.%dcommand overrun for command on %d.%d.%dstatus overrun for command on %d.%d.%dmsg not COMMAND COMPLETE after status %d.%d.%dNo MESSAGE OUT phase after selection on %d.%d.%dEXTENDED IDENTIFY failed %d.%d.%dINITIATOR DETECTED ERROR rejected by %d.%d.%dABORT OPERATION rejected by %d.%d.%dMESSAGE REJECT rejected by %d.%d.%dNOP rejected by %d.%d.%dMESSAGE PARITY ERROR rejected by %d.%d.%dBUS DEVICE RESET rejected by %d.%d.%dIDENTIFY rejected by %d.%d.%d%d.%d.%d had an unexpected bus freemarkednot markedInvalid IOCB entry type detectedinternal queues full for %d.%d.%d status 0x%xAuto Request Sense failed for %d.%d.%dWide Negotiation failed for %d.%d.%dSDTR Message failed for target %d.%d.%dBad LVD condition while talking to %d.%d.%dport unavailable for target %dport logout for target %dport changed for target %dport busy for target %dUnknown Completion Status 0x%xisp_parse_statusCommand for fast post handle 0x%x not found?????OOOO?GET NOST DATASET HOST DATAGET DATA OVERRUN RECOVERY MODESET DATA OVERRUN RECOVERY MODEGET TARGET MODE STATEENABLE TARGET MODEEXECUTE IOCB A64INITIALIZE RESPONSE QUEUE A64INITIALIZE REQUEST QUEUE A64DUMP RAM A64LOAD RAM A64GET FIRMWARE FEATURESSET FIRMWARE FEATURESSET SCAM CONFIGURATIONGET SCAM CONFIGURATIONGET SYSTEM PARAMETERSET SYSTEM PARAMETEREXEC BIOS IOCBWRITE FOUR RAM WORDSRETURN BIOS BLOCK ADDRSET RESET DELAY PARAMSSET DEV QUEUE PARAMSSET TARGET PARAMSSET PCI CONTROL PARAMSSET ASYNC DATA SETUP TIMESET ACT NEG STATESET CLOCK RATESET TAG AGE LIMITSET RETRY COUNTSET SELECT TIMEOUTSET INIT SCSI IDGET RESET DELAY PARAMSGET DEV QUEUE PARAMSGET TARGET PARAMSGET PCI PARAMSGET ASYNC DATA SETUP TIMEGET ACT NEG STATEGET CLOCK RATEGET TAG AGE LIMITGET RETRY COUNTGET SELECT TIMEOUTGET INIT SCSI IDGET FIRMWARE STATUSGET DEV QUEUE STATUSABORT QUEUESINGLE STEP QUEUESTART QUEUESTOP QUEUEBUS RESETABORT TARGETABORT DEVICEABORTSTOP FIRMWAREWAKE UPEXECUTE IOCBINIT RESULT QUEUEINIT REQUEST QUEUECHECK FIRMWAREABOUT FIRMWAREVERIFY CHECKSUMMAILBOX REG TESTREAD RAM WORDWRITE RAM WORDDUMP RAMEXEC FIRMWARELOAD RAMNO-OPO/!OO1OOLun RESETSEND LFAGet ID ListINITIALIZE IP MAILBOXSET VENDOR IDGET PORT/NODE NAME LISTLOGIN LOOP PORTINIT LIP LOGINFABRIC LOGOUTSEND CHANGE REQUESTFABRIC LOGINSEND SNSINIT LIP RESETGET LINK STATUSGET PORT NAMEGET FW STATEABORT TASK SETCLEAR TASK SETTARGET RESETCLEAR ACAGET PORT DATABASEGET FC-AL POSITION MAPINIT LIPINIT FIRMWAREGET/SET DATA RATEDRIVER HEARTBEATGET PORT DATABASE,, ENHANCEDREQUEST NON PARTICIPATING MODEGET RESOURCE COUNTSLOOP PORT ENABLELOOP PORT BYPASSSET PORT QUEUE PARAMSSET FIRMWARE OPTIONSGET PORT QUEUE PARAMSGET FIRMWARE OPTIONSGET LOOP IDREAD RAM WORD EXTENDEDUnknown Command 0x%xno parameters for 0x%xopcode %xINVALID COMMANDHOST INTERFACE ERRORTEST FAILEDCOMMAND ERRORCOMMAND PARAMETER ERRORLOOP ID ALREADY IN USEPORT ID ALREADY IN USEALL LOOP IDS IN USETIMEOUTerror 0x%xMailbox Command '%s' failed (%s)isp_mboxcmdskipping target %d bus %d updatebus %d set tgt %d flags 0x%x off 0x%x period 0x%xUsing Node WWN 0x%08x%08xUsing Port WWN 0x%08x%08xisp_reinit cannot reset cardisp_reinit cannot restart cardinvalid NVRAM header%x %x %xinvalid NVRAM checksumversion %d NVRAM not understoodisp_read_nvramNVRAM Port WWN 0x%08x%08xNVRAM Node WWN 0x%08x%08xNVRAM: maxfrmlen %d execthrottle %d fwoptions 0x%x loopid %xPolled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sispadded to blocked queueActive Hiwater Mark=%dblocking queueretrying later for %d.%dfinished command on borrowed timerestarting blocked queuewatchdog found done cmd (handle 0x%x)recursive watchdog (handle 0x%x)watchdog cleanup for handle 0x%xwatchdog timeout on handle %xpossible command timeout on handle %xwatchdog with no commandisp_wdogrestarted command for %d.%dblocked cmd again%s for %d.%dCMD_EAGAINCMD_RQLATERrequeued %d commands, 16 bit wide, Tagged Queueing Enabled, 16 bit wide, Tagged Queueing Enabled Bus %d Target %d at %dMHz Max Offset %d%sBus %d Target %d Async Mode%sSCSI bus %d reset detectedLoop DOWNLoop UPTarget %d (Loop 0x%x) Port ID 0x%x role %s %s Port WWN 0x%08x%08x Node WWN 0x%08x%08xTarget/InitiatorInitiatorTargetNoArrivedDepartedName Server Database Changed N_Port NL_PortF/NL_Port Nx_Port F_port FL_Port E_port%s Fabric Device @ PortID 0x%xout of space for fabric devicesInternal Firmware Error on bus %d @ RISC Address 0x%x%s: espFAS366/HMEAM53C974FAS216FAS408ESP406NCR53C96NCR53C94ESP200ESP100AESP100out of memory %s: unknown variant %d, devices not attached : %s, %dMHz, SCSI ID %d %s: unknown revision code, assuming ESP100 %s: resetting SCSI bus [NCR_INIT(%d) %d] ncr53c9x_ecbregs[intr=%02x,stat=%02x,step=%02x,stat2=%02x] [ncr53c9x_select(t%d,l%d,cmd:%x,tag%x,%x)] SELATNS [ncr53c9x_scsi_cmd] [0x%x, %d]->%d [ncr53c9x_poll] [ncr53c9x_poll: rescheduling] [ncr53c9x_sched] ncr53c9x_sched: not IDLE (state=%d)ncr53c9x_sched: tag alloc failure%d:%d busy requesting sense [ncr53c9x_done(error:%x)] %s: QFULL -- throttling to %d commands resid=%lu sense=0x%02x error=%d ncr53c9x_dequeue: lun %qx for ecb %p does not existncr53c9x_dequeue: slot %d for lun %qx has %p instead of ecb %p[flushfifo] ncr53c9x_rdfifo: bad flag [rdfifo %s (%d):startcont %02x] [wrfifo(%d):%s: reselect with invalid selid %02x; sending DEVICE RESET %s: reselect from target %d lun %d tag %x:%x with no nexus; sending ABORT ncr53c9x_sched_msgout %x %d [ncr53c9x_msgin(curmsglen:%ld)] %s: msgin: no msg byte available %s: phase change, dropping message, prev %d, state %d gotmsg(%x) state %dcmdcomplete got %ld extra bytes msg reject (msgout=%x) %s: tagged queuing rejected: target %d (rejected sent tag)%s: sync transfer rejected: target %d %s: wide transfer rejected: target %d noop TAG %x:%xdisconnect save datapointer restore datapointer extended(%x) SDTR period %d, offset %d async mode max sync rate %d.%02dMB/s %s: wide mode %d unrecognized MESSAGE EXTENDED; sending REJECT ident unrecognized MESSAGE; sending REJECT %s: TAG reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: reselect without IDENTIFY; MSG %x; sending DEVICE RESET %s: unexpected MESSAGE IN; sending DEVICE RESET [ncr53c9x_msgout(priq:%x, prevphase:%x)]%s at line %d: unexpected MESSAGE OUT phase %s at line %d: no nexus [ncr53c9x_intr: state %d] %s: SCSI bus reset %s: nexus in reset state%s: illegal command: 0x%x (state %d, phase %x, prevphase %x) %s: DMA error; resetting %s: !TC on MSG OUT [intr %x, stat %x, step %d] prevphase %x, resid %lx %s: !TC on DATA XFER [intr %x, stat %x, step %d] prevphase %x, resid %x %s: SCSI bus parity error sync nego not completed! %s: unexpected disconnect; resetting sending REQUEST SENSE %s: waiting for SCSI Bus Reset to happen %s: target didn't identify <>%s: target didn't send tag: %d bytes in fifo [%d] backoff selector %s: RESELECT: %d bytes in FIFO! [intr %x, stat %x, step %d, prevphase %x] selid=%2x %s: identify failed, state %d, intr %02x ncr53c9x: no nexus%s: step 1 & !NEG %s: !MSGOUT (%s:%d:%d): selection failed; %d left in FIFO [intr %x, stat %x, step %d] (%s:%d:%d): select; %lu left in DMA buffer [intr %x, stat %x, step %d] %s: unexpected status after select: [intr %x, stat %x, step %x] %s: stray interrupt %s: ICCS: : [intr %x, stat %x, step %x] %s: can't get status, only %d bytes %s: STATUS_PHASE: msg %d %s: invalid state: %dncr53c9x no nexusMESSAGE_OUT_PHASE MESSAGE_IN_PHASE %s: MSGIN: unexpected FC bit: [intr %x, stat %x, step %x] %s: MSGIN: weird bits: [intr %x, stat %x, step %x] COMMAND_PHASE 0x%02x (%d) DATA_OUT_PHASE [%ld] DATA_IN_PHASE STATUS_PHASE %s: unexpected bus phase; resetting DMA active%s: timed out [ecb %p (flags 0x%x, dleft %x, stat %x)], AGAIN sync negotiation disabled $ # $ %$ $ $$ & $ '@@$ x&$ p(100-T4mii100-FX100-TXbncreservedauiutp#%$&'&(ep address %s , wrote %x to TX_AVAIL_THRESH, read back %x. Interface disabled warning: unknown chipset, possibly 3c515? /%s (default %s) (unknown/impossible media) default %s%s/autoselect%s: media_status on unknown chipset 0x%x epstart: no header mbuf%s: device timeout %s: eeprom failed to come ready %s: erase pencil mark, or disable PnP mode! wi$$$$p$X$@$($$$ $ $ $ $ $$$p$p$p$p$P$P$P$P$8$8$8$8!$ "$ #$ $$ PRISM3 ISL37300P(PCI)PRISM3 ISL37300PPRISM2.5 ISL3874A(PCI-bridge)PRISM2.5 ISL3874A(Mini-PCI)PRISM2.5 ISL3873PRISM2 HFA3842(EVAL)PRISM2 HWB3163(EVB2) SST-flashPRISM2 HWB3163 SST-flashPRISM1 HWB1153PRISM2 HFA3842(EVB3)PRISM2 HWB3163 rev.BPRISM2 HWB3163 rev.APRISM2 HWB3763 rev.BPRISM2 HFA3841(EVB2)Lucent Embedded WaveLAN/IEEESony WaveLAN/IEEELucent WaveLAN/IEEE: unable to read station address address %sWaveLAN/IEEE nodeIBSS %s: received packet of unknown type on port 7 %s: received packet on invalid port (wi_status=0x%x) %s: oversized mgmt packet received in hostap mode (wi_dat_len=%d, wi_status=0x%x) wihap: failed to copy header %s: oversized packet received (wi_dat_len=%d, wi_status=0x%x) %s: Error decrypting incoming packet. wi_rxeof%s: wi_cmd failed with %d %s: init failed %s: invalid data path: %x %s: failed to allocate %d bytes on NIC %s: unsupported crypto algorithm %d wi_ioctl%s: tx buffer allocation failed %s: mgmt. buffer allocation failed w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-wi_do_hostencrypt%s: wi_do_hostdecrypt: iv mismatch: 0x%02x%02x%02x%02x vs. 0x%x wi_do_hostdecrypt%s: wi_start: dropping unassoc dst %s %s: host encrypt not implemented for 802.3 %s: wi_start: xmit failed %s: wi_mgmt_xmit: xmit failed %s: device timeout Unknown PRISM2 chip %s: Firmware %d.%02d variant %d, %s: %s%s, Firmware %d.%d.%d (primary), %d.%d.%d (station), Symbol put_rateswihap_init: sc=0x%x whi=0x%x Sending disassoc to sta %s Sending deauth to sta %s wihap_shutdown: sc=0x%x whi=0x%x wihap_shutdown: FREE(sta=0x%x) wihap_timeout: disassoc due to inactivity: %s wihap_timeout: deauth due to inactivity: %s wihap_auth_req: station %s algo=0x%x seq=0x%x wihap_auth_req: new station challenge: 0x%x 0x%x ... wihap_auth_req: algorithm unsupported: 0x%x wihap_auth_req: returns status=0x%x wihap_assoc_req: from station %s wihap_assoc_req: bad ssid: '%.*s' != '%.*s' wihap_assoc_req: rates mismatch. wihap_assoc_req: capinfo: not ESS: capinfo=0x%x wihap_assoc_req: WEP flag mismatch: capinfo=0x%x wihap_assoc_req: polling not supported: capinfo=0x%x wihap_assoc_req: already assoc'ed? wihap_assoc_req: returns status=0x%x wihap_assoc_reqwihap_deauth_req: unknown station: %s wihap_disassoc_req: unknown station: %s wihap_mgmt_input: len=%d MGMT: assoc req: assoc resp: reassoc req: reassoc resp: probe req: probe resp: beacon: ann traf ind disassociation: auth: deauth: unknown (stype=0x%x) ftype=0x%x (ctl=0x%x) wihap_data_input: no TODS src=%s wihap_data_input: incorrect bss: %s wihap_data_input: dropping unassoc src %s wihap_ioctl: i shouldn't get other ioctls! leam7990_config: weird memory size %d: address %s %s: %d receive buffers, %d transmit buffers am7990_config: can't establish shutdownhook%s: controller failed to initialize %s: overflow %s: receive buffer error %s: dropping chained buffer %s: transmit buffer error %s: underflow %s: excessive collisions, tdr %d %s: memory error %s: receiver disabled %s: transmitter disabled %s: device timeout missing buffer, no_td = %d, last_td = %d ne%s: where did the card go? %s: setup failed ne2000_attachne2000_detectne2000_write_mbuf: negative lenne2000_write_mbuf: data != lim%s: remote transmit DMA failed to complete @@ /dev/ksyms: Symbol table not valid. ELFfailed to allocate memory for /dev/ksyms pf: state insert failed: tree_lan_ext lan: gwy: ext: pf: state insert failed: tree_ext_gwydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf.cstate->timeout < PFTM_MAXpeerpeer->state == cur->statepf_purge_expired_statespf_dynaddr_update%u.%u.%u.%u:%u:%x[%u]TCP UDP ICMP ICMPV6 %u [lo=%u high=%u win=%u modulator=%u wscale=%u] %u:%uFSRPAUEWinvalid address type: %d pf_change_appf_change_a6pf_change_icmppf_map_addr: selected address: pf_map_addrpf_get_sportPF_STEP_INTO_ANCHORPF_STEP_OUT_OF_ANCHORpf: NAT proxy port allocation (%u-%u) failed pf_get_wscalepf_get_msspf_calc_msspf_test_tcppf_test_udppf_test_icmppf_test_otherpf: loose state match: seq=%u ack=%u len=%u ackskew=%d pkts=%d:%d pf: BAD state: seq=%u ack=%u len=%u ackskew=%d pkts=%d:%d dir=%s,%s inoutfwdrevpf: State failure on: %c %c %c %c | %c %c pf_test_state_tcppf_test_state_udppf: ICMP error message too short (ip) pf: ICMP error message too short (ip6) pf: ICMPv6 short opt pf: ICMP error message too short (tcp) pf: BAD ICMP %d:%d -> state: seq=%u pf: ICMP error message too short (udp) pf: ICMP error message too short i(icmp) pf: ICMP error message too short (icmp6) pf_test_state_icmppf_test_state_otherpf_routablepf_route: invalid parameterspf_route: m0->m_len < sizeof(struct ip)pf_route: TAILQ_EMPTY(&r->rpool.list)pf_routepf_route6: invalid parameterspf_route6: m0->m_len < sizeof(struct ip6_hdr)pf_route6: TAILQ_EMPTY(&r->rpool.list)pf_route6non-M_PKTHDR is passed to pf_testpf: dropping packet with ip options pf: IPv6 short opt pffrentpffragpffrcachepffrcentpfstscrdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/pf_norm.cBUFFER_FRAGMENTS(frag)%s: pf_purge_expired_fragmentsexpiring %d(%p) !BUFFER_FRAGMENTS(frag)TAILQ_EMPTY(&pf_cachequeue) || TAILQ_LAST(&pf_cachequeue, pf_cachequeue) != fragpf_flush_fragmentstrying to free > %d frents trying to free > %d cache entries LIST_EMPTY(&frag->fr_cache) || LIST_FIRST(&frag->fr_cache)->fr_off > frcache->fr_end*frag == NULL || BUFFER_FRAGMENTS(*frag)frep != NULL || frea != NULLpf_reassembleoverlap -%d adjust overlap %d missing fragment at %d, next %d, max %d %d < %d? frent != NULLdrop: too big: %d complete: %p(%d) *frag == NULL || !BUFFER_FRAGMENTS(*frag)pf_fragcachefragcache[%d]: new %d-%d frp != NULL || fra != NULLfragcache[%d]: dead (%d-%d) %d-%d fragcache[%d]: adjacent (%d-%d) %d-%d fragcache[%d]: chop %d (%d-%d) %d-%d (*m0)->m_next == NULL(int)m->m_len == ntohs(h->ip_len) - precutfragcache[%d]: gap %d (%d-%d) %d-%d fragcache[%d]: adjacent %d-%d (%d-%d) fragcache[%d]: chop %d %d-%d (%d-%d) (int)m->m_len == ntohs(h->ip_len) - aftercutfragcache[%d]: gap %d %d-%d (%d-%d) fragcache[%d]: adjacent(merge %d-%d) %d-%d (%d-%d) cur == NULLfragcache[%d]: done 0-%d fragcache[%d]: dropping overall fragment pf_normalize_ipIP_DF mff and %d max packet %d reass frag %d @ %d-%d dropping bad fragment src->scrub == NULLpf_normalize_tcp_initsrc->scrub || dst->scrubpf_normalize_tcp_statefulpftrplpfruleplpfaddrplpfstateplpfaltqplpfpooladdrplpf: started pf: stopped altq: started altq: stopped pfioctlpfrktablepfrkentrypfr_clr_addrs: corruption detected (%d). pfr_add_addrspfr_del_addrspfr_set_addrspfr_tst_addrspfr_get_addrs: corruption detected (%d). pfr_get_astats: corruption detected (%d). pfr_clr_astatspfr_enqueue_addrs: IPv4 walktree failed. pfr_enqueue_addrs: IPv6 walktree failed. pfr_mark_addrs: IPv4 walktree failed. pfr_mark_addrs: IPv6 walktree failed. pfr_lookup_addrpfr_insert_kentries: cannot route entry (code=%d). pfr_reset_feedbackpfr_route_kentrypfr_unroute_kentry: delete failed. pfr_unroute_kentrypfr_walktreepfr_add_tablespfr_del_tablespfr_get_tables: corruption detected (%d). pfr_get_tstats: corruption detected (%d). pfr_clr_tstatspfr_set_tflagspfr_ina_definepfr_commit_ktablepfr_update_stats: assertion failed. pfr_attach_tablepfr_detach_table: refcount = %d. pfr_pool_getpf_osfp_fingerprintfingerprinted %s:%d %d:%d:%d:%d:%llx (%d) (TS=%s,M=%s%d,W=%s%d) 0*%osfp no match against %x osfp matched %s %s %s %x==%x fingerprint 0x%x didn't match pfosfpenpfosfpadding osfp %s %s %s = %s%d:%d:%d:%s%d:0x%llx %d (TS=%s,M=%s%d,W=%s%d) %x TSFound "%s %s %s" instead of "%s %s %s" Couldn't find "%s %s %s" pflog%dpflog_packetpfsync0altq assertion "%s" failed: file "%s", line %d altq assertiontbr_set: no cpu clock available! altq_add: no cpu clockinit_machclkread_machclkinvalid weight value %d for red! use %d wtab_alloc: malloc failed!cbq_add_queue: no parent class! cbq_add_class: borrow class != parent altq: packet for %s does not have pkthdr rmc_init: root class not allocated _rmc_wrr_dequeue_next_rmc_prr_dequeue_nextrmc_root_overlimitaltq: packet for %s does not have pkthdr hfsc_dequeue:altq: packet for %s does not have pkthdr a.out[ %s symbol table has bad start address %p ] [ %s symbol table has bad string table address %p ] [ %s a.out symbol table not valid ] [ %s has bad a.out string table index (0x%x) ] [ using %ld bytes of %s a.out symbol table ] gcc_compiled.???All breakpoints used. Already set. Too many breakpoints. Not set. No breakpoints set Map Count Address %s%p %5d * %-12s? No such command Ambiguous Bad modifier Count missing db_commandMalloc debugging not enabled. calloutprocswatchesuvmexpregistersprocpoolpageobjectmapmallocextentsbreaksallpoweroffreboothaltdumpcrashsynchangmanhelpbootshowpscalltracematchnextuntilccontinuesstepwatchdwatchbreakddeletewwritesetsearchxexamineprintmachine ddb> Bad function Too many arguments Argument missing %#n ELF[ %s symbol table has bad start address %p ] ELFbad magicbad e_machine.strtab.symtabsymtab unalignedsymtab corrupted[ using %lu bytes of %s ELF symbol table ] [ %s ELF symbol table not valid: %s ] : = 0x%lx %-*lr%-*lx%-*lz%-*ld%-*lu%-*lo%c\%03o%*r%*x%*z%*d%*u%*o Bad modifier bhlAddress missing Value missing Count missing Symbol not found Syntax error Divide by 0 Negative shift amount ^R Bad character in number Bad escape String too long Bad character --db_more--  -%#*lx-%*lx-%#*lo-%*lo-%#*lu-%*luFaulted in traceback, aborting... Starting stack trace... End of stack trace. %-12s%#*ln %s+%#lr [after %6d] bsd[ %s symbol table has bad start address %p ] [ no symbol table formats found ] No slots left for %s symbol tableUnable to find symbol table slot for %s.invalid symbol table name%s%s %s Sifting table %s: %s+%s [%s:%d]db_printsymAfter %d instructions (%d loads, %d stores), Breakpoint at Watchpoint at Stopped at RUN AT LEAST 'trace' AND 'ps' AND INCLUDE OUTPUT WHEN REPORTING THIS PANIC! DO NOT EVEN BOTHER REPORTING THIS WITHOUT INCLUDING THAT INFORMATION! linestabstopsmaxwidthmaxoffradixUnknown variable No value ? All watchpoints used. No map. Already set. Too many watchpoints. Not set. No watchpoints set Map Address Size %s%p %8lx %lx * Unknown size %#8n = %#8n Nothing written. 88888 9 7 6 97 5 9 423 9 2 9 1 0 9 9 \/|\/O|/-| () Score: %lu/%lu db_hangmanvm_map_lock_read: intrsafe mapcdlinemicheadphonesspeakeraudio audio: missing method audio: could not allocate play buffer audio: could not allocate record buffer recordmonitorsourceoutputmasteraudioattachauddetaudiodetach: %s didn't detach au_portofaudio_attach_mi: NULL oplmpuaudioprint: unknown type %d%s at %saudio_open: 0 precision audio_drain: copying in progress!?! aud_draud_hraud_rdaudio_silence_copyoutaud_wraudio_write: cc == 0, swcode=%p, factor=%d au_set_gainau_get_gainau_set_portau_get_portaudiosetinfoaudiogetinfovm_map_lock_read: intrsafe mapccdattach: count <= 0WARNING: no memory for concatenated disks ccd%dccdinit: device name too long. ccdinitccdbufferccdintrccdiodone (mirror)%s: error %d on component %d%s ccdiodone: countccdfictitiousdefault labelccdlckMSG_INMSG_OUTUNSPEC2UNSPEC1STATUSCOMMANDDATA_INDATA_OUTncr5380_cmd_timeout: no scsi_xfer %s: cmd timeout, targ=%d, lun=%d ncr5380: scsi data uio requested%s: polled request aborting %d/%d ncr5380_scsi_cmd: polled request, abort failedncr5380_scsi_cmd: poll didn't finishncr5380_done: state=idlencr5380_done: current=0ncr5380_done: dma free did notncr5380_done: sense asked for sense %s: target %d, bad status=%d ncr5380_done: bad statencr5380_sched: not idlencr5380_sched: current set%s: reselected while polling (abort) %s: select found SCSI bus busy, resetting... %s: ptr but no data in/out flags? ncr5380_reselect: current set%s: reselect, BSY stuck, bus=0x%x %s: selected as target, data=0x%x %s: bad reselect, data=0x%x %s: reselect, SEL stuck, bus=0x%x %s: reselect, no REQ %s: reselect, phase=%d %s: reselect, not identify, msg=%d %s: phantom reselect: target=%d, LUN=%d %s: unrecognized MESSAGE EXTENDED; sending REJECT %s: unrecognized MESSAGE; sending REJECT %s: SEND_IDENTIFY while not connected; sending NOOP %s: unexpected MESSAGE OUT; sending NOOP %s: weird MESSAGE OUT; sending NOOP %s: sense phase error %s: aborting, but phase=%s (reset) %s: data phase error %s: too much data padding ncr5380_status: none? ncr5380_machine: state=idlencr5380_machine: no current cmdncr5380_machine: unexpected disconnect. %s: no REQ while aborting, reset %s: no REQ for next phase, abort ncr5380_machine: Unexpected phase 0x%x %s: parity error! %s: reset SCSI bus for TID=%d LUN=%d %s: %d extra bytes from %d:%d %s: Target %d LUN %d stuck busy, resetting... %s: address %s %s: device timeout dp8390_initdp8390_xmit: desync, next_tx=%d inuse=%d cnt=%d new=%ddp8390_xmit: no packets to xmitdp8390_start: no header mbuf%s: length does not match next packet pointer %s: len %04x nlen %04x start %02x first %02x curr %02x next %02x stop %02x %s: NIC memory corrupt - invalid packet length %d %s: warning - receiver ring buffer overrun : failed to clear NIC buffer at offset %x - check configuration %s: device enable failed  "&*.26:>ACEGIKMOQSUWY[]_abcdefghijklmnoppqDqrDrsDstDtuDuvDvwDwxDxxy$ydyyz$zdzz{${d{{|$|d||||}}4}T}t}}}}~~4~T~t~~~~~~~~ ,<L\l|||||||||||||||||||||||||||||||||<<<<<<<<\܆\܅\܄\܃lL, ̂lL, ́tdTD4$ԀĀxph`XPH@80(   !"#$%&'()*+,-./02468:<>AEIMS[gjkhinolmbc`afgdeu@ut@tw@wv@vq@qp@ps@sr@r*."&:>26 UWQS]_Y[EGACMOIK~~~~~~~~~(~8~~~h~x~H~X(8hxHXzzz z`{{{ {`xxx x`yyy y`}P}p}}0}}}}|P|p||0||||@@@@@@@@XHxh8(؁ȁ聘XHxh8(؀Ȁ耘` ` ` ` Ђ0pPЃ0pP****++++(((())))....////,,,,----""""#### !!!!&&&&''''$$$$%%%%::;;8899>>??<<==2233001166774455   jnbfzrJZ镗vm_map_lock_read: intrsafe mapsystrrd%s: attach to %u: %d systracef_ioctlstrprocplstrpolplsystracesystrace_forkdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/systrace.cstrp->proc == p%s: %u: policy %d systrace_answer%s: new, ents %d systrace_policy%s: %d -> pid %d %s: %d: code %d -> policy %d %s: %d systrace_getcwd%s: %u: %p(%lu) systrace_io%s: Trying to detach from %d systrace_detach%s: allocating %d -> %lu systrace_newpolicysystrmsg%s: %p: pid %d -> pid %d systrace_msg_child%s: free %d systrace_msg_policyfreevm_map_lock_read: intrsafe mapvndencryptWARNING: no memory for vnode disks vnd devicefictitiousvndiodonevnd%dVNDIOCSET: device name too long vndioctl: null vpvndlckvm_map_lock_read: intrsafe maparc4maybeinit;n vAMaX ֣d° xget_random_bytesrndrdvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcd9660_lookupvm_map_lock_read: intrsafe mapcd9660_inactive: pushing activecd9660_reclaim: pushing activevm_map_lock_read: intrsafe mapRRIP without PX field? ..RRIP with incorrect flags?RRIP with incorrect NM flags? IEEE_1282IEEE_P1282RRIP_1991ASPvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapH\dm`cd9660_mountroot: can't setup bdevvp'scd9660root_deviceCD001%/@%/C%/Eisoinodefhtovp: lbn exceed volume space %d fhtovp: crosses block boundary %d fhtovp: bread error %d fhtovp: directory crosses block boundary %d[off=%d/len=%d] vm_map_lock_read: intrsafe map..cd9660_strategy: spectag VT_ISOFS, isofs vnode vm_map_lock_read: intrsafe mapexec: a VTEXT vnode has writecount != 0vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapelf32_load_fileexec: a VTEXT vnode has writecount != 0OpenBSDexec_elf32_makecmdsvm_map_lock_read: intrsafe map#!exec_script_makecmds: epp already has a fdexec_script: copyinstr couldn't fail/dev/fd/%dvm_map_lock_read: intrsafe mapvmcmdset_extend: not necessarydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/exec_subr.cocnt > 0exec_process_vmcmds: RELATIVE no basevm_map_lock_read: intrsafe mapCopyright (c) 1982, 1986, 1989, 1991, 1993 The Regents of the University of California. All rights reserved. Copyright (c) 1995-2003 OpenBSD. All rights reserved. http://www.OpenBSD.org swappercannot mount rootcannot find root vnodefork initpagedaemonfork pagedaemonreaperfork reapercleanerfork cleanerupdatefork updateaiodonedfork aiodonedcryptocrypto thread/sbin/init.bak/sbin/oinit/sbin/init/dev/consolewarning: /dev/console does not exist warning: /dev/console error %d init: couldn't allocate argument spaceexec %s: error %d init: not found no initvm_map_lock_read: intrsafe mapacct_processacctAccounting resumed Accounting suspended acct_threadvm_map_lock_read: intrsafe mapfileplfdescplfd_unused: fd_lastfile inconsistentdup2: fdallocfilefdexpandclosef: count < 0closefclosef: count: %d/%dkqeueplknoteplkqreaddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_event.c(kn->kn_status & KN_QUEUED) == 0kn->kn_status & KN_QUEUEDvm_map_lock_read: intrsafe mapexecve: argp == NULLexecve: no vmcmdssys_execve: falloc indx != ikernel mapping failed %d user mapping failed vm_map_lock_read: intrsafe mapinit died (signal %d, exit %d)reaperwaitvm_map_lock_read: intrsafe mapprocppwaitWARNING: thread `%s' (%d) exits with status %d unable to allocate kthread_qvm_map_lock_read: intrsafe mapktrsyscallktrsysretktrnameiktremulktrgenioktrpsigktrcswktrace write failed, errno %d, tracing stopped lockmgr: using decommissioned locklockmgr: non-release on draining lock: %dlockmgr: make up your mindlockmgr: not holding exclusive locklockmgr: upgrade exclusive locklockmgr: non-zero exclusive countlockmgr: locking against myselflockmgr: pid %d, not %s %d unlockingexclusive lock holderlockmgr: LK_RELEASE of unlocked locklockmgr: draining against myselflockmgr: unknown locktype request %d lock type %s: SHARED (count %d) lock type %s: EXCL (count %d) by pid %d with %d pendingvm_map_lock_read: intrsafe maplkmopnlkmlookupDDB symbols added: %ld bytes NTFS vrunNTFS decompNTFS resident data NTFS file attrNTFS hash tablesNTFS dirNTFS fnodeNTFS nodeNTFS mounttemprp_addrip6rrNDPip6_optionsemuldata1394data1394ctlpacket tagsIPsec credscrypto datamemdescUSB HCUSB deviceUSBUVM aobjUVM amapRAIDframe dataVM swapindirdepnewblkinodedeppagedepxform_datatdbpfkey dataEXT2FS nodeadosfs bitmapadosfs anodeadosfs mountmiscfs mountexecttysMSDOSFS nodeMSDOSFS fatMSDOSFS mountISOFS nodeISOFS mountmrtether_multiin_multiip_moptionsNFS daemonNFS uidNFS srvsockExport HostMFS nodeVFS clustersubprocproclockffile descfileVM pmapsemVM mapshmUFS mountUFS quotanamecachevnodesNFS nodeNFS mountNFS reqmountiovioctlopsnameisysctlsooptsifaddrfragtblroutetblpcbdebugdevbufmbuffree??malloc - bogus typemalloc: out of space in kmem_mapmalloc: allocation too large???%s %d of object %p size 0x%lx %s %s (invalid addr %p) Data modified on freelist: wordprevious type%s %d of object %p size 0x%lx %s %s (0x%x != 0x%x) malloc: wrong bucketmalloc: lost datafree: non-malloced addr %p type %sfree: unaligned addr %p, size %ld, type %s, mask %ldmultiply freed item %p free: duplicated freefree: multiple freeskmeminit: minbucket too small/struct freelist too big%d,%s,physbuftodo < 0; minphys brokentodo > MAXPHYS; minphys brokenphysiodone < 0; strategy brokendone > todo; strategy brokenputphysbuf: private buf B_WANTEDprocplzombieplucredplpgrpplsessionplpcredplchgproccnt: procs < 0chgproccnt: lost userenterpgrp: setsid into non-empty pgrpenterpgrp: session leader attempted setpgrpenterpgrp: new pgrp and pid != pgidenterpgrp: mksession and p != curprocdeadzombiestopsleeprunidle%dPROC (%s) pid=%d stat=%s flags=%b ADVLOCKCTTYINMEMNOCLDSTOPPPWAITPROFILSELECTSINTR SUGID SYSTEM TIMEOUT TRACED WAITEDWEXITEXECPWEUPCFSTRACESSTEPSUGIDEXECNOCLDWAITNOZOMBIEINEXECSYSTRACECONTINUED pri=%u, usrpri=%u, nice=%d forw=%p, back=%p, list=%p,%p user=%p, vmspace=%p estcpu=%u, cpticks=%d, pctcpu=%d.%d%, swtime=%u user=%llu, sys=%llu, intr=%llu plimitplvm_map_lock_read: intrsafe mapsigaplpausepsignal signal numberProcess (pid %d) got signal %d issignal postsigpostsig actionpid %d was killed: %s sorry, pid %d was killed: %s %s.corecoredumpuiomove: modeuiomove: procureadc: zero residureadc: non-positive iovcnthashinit: bad cnthook_disestablish: hook not establishedpowerhook_disestablish: hook not establishedvm_map_lock_read: intrsafe mapsysctlsysctl_disklocksysctl_kmemlocksysctl_doproc%s,diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/kern_synch.cphztsleepsleep called with priority %d > PZERO, wchan: %p old sleepsleepwakeuppreempt: cpu_preempt not yet implementedmi_switchsetrunnablemawnusage: show all procs [/a] [/n] [/w] /a == show process address info /n == show normal process info [default] /w == show process wait/emul info PID %-10s %18s %18s %18s COMMANDSTRUCT PROC *UAREA *VMSPACE/VM_MAP PID %5s %5s %5s S %10s %-9s %-16s PPIDPGRPUIDFLAGSWAIT PID %-16s %-8s %18s %s EMULWAIT-CHANNELWAIT-MSG%c%5d %-10.10s %18p %18p %18p %5d %5d %5d %d %#10x %-9.9s %-16s %-16s %-8s %18p %s vm_map_lock_read: intrsafe mapdenied attempt to set clock forward to %ld denied attempt to set clock back %ld seconds nanosleeptimeout_add: not initializedtimeout_add: to_ticks < 0?%9d %2d/%-4d %8x %s ticks now: %d ticks wheel arg func smashed stack in %s>>> probing for %s* %d mapply: no match function for '%s' device>>> %s probe returned %d >>> %s probe won >>> no winning probe unsupported not configured root device %s not configured %s (root)%s at %sconfig_make_softcconfig_make_softc: allocation for device softc failed%s%dconfig_make_softc: device name too longconfig_make_softc: %sing dev arrayexpandcreatconfig_make_softc: duplicate %sconfig_detach: bad device fstateconfig_detach: forced detach of %s failed (%d)config_detach: detached device has children%s detached config_defer: can't defer config of a root deviceconfig_defer: deferred twiceconfig_defer: can't allocate defer structureconfig_activate_children: shouldn't get hereevcnt_attach%s%d%c: %s %sing fsbn readwrit%d%d of %d-%d (%s%d bn %d; cn %d tn %d sn %d)disk_attach: can't allocate storage for disklabeldisk_detach: disk_count < 0disk_unbusy: %s: dk_busy < 0 rootdev=0x%x rrootdev=0x%x rawdev=0x%x cannot open disk, 0x%x/0x%x, error %dcannot read disk label, 0x%x/0x%x, error %droot filesystem has size 0filesystem type %d not known.. assuming ffs dk_mountrootextent_register: already registeredextentplextent_create: name == NULLextent_create: extent `%s', start 0x%lx, end 0x%lx extent_create: end < startextent_create: fixed extent, bad storagesize 0x%lxextent_create: storage provided for non-fixedextent_destroy: NULL extentextent_alloc_region: NULL extentextent_alloc_region: extent `%s', size 0x%lx extent_alloc_region: bad sizeextent_alloc_region: extent `%s', start 0x%lx, size 0x%lx extent_alloc_region: overflowextent_alloc_region: extent `%s' (0x%lx - 0x%lx) extent_alloc_region: start 0x%lx, end 0x%lx extent_alloc_region: region lies outside extentextent_alloc_region: can't allocate region descriptor extntextent_alloc_subregion: NULL extentextent_alloc_subregion: NULL result pointerextent_alloc_subregion: extent `%s', ex_start 0x%lx, ex_end 0x%lx extent_alloc_subregion: substart 0x%lx, subend 0x%lx extent_alloc_subregion: bad subregionextent_alloc_subregion: extent `%s', size 0x%lx extent_alloc_subregion: bad sizeextent_alloc_subregion: bad alignmentextent_alloc_subregion: extent `%s', size 0x%lx, boundary 0x%lx extent_alloc_subregion: bad boundaryextent_alloc_subregion: can't allocate region descriptor extent_alloc_subregion: extent `%s' (0x%lx - 0x%lx), alignment 0x%lx extent_alloc_subregion: overflow after alignmentextent_free: NULL extentextent_free: extent `%s', start 0x%lx, size 0x%lx extent_free: extent `%s', region not within extentextent_free: overflowextent_free: start 0x%lx, end 0x%lx extent_free: region not foundextent_print: NULL extentextent `%s' (0x%lx - 0x%lx), flags=%b FLWANTEDWANTEDNOCOALESCEFIXED 0x%lx - 0x%lx vm_map_lock_read: intrsafe mapklogvm_map_lock_read: intrsafe mappr_rmpage: nidle inconsistentpr_rmpage: nitems inconsistentpool_init: pool item size (%lu) too largepool_init: too much uptimediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/subr_pool.cpp->pr_itemsperpage != 0phpoolpcgpoolpool_destroy: pool busy: still out: %upool_set_drain_hook(%s): already setpool_getpool_get: %s:must have NOWAITpool_get: %s: crossed hard limit%s pool_get: %s: curpage NULL, nitems %u pool_get: nitems inconsistentpool_get: %s: page emptypool_get: %s: items on itemlist, nitems %u pool_get(%s): free list modified: magic=%x; page %p; item addr %ppool_get: nidle inconsistentpool_get: %s: nmissing inconsistentpool %s: putting with none out pool_putpool_put: %s: page header missingpool_prime_page: %s: unaligned page((((vaddr_t)pi) + ioff) & (align - 1)) == 0pool %s is locked; try again later POOL %s: size %u, align %u, ioff %u, roflags 0x%08x alloc %p minitems %u, minpages %u, maxpages %u, npages %u itemsperpage %u, nitems %u, nout %u, hardlimit %u nget %lu, nfail %lu, nput %lu npagealloc %lu, npagefree %lu, hiwat %u, nidle %lu page list: page %p, nmissing %d, time %lu,%lu item %p, magic 0x%x no current page curpage %p no log cache %p: allocfrom %p freeto %p hits %lu misses %lu ngroups %lu nitems %lu group %p: avail %d %p %s: pool(%p:%s): page inconsistency: page %p; at page head addr %p (p %p) pool(%s): free list modified: magic=%x; page %p; item ordinal %d; addr %p (p %p) poolpool(%p:%s): page inconsistency: page %p; item ordinal %d; addr %p (p %p) pcg->pcg_avail <= PCG_NOBJECTSpcg->pcg_avail != 0pcg->pcg_objects[idx] != NULLpcg->pcg_avail < PCG_NOBJECTSpcg->pcg_objects[idx] == NULLpool_page_alloc_nointrpool_page_free_nointrvm_map_lock_read: intrsafe mapkernel %sassertion "%s" failed: file "%s", line %d%s: table is full panic: splassert: %s: want %d have %d spl assertion failure in %s%dlogpri%llo%lld%llx0123456789abcdef(null)0123456789ABCDEFbug in kprintf: bad basekprintf?vverbosettimezonesshowquitLlinesllisthhelpffindqexiteenableddisableDddbcchangebbaseaadd--- more --- %d%d0%o0x%x%s*FOUND***UNKNOWN*%3d free slot (for add) %3d %s count %d (pseudo device) Unknown devno (max is %d) %3d at root%c disable ??? %s flags 0x%x %s [] ? Unknown argument change (y/n) ? out of memory. flags changed %3d can't change free slot count%3d %s changed Error unknown state already disabled %3d can't disable free slot %3d %s can't disable pseudo device enabled %3d can't enable free slot %3d %s can't enable pseudo device command args description [count] number of lines before moredev add a device8|10|16 base on large numbersdevno|dev change devices enter ddbattr val|devno|dev disable devicesattr val|devno|dev enable devicesdevno|dev find devices this message list configuration leave UKC[attr [val]] show attributes (or devices with an attribute)[mins [dst]] set timezone/dst toggle verbose booting don't know%s Unknown routine /%c/ Unknown attribute Unknown pseudo routine /%c/ Value missing for attribute %s ? Not same device type No more space for new devices. Device not complete number or * is missing No device of this type exists. Clone Device (DevNo, 'q' or '?')Insert before Device (DevNo, 'q' or '?')Unknown command, try help Argument expected Dev expected 8|10|16 expected DevNo or Dev expected Attr, DevNo or Dev expected timezone = %d, dst = %d autoconf verbose %sabled endisUnknown command User Kernel Config UKC> Continuing... sys_ioctlselectpollpipespace: out of kvmpipelkpiperdExpected pipe buffer wraparound disappearedExpected wraparound badPipe buffer overflowpipewrpipeclpipeplptrace: impossiblevm_map_lock_read: intrsafe mapmsginfo.msgssz %d not a small power of 2msginfo.msgseg %d > 32767msgmaps is NULLmsghdrs is NULLmsqids is NULLmsghdr->msg_spot out of rangemsghdr->msg_spot != -1sys_msgctl: msg_cbytes is screwed upsys_msgctl: msg_qnum is screwed upmsgwaitmsg_perm.mode & MSG_LOCKEDsegs_needed > nfree_msgmapsmsgsz + msg_cbytes > msg_qbytesno more msghdrsmsqid_ds is already lockednot enough msgmapsnil free_msgmapsnext too low #1next out of range #1next too low #2next out of range #2didn't use all the msg segmentsmsg_first/last screwed up #1msg_first/last screwed up #2msg_first/last screwed up #3next too low #3next out of range #3semaplsemuplsemundo_adjust: suptr not in semu_listsemwaitsemop - can't undo undossemexit - semid not allocatedsemexit - semnum out of rangeshmseg free count inconsistentshmplvm_map_lock_read: intrsafe map@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /dev/consolettnreadttrstrtttypendttyunblockttckoutqttwritettyrub: would panic c = %d, val = %d load: %d.%02d not a controlling terminal no foreground process group empty foreground process group cmd: %s %d [%s] iowaitrunning%ld.%02ldu %ld.%02lds %d%% %ldk tty_detach: tty_count < 0vm_map_lock_read: intrsafe mapptcreadptcwriteputc: required clalloc b_to_q: required clalloc  $$ $$$$  $$x @ $$p$$ $$p$$ @ $h$` $h$`PTCLPTRTCN46vm_map_lock_read: intrsafe mapWARNING: mclpool limit reached; increase NMBCLUSTERSmbplmclplm_copym0: off %d, len %dm_copym0: null mbufm_copym0: m == 0 and not COPYALLm_copym0 overrunm_copydata: off %d < 0m_copydata: len %d < 0m_copydata: null mbuf in skipm_copydata: null mbufm_zero: M_READONLYm_apply: len %d < 0m_apply: off %d < 0m_apply: null mbuf in skipm_apply: null mbufm == NULL in m_pulldown()unixsockplsofreesoclose: NOFDREFsoabortsoaccept: !NOFDREFreceive 1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/uipc_socket.cm == so->so_rcv.sb_mbreceive 1aso->so_rcv.sb_mb == mreceive 3netconnetclsnetionetlcksonewconnsoqinsquediagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../kern/uipc_socket2.csb->sb_mb == sb->sb_lastrecordsbappendaddrsbappendcontrolsemi-panic: sbcompress (sb->sb_flags & SB_LOCK) == 0sb->sb_cc == 0sb->sb_mb == NULLsb->sb_mbtail == NULLsb->sb_lastrecord == NULLsbdropsbcreatecontrol: message too large %d acceptvm_map_lock_read: intrsafe mapuipc 1uipc 2uipc 3uipc 4piusrrequnp_attachunp_bindunp_connect2unp_disconnectvm_map_lock_read: intrsafe mapbremfree: lost tailbufplbuf_dirtybuf_undirtygetblkallocbuf: buffer larger than MAXBSIZE requestedallocbuf: negative bufsizegetnewbufDirty buffer on BQ_CLEANBQ_CLEAN has buffer with dependenciescleanerClean buffer on BQ_DIRTYbiowaitbiodonebiodone alreadyvm_map_lock_read: intrsafe mapcache_enter: name too longnchplvm_map_lock_read: intrsafe mapcluster_read: size = 0cluster_read: DONE bpcluster_rbuild: size %ld != filesize %ldcluster_rbuild: too much memorycluster_callbackcluster_callback: too little memorycluster_wbuild: size %ld != filesize %ldClustered Block: %d addr %x bufsize: %ld Child Block: %d addr: %x Clustered write to wrong blocksvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvop_generic_revokevop_generic_revokeallvm_map_lock_read: intrsafe mapoperation %s not listed in %s. vfs_op_descsvfs_opv_init: bad operationvfs_opv_init: operation vector without default routine.vm_map_lock_read: intrsafe maplf_findoverlap: defaultvm_map_lock_read: intrsafe mapnamei: bad cred/procnamei: nameiop contaminated with flagsnamei: flags contaminated with nameiopsleaf should be emptyrelookup: null namerelookup: lookup on dot-dotrelookup: symlink found.vm_map_lock_read: intrsafe mapvnodesvfslock%s_mountroot failed: %d vnodefree vnodefree vnode isn'tcleaned vnodecleaned vnode isn'tClean vnode has pending I/O'sv_lockvgetvref used where vget requiredUse count is not zero!vnode already on free list: vnode already on free listvput: null vpvput: bad ref countvput: ref cntvput: bad writecountvput: v_writecount != 0vrele: null vpvrele: bad ref countvrele: ref cntvrele: bad writecountvrele: v_writecount != 0vclean: deadlockvclean: cannot reclaimvclean: not cleanvgonemissing bdevmissing aliasvgonel: not cleanVBADVFIFOVSOCKVLNKVCHRVBLKVDIRVREGVNON%s: type %s, usecount %u, writecount %u, holdcount %u,|VROOT|VTEXT|VSYSTEM|VXLOCK|VXWANT| VBIOWAIT|VALIASED flags (%s) vprintkinfo: vp changed unmount of %s failed with error %d WARNING: some file systems would not unmount retrying syncing disks... giving up done softdep %d vwaitforiovwakeupvwakeup: neg numoutputvinvalbufvinvalbuf: dirty bufsvinvalbuf: flush failedvflushbuf: not dirtyvflushbufvflushbuf: dirtybgetvpbgetvp: not freebrelvpbrelvp: NULLbrelvp: holdcntbuf_replacevnodereassignbufvfs_register called with vfc_refcount > 0 vm_map_lock_read: intrsafe mapsched_sync: fsync failedsyncersyncer vnode vm_map_lock_read: intrsafe mapvfslocksys_mountmount: lost mountunmount: dangling vnodesys_statfssys_fstatfssys_getfsstatsys_getfhsys_fhopensys_fhstatsys_fhstatfsvm_map_lock_read: intrsafe mapvn_lockvm_map_lock_read: intrsafe mapdefaultvop_islockedvop_lookupvop_createvop_mknodvop_openvop_closevop_accessvop_getattrvop_setattrvop_readvop_writevop_leasevop_ioctlvop_selectvop_kqfiltervop_revokevop_fsyncvop_removevop_linkvop_renamevop_mkdirvop_rmdirvop_symlinkvop_readdirvop_readlinkvop_abortopvop_inactivevop_reclaimvop_lockvop_unlockvop_bmapvop_printvop_pathconfvop_advlockvop_reallocblksvop_whiteoutvop_getextattrvop_setextattrvop_strategyvop_bwritevm_map_lock_read: intrsafe mapdead_read: lockdead_write: locktag VT_NON, dead vnode dead_badop calledchkvnlockvm_map_lock_read: intrsafe maplayer_node_find: vget failed. layer_node_create: aliaslayer_node_create: lowerlayer_node_create: lower has 0 usecount.vp = %p, ZERO ptr %lx layer_checkvpvp = %p, unref'ed lowervp layer with unref'ed lowervpvm_map_lock_read: intrsafe maplayerfs_statfsvm_map_lock_read: intrsafe maplayer_bypass: %s tag VT_LAYERFS, vp=%p, lowervp=%p vm_map_lock_read: intrsafe mapfdesc 0  !D "8 "vm_map_lock_read: intrsafe mapfdfsfdttystdinfd/0stdoutfd/1stderrfd/2..fdesc_getattr%dfdesc_readdirtag VT_NON, fdesc vnode fdesc: bad opvm_map_lock_read: intrsafe mapfifo_read modefifo_write modetag VT_NON , fifo with %ld readers and %ld writersfifo_badop calledvm_map_lock_read: intrsafe mapkernfs_get_rrootdev: no raw root device kernfs. = > > >P > ?tvm_map_lock_read: intrsafe map$`m$Xm$H+$ $8($ $($cx$$/ $_$(T$$5$$(Ո$$-V$$Y$$($$'Ұ$ $'Ҹ$$($$- `$$-\c$$($$)G$$(G$$x$$p[$$h'$$`k$ipsecversionusermemtimerrootdevrootdevposixphysmempagesizeosrevosreleaseostypencpumsgbufmodelmachineloadavghzdomainnamehostnamecopyrightbyteorderboottime...kfs%ld %ld %d %d %d %d %ld %u kernfs_getattrkernfs_readkernfs_writekernfs_readdirtag VT_KERNFS, kernfs vnode: name %s, vp %p, tag %d kernfs: bad opvm_map_lock_read: intrsafe map$° MT \ OL d     h   8 vm_map_lock_read: intrsafe map,(vm_map_lock_read: intrsafe map O Q Q R Rvm_map_lock_read: intrsafe mapportal_closefd: error = %d portalconportal_open: %d extra fds tag VT_PORTAL, portal vnode portal: bad opvm_map_lock_read: intrsafe map(%s)vm_map_lock_read: intrsafe map$H$@$8$0$(waitrunstepdetachattach$P$H$@$8$0$($ $$$ $ $ $ $ $$$$$$Ÿ$Ű$Ũ$Š$Ř$Ő$ň$ŀ$x$p$h$`$Xusr2usr1infowinchprofvtalrmxfszxcpuiottouttinchldconttstpstopurgtermalrmpipesyssegvbuskillfpeemtiotabrttrapillquitinthupprocfsxprocfsprocfs_controlprocfs_doctlvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map total: used: free: shared: buffers: cached: Mem: %8lu %8lu %8lu %8lu %8lu %8lu Swap: %8lu %8lu %8lu MemTotal: %8lu kB MemFree: %8lu kB MemShared: %8lu kB Buffers: %8lu kB Cached: %8lu kB SwapTotal: %8lu kB SwapFree: %8lu kB procfs_domeminfoprocfs_docpuinfovm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapprocfs_donotevm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map %d %d %d %d %d,%d %sctty,%ssldrnoflags %ld,%ld -1,-1 %ld,%ld %ld,%ld %snochan %u, %u,%u procfs_stat_genvm_map_lock_read: intrsafe mapprocfslprocfs_allocvpvm_map_lock_read: intrsafe mapprocfs: invalid directory entry sizeprocfs t v| u v8 v ovm_map_lock_read: intrsafe mapexecmdlinenotepgnotestatusctlfpregsregsmemfile...cpuinfomeminfotag VT_PROCFS, type %d, pid %d, mode %x, flags %lx %ldprocfs_getattrprocfs_getattrcurprocselfprocfs_readdirprocfs_readlinkvm_map_lock_read: intrsafe mapspec_read modespec_read procspec_read typespec_write modespec_write procspec_write typespec_ioctlspec_fsync: not dirtyspec_fsyncspec_fsync: dirtyspec_close: not specialtag VT_NON, dev %d, %d spec_badop calledvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe map$ \ l d     h   8 vm_map_lock_read: intrsafe map,(umap_bypass: %s umap_bypass: user was %d, group %d umap_bypass: user now %d, group %d umap_bypass: component credit user was %d, group %d umap_bypass: component credit user now %d, group %d umap_bypass: returning-user was %d umap_bypass: returning-user now %d umap_bypass: returning-component-user was %d umap_bypass: returning-component-user now %d umap_lookup umap_lookup: component credit user was %d, group %d umap_lookup: component credit user now %d, group %d umap_lookup: returning-component-user was %d umap_lookup: returning-component-user now %d umap_getattr: mapped uid = %d, mapped gid = %d umap_getattr: original uid = %d umap_getattr: original gid = %d tag VT_UMAPFS, vp=%p, lowervp=%p umap_rename: rename component credit user was %d, group %d umap_rename: rename component credit user now %d, group %d vm_map_lock_read: intrsafe mapunionlkunion: unidentifiable allocationunion: . not lockedunion: allocvp not lock ownerunionallocunion: dircache table too smallvm_map_lock_read: intrsafe map:::union_mount: bad um_opunion_statfs  L h L P vm_map_lock_read: intrsafe map,(union_lookup -> . (%p) != startdir (%p)empty union vnodeunion_close empty vnodeunion: missing upper layer in writeunion remove: null upper vnodeunion_link called without LOCKPARENT set! union: null upperdvp?union rmdir: null upper vnodeunion: %p: warning: locking decommissioned lockunion: %p: non-release on draining lock: %dunion: dangling klockunion: dangling upper lock (%p)union: locking against myselfunionlk2union: unlock unlocked nodeunion: unlocking other process's union nodeunion: %p: warning: unlocking decommissioned lock tag VT_UNION, vp=%p, uppervp=%p, lowervp=%p union: upperunion: lowerdircache:union_strategy: nil vpunion_strategy: writing to lowervpvm_map_lock_read: intrsafe mapdos2unixtime(): month value out of range (%ld) !#$%&'()-0123456789@ABCDEFGHIJKLMNOPQRSTUVWXYZ^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{}~Ͼ󨷵ǎԐѥ噞᷵ǎԐѥ???????????????????????????????? !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~?Ѫ?????????????????????????????յݯ????  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~vm_map_lock_read: intrsafe mapdenodedeget(): pcbmap returned %d detrunc(): can't truncate root directory, clust %ld, offset %ld deextend: file too largemsdosfs_reclaim(): pushing activemsdosfs_inactive(): pushing activevm_map_lock_read: intrsafe mapfatentry(): function code doesn't specify get or set fatentry(): get function with no place to put result extendfile(): attempt to extend root directory extendfile: pcbmapvm_map_lock_read: intrsafe mapmsdosfs_lookup. .. doscheckpath: source and target on different filesystemsdoscheckpath(): .. not a directory? vm_map_lock_read: intrsafe mapRRaArrAaUmsdosfs_sync: rofs mod -< :X :` ; ;@ %s: invalid input protocol %s: Cisco packet in PPP mode %s: invalid input packet %s: protocol queue overflow %s: no memory for transmit header %s: cisco invalid packet length: %d bytes %s: cisco input: %d bytes <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: cisco unknown packet type: 0x%lx %s: loopback %s: up %s: cisco output: <0x%lx 0x%lx 0x%lx 0x%x 0x%x-0x%x> %s: %s output <%s id=0x%x len=%d> %s: %s invalid packet length: %d bytes %s: %s input(%s): <%s id=0x%x len=%d%s: %s invalid conf-req length %d %s: %s tlu %s: %s id mismatch 0x%x != 0x%x %s: %s send terminate-ack %s: %s: ignoring RXJ (%s) for proto 0x%x, danger will robinson %s: lcp echo req but lcp closed %s: invalid lcp echo request packet length: %d bytes %s: got lcp echo req, sending echo rep %s: lcp invalid echo reply packet length: %d bytes %s: lcp got echo rep %s: %s send code-rej for 0x%x %s: %s up(%s) %s: %s down(%s) %s: %s open(%s) %s: %s close(%s) %s: %s TO(%s) rst_counter = %d %s: %s %s->%s %s: Up event(incoming call) %s: Down event (carrier loss) %s: lcp parse opts: %s [invalid] [invalid chap len] [not configured] [rej] send conf-rej %s: lcp parse opt values: 0x%lx [glitch] [empty] [non-empty] %lu [mine %s != his %s] [chap not MD5] send conf-nak max_failure (%d) exceeded, closing send conf-ack %s: lcp rej opts: [don't insist on auth for callout][access denied] %s: lcp nak opts: magic glitch %d %s: phase %s sppp_lcp_scr%s: ipcp_open(): no IP interface %s: ipcp parse opts: %s: ipcp parse opt values: %s %s [ack] [addr requested] %s [not agreed] still need hisaddr send conf-nak send conf-ack %s: ipcp rej opts: %s: ipcp nak opts: [wantaddr %s] [agree] sppp_ipcp_scr%s: chap invalid packet length: %d bytes %s: chap corrupted challenge <%s id=0x%x len=%d%s: chap input <%s id=0x%x len=%d name= value-size=%d value=%s: chap success: %s: chap failure%s: chap failure %s: chap corrupted response <%s id=0x%x len=%d%s: chap dropping response for old ID (got %d, expected %d) %s: chap response, his name != expected %s: chap input(%s) <%s id=0x%x len=%d name=%s: chap bad hash value length: %d bytes, should be %d Failed...Welcome!%s: chap unknown input(%s) <0x%x id=0x%xh len=%dsppp_chap_input%s: chap TO(%s) rst_counter = %d %s: chap %s, reconfirmedtlunext re-challenge in %d seconds re-challenging supressed %s: chap tld %s: pap invalid packet length: %d bytes %s: pap corrupted input <%s id=0x%x len=%d%s: pap input(%s) <%s id=0x%x len=%d name= passwd=%s: pap success%s: pap failure%s: pap failure %s: pap corrupted input <0x%x id=0x%x len=%d%s: pap TO(%s) rst_counter = %d %s: pap peer TO %s: pap tld %s: down sppp_paramsconf-reqconf-ackconf-nakconf-rejterm-reqterm-ackcode-rejproto-rejecho-reqecho-replydiscard-req0x%xchallengeresponsesuccessfailurereqacknakmruasync-mapauth-protoqual-protomagicproto-compaddr-compaddressescompressionaddressinitialstartingclosedstoppedclosingstoppingreq-sentack-rcvdack-sentopenedillegaldeadestablishterminateauthenticatenetwork %02x-%02x\x%x%c%d.%d.%d.%dlo%dlooutput: no header mbuf%s: can't handle af%d looutputlo_altqstart: can't handle af%d ifmedia_add: can't malloc entryifmedia_set: no match for 0x%x/0x%x ifmedia_setifmedia_match: multiple match for 0x%x/0x%x sl%dsl%d: can't allocate buffer %s: af%d not supported slstartslinputppp%dpppdealloc%s: comp_alloc failed %s: decomp_alloc failed %s: no compressor for [%x %x %x], %x pppioctl%s: af%d not supported %s output: ppp_requeuepppintrif_ppp/ccp: not enough data in mbuf (%p+%x > %p+%x) %s: got %d bytes %s: decompress failed %d %s: VJ uncompress failed on type comp %s: VJ uncompress failed on type uncomp %s: input queue full %s pppdumpmvm_map_lock_read: intrsafe mappppwritepppasyncstart%s: bad char %x %s: bad fcs %x %s: too short (%d) %s: no input mbufs! %s: garbage received: 0x%x (need 0xFF) %s: missing UI (0x3), got 0x%x %s: bad protocol %x %s: packet too big %s: too few input mbufs! %s input: %s pppdumpbbsd_decomp%d: bad sequence # %d, expected %d bsd_decomp%d: bad CLEAR bsd_decomp%d: bad code 0x%x oldcode=0x%x max_ent=0x%x explen=%d seqno=%d bsd_decomp%d: ran out of mru bsd_decomp%d: peer should have cleared dictionary z_compress: deflate returned %d (%s) z_decompress%d: bad seq # %d, expected %d z_decompress%d: inflate returned %d (%s) z_incomp%d: inflateIncomp returned %d (%s)       )$)$$unknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkincorrect data check??invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeat #+3;CScs !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeinvalid literal/length codeinvalid distance code0.95Pbuffer errorinsufficient memorydata errorstream errorfile errorstream endvm_map_lock_read: intrsafe maptun%dtunreadbridge%dbridge_ioctlbridge_bifconfbridge_brlconfbridge_input(): no HDRbridge_broadcastbridge_rtfindbridge_ipsecbstp_ifupdstatusvlanattach: MALLOC failedvlan%dvlan_input%s: initialized with non-standard mtu %lu (parent %s) %svlan_ioctldiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/if_vlan.cmc != NULLvlan_ether_purgemultirn_addmask: mask impossibly already in treeMask for route not entered Non-unique normal route, mask not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %p at %p rn_delete: Orphaned Maskrn_init: radix functions require max_keylen be set rn_initrn_init 2raw_usrreqrtfreertfree 2rtfree: %p not freed (neg refs) ifafreertredirectrtflushclone: called with a non-cloning routertflushclone: no rnh_walktreertrequest deletertinit: wrong ifa (%p) was (%p) /usr/src/sys/arch/sparc/compile/GENERIC/../../../../net/route.crt_init_done == 0rt_timer_queue_destroy: rtq_count reached 0 rt_timer_remove_all: rtq_count reached 0 rt_timer_add: rtq_count reached 0 rt_timer_timer: rtq_count reached 0 route_outputrt_msg1routesl_compress_tcpenc%dgre%dgre_ioctlarp_rtrequest: bad gateway value arp_rtrequest: malloc failed arprequestarpresolve: can't allocate llinfo arpresolve: unresolved and rt_expire == 0 arpintrarp: ether address is broadcast for IP address %s! arp: ether address is multicast for IP address %s! duplicate IP address %s sent from ethernet address %s arp: attempt to overwrite permanent entry for %s by %s on %s arp: attempt to overwrite entry for %s on %s by %s on %s arp info overwritten for %s by %s on %s arp: attempt to add entry for %s on %s by %s on %s in_arpinputarptfreearplookup: unable to enter address for %s revarprequestrevarp[NULL][%d,] ifa_addr= ifa_dsta= ifa_mask= flags=0x%x, refcnt=%d, metric=%d la_rt=%p la_hold=%p, la_asked=0x%lx rtentry=%p flags=0x%x refcnt=%d use=%ld expire=%ld key= mask= gw= ifp=%p (%s)(NULL) ifa=%p genmask= gwroute=%p llinfo=%p Route tree for AF_INET (not initialized) in4_cksum: offset too shortin4_cksum: bad mbuf chaincksum4: out of data in4_cksumin_controlin_controlinvalid argument to in_lifaddr_ioctlin_lifaddr_ioctlin_ifinitin_ifinitin_addmultiin_delmultiin_pcbinit: hashinit failedIPv6 pcb passed into in_pcbconnectin_pcbnotifyin_pcbhashlookup: faddr=%08x fport=%d laddr=%08x lport=%d in6_pcblookup_connect: faddr= fport=%d laddr= lport=%d interneticmp_erroricmp lenicmp_reflecticmp_mtudisc_timeout: bad route to timeouticmp_mtudisc_timeouticmp_redirect_timeout: bad route to timeout %d.%d.%d.%dipqeplip_initaeshmac-sha1deflateipintr no HDRattempted source route from %s to %s ip_dooptionssave_rte: olen %d ip_srcroute: nhops %d mlen %d hops %x %x %x forward: src %x dst %x ttl %x redirect (%d) to %x ip_forwardip_output: IPv6 pcb is passedip_output no HDRip_output: tag of length %d (should be %dip_outputmalformed IPv4 option passed to ip_optcopyip_setmoptionsrip_attachrip_detachrip_usrreqtcp_inputtcp_sack_optiontcp_pulloutofbandtcp_output: options too longtcphdr too bigtcp_outputtcp_output: template len != hdrlen - optlentcp_outputtcp_output REXMTtcpcbplsackhlpltcp_inittcp_respondassumption failed in tcp6_ctlinputtcp6_mtudisc_callbackchghitcp_timer_rexmttcp_usrreqtcp_identm_pulldown malfunctionudp_inputudp6_ctlinputIPv6 inpcb to udp_outputudp_usrreqgre_input2gre_mobile_inputIPcompIPsec ESPIPsec AHIPv4 Simple Encapsulationno tdb hash table tdb cnt bucket cnt %d%c %d +uniqueinvalidhalfivpfstunnelingnoreplayrandom paddingskipcryptousedtunnel% % % @% % % % 0@% @% PSPI = %08x, Destination = %s, Sproto = %u Established %d seconds ago Source = %s, Proxy = %s MTU: %d, expires in %llu seconds Local credential type %d Remote credential type %d Local auth type %d Remote auth type %d Flags (%08x) = <none> %s,> Crypto ID: %llu xform = <%s> Encryption = <%s> Authentication = <%s> Compression = <%s> Next SA: SPI = %08x, Destination = %s, Sproto = %u Previous SA: SPI = %08x, Destination = %s, Sproto = %u %llu bytes processed by this SA Last used %llu seconds ago Last marked/unmarked %llu seconds ago Expirations: Hard expiration(1) in %llu seconds Soft expiration(1) in %llu seconds Hard expiration after %llu bytes Soft expiration after %llu bytes Hard expiration after %u flows Soft expiration after %u flows Hard expiration(2) in %llu seconds Hard expiration in %llu seconds after first use Soft expiration(2) in %llu seconds Soft expiration in %llu seconds after first use (none) Hashmask: %d, policy entries: %d %d.%d.%d.%d(unknown address family)ipsp_reffree: illegal reference count %d for object %p (len = %d, malloctype = %d) ipsp_spd_lookupipsec policyipsec acquireipsp_spd_inpipip_input: should never reach hereipip_inputipe4_input(): should never be called etherip_inputipsec_common_inputipsec_common_input_cbipsec_common_ctlinputah6_input: l went zero or negativeesp6_input: l went zero or negativeipcomp6_input: l went zero or negativeesp_initesp_input_cbesp_outputah_initah_massage_headersah_input_cbah_outputipcomp_initipcomp_outputcc||ww{{ kkooT`00PggV++}bMvvE@}}YYGG Ag_E#Srr[u=L&&jl66Z~??AOh44\Q4qqsb11S*? RF##e^0(7 / $6=&N''iuu X,,t4.6-nnZZ[RRv;;Ma}R)){>^//qSSh,@ `yȶ[[jjFgr99KJJޘLL԰XXJk*OCCŚMMf33UEEPPx<!KKa pp|>>BqffHHaaj55_WWiX:''8+"3iip3-<" IUUP((xzY  e1BBhhAA)Z--w{˨TTm,:cc||ww{{ kkooTP`00gg}V++bMvvEʝ@ɇ}}YYɎGG Ag_E#Srr[u=jL&&Zl66A~??O\h44Q4qqsSb11?* ReF##^(07 / 6$=&iN''uu tX,,.4-6nnZZ[RRMv;;a}{R))>q^//SSh,`@ y[[jjFgKr99ޔJJԘLLXXJk*OņCCךMMUf33ϊEEPPDx<<%KQQ]@@?!Hp88cwucB!!0 mL 5&/__5̈DD9.WU~~Gz==dd]]+2ss``ўOOfD""~T**; ʌFF)k<(y^^ v;Vd22Nt:: ےII lH$$\\]nCbb917yy2CYn77mmdҜNNIllVV%eezzGoxxoJ%%r\..$8WsQ#|ݜtt!>ݖKKa ppB|>>qffؐHHaa_j55WWiX':'8+3"iipى3-"< IUUxP((zߏY  e1ƄBBhhÂAA)wZ--{TTm:,cc||ww{{ kkooT0P`0gg+}V+b׫MvvEʂ@}}YYGɎG AgԢ_E#Srr[u=&jL&6Zl6?A~?O4\h4Q4qqs1Sb1?* R#eF#^(07 / 6$=&'iN'uu  ,tX,.4-6nnZZ[RR;Mv;aֳ}){R)>/q^/SSh, `@ y[[jjF˾g9Kr9JޔJLԘLXXJk*OCņCMךM3Uf3EϊEPPKݖKa pp>B|>qffHؐHaa5_j5WWiX':'8+3"iipَ3-"< IUU(xP(zߌY  e1BƄBhhAÂA)-wZ-{TTm:,cc||ww{{ kkooT00P`gg++}VbMvvE@}}YYGGɎ Ag_E#Srr[uᓓ=&&jL66Zl??A~O44\hQ4qqs11Sb?* R##eF^(07 / 6$=&''iNuu ,,tX.4-6nnZZ[RR;;Mva})){R>//q^SSh, `@㱱y[[jjFg99KrJJޔLLԘXXJk*ŪOCCņMMך33UfEEϊPP<KKݖa pp>>B|qffHHؐaa55_jWWiX':'8똘+3"iip3-"< IUU((xPzY e1BBƄhhAAÂ)--wZ{TTm:,cccc||||wwww{{{{kkkkoooo0000gggg++++׫vvvvʂ}}}}YYYYGGGG𭭭Ԣrrrr&&&&6666????4444qqqq1111####''''uuuu ,,,,nnnnZZZZRRRR;;;;ֳ))))////SSSS [[[[jjjj˾9999JJJJLLLLXXXX着CCCCMMMM3333EEEEPPPP<<<>>>ffffHHHHaaaa5555WWWWiiiiَUUUU((((ߌ BBBBhhhhAAAA----TTTTQP~AeS:'^;kEXK 0UvmvL%O*&5DbޱZI%gE]/uLFk_mzRYԾ-Xt!Ii)Du‰jyxX>k'qݾO f}:cJ1Q3`bSEdwk+pHhXElR{s#rKWfU*(/{70(#j\+yNie4bĦ4.SU2u 9@`^qnQ>!=>MFTq]o`P$ֽ闉@CgٞwB[8yۡ| G|B 2+HplZrN8V=6-9' dh\![T$6.: gWOa ZwKi⓺ *<"C ǭ-WuLݻ`&\rDf;[~4C)v#ܶhc1Bc"@ J$}һ=2)m/Kܲ0 Rw+lpHGd"Ġ?V},"3IN8ʢ 6ϥz(ڷ&?,:Px j_̛T~Fbظ.9^ï]iГ|o-%Ȭ;}cn;{&x nY욷One~!Jo6 )|1*?#1ƥ05ftN7ʦа3JAP/vM֍CM̪MTߞѵLj,FeQ^5]ts A.gZRV3mGa7 zY<Ω'a5zG8$4,£@_r% ('qOf }:cJ1`Q3EbSdwk+XpHhElR{#srKW*fU(/š{70(#j\+yNie4bĦ4.SU2u9 @`^qQn>!=>FM潵Tq]o`P$ֽ̉@CwgٞB8[yG| |B H2+pNlZrV8='6-9d !h\ћ[T:$6. gWҴOŢa iZwK ⓺*C<"  ǹ-WLu`&\rDf;4[~vC)#hc1Bc@" }J$һ=2m)K/ܲ0 Rwl+pH"GdĨ?V},"3LJIN8ʢ6 Ϧ(z&ڷ?,: Pxj_bT~Fظ^.9ï]|iГo-%;Ȭ}nc{; &xnY욷Oen~!ٺJo6 )|11*?#0ƥ5f7tNʰ3JAP/vMMCT̪MѵLj,FeQ^]5st. AZgR3VmGaz7 Y<Ω'5ah,8$4_£@r %(kXq'Of :}Jc13`QEbSwdk+hXpHElR{#srKW*fU(/{70(#j\+ϴyNieھb4ĦS4.U2u9 @`^qQn>!=>FM捵T]qo`P$ֽC̉@wgB苈[8y G||B H2+prNlZ8V=9'6-d !h\Tћ[.:$6g WҴO aKiZw *C<"  ǭ򋨹-WLuݻ`&\r;Df~4[)vC#hc1Bc"@ $}J=һ2m)/K0ܲR wl+pHd"GĨ?,V}"3NLJI8 6ԁϦ(z&ڷ?,: Px̛j_FbT~^.9À]|i-o%;Ȭ}cn蜻{;x &nY욚One~!ٺ6Jo |)1#1*?0ƥf57tNʦа3JAP/֍vMMCMT̪䖵шLj,QFe^5]tsA. ZgRV3Gma z7Y<'Ω5ah4,8$@_£r% I(kq'O f:}Jc1Q3`SEbdwk+HhXpEl{Rs#KrWU*f(/{7(0#j\+yiNe4bѦ.S4U2u9 `@q^nQ!>=>FMT]qoP`$@C̉ٞwgB[8y| GB| +H2pZrNl8V=-9'6d \!h[Tћ6.:$ g WҴO awKiZ *"C< ǭ򶨹-WuLݻ`&r\f;D~4[C)v#hc1cB"@ J$}=2)mǞ/K0܆R wl+pHd"GĨ?},V3"INLJ8ʢ 6Ϧz(&ڭ?:,x P_̛j~FbTظ9^.ï]Г|i-o%Ϭ;}cn;{&x YnOne~!ٺo6J |)1?#1*0Ƣf5N7tʦа3JAP/M֍vMCMT̖ѵjL,eQF^5]ts A.gZRV3Gma z7Y<'a5G$4,8@_r% >>>KKKKyyyy xxxxZZZZݨ33331111YYYY''''____````QQQQJJJJ ----zzzzɜ;;;;MMMM****뻻<<<QR1m'ȿY էGcQ))g' .!8M,mS8 e sTvj .r,表fKKplQђ֙$5jp7l'HwL49 NتJ[Oh.otxcoxPlqxj ggQRf߫1m-2'Ș!?YǾ =էG %cQo))g np' F/.!8\&&M,mZ*S8 e sTcvj &aц!}}Onxgro c}ŢȘ? q 5G(w#}2ʫ{@$< ɾCgĜ LLԾ>BY)e~*_o:lDJGX˻]b)*6|YZ0p/Y9g3&g 1JhX . dGHOj ggʧ;l٫Ak[~!y0123456789abcdef/usr/src/sys/arch/sparc/compile/GENERIC/../../../../crypto/sha2.ccontext != (SHA256_CTX*)0 && data != (sha2_byte*)0context != (SHA256_CTX*)0SHA256_EndSHA256_Datacontext != (SHA512_CTX*)0 && data != (sha2_byte*)0context != (SHA512_CTX*)0SHA512_EndSHA512_Datacontext != (SHA384_CTX*)0SHA384_EndSHA384_Data1 ߵ/r߷j&~|E,$Glⅎci qWNiX=~ trXqXJ{TZY09*`Ѱ#(`Ay8yܰ`:l>w1K'x/U`\`U%UWHbc@U9j*\4AΡT|r铳co*+]t1\>ֺ3l$\z2S(w;HkKĿf(!a !H|`]2]]u&#e#>ӖmoB9. D iJ^!hBlg aӈjQT/h(Q3n lz;;P~*e9vfY>CEo};^ou؅ s@DVjNӪb6?wrB=7$ HISrɀ{%yPyL;lO@`^\j$cho>lS9;RomQ0,́ED^ 3Jf(.K˨WEt _9Uy`2 ֡@,ryg%̎2"߂\WoV.iB(~ìg2ƌOUsi['X]=!Jl-[SyEeҎIKڤ~3bA 6wL~+MꭎqkՠЎЯ%<[/u+d O^h񑳨//"wu-otΉ♴O|;ҭ_fws!w ewTB5ͯ {>AӮ~I%- q^"hW$d6 UcYߦxCZS }[Ń&vbϩhNsJAG-{JQRS)W?+`vtoWk* ce!4.ŅVdS-]GnjKzp鵳)Du .&#nI}`f쪌qiVdRl±6u L)Y@:>?T[Bek֙?֡Ҝ0M-8%]L p&c^ hk?><kjph5R↷SP7>ޮ\}DW:7P  uA8͙;/2>1NT8OmoB  ,$|yVyrޚwٓ?.Ur.kq$P柄͇zXGtK}z:ۅc CfdG2C;7$ºMC*eQP:q1NUw_5Vףk<;Y$ ,*wN=)eܹ>Rf%.LxjxEⶣlOOBBjeO;A!yMKGj=bPb[&FǶ$itG V [Hbt#XB* U>#?pa3r𒍓~A_l";|7Yt`@w2nPUaٗ5i Z ܞDz.E4gsUg_ygC@4eq>8=(m >!珰=J+ۃ=Zh@L&i)4A vk.Ԣh$q3 jCԷPa9.$EF!Ot@Mpf/E m1˅'U9A%G (Px%S) ,mhbHih'O?臭zֶ|7_x@k*B 59׫;NKmV&f1㗲:nt[C2hAx NE@VH'US:: kЖKUgX̩)c3*JV?1%^~)1|'/p\(,Hm"H?A@Gy]n2_Q՛A5d%{x4`*`cl2fOсk#3>;$ b" r -(xEd}bTIo}HÝ'> GcA.t:on7`Lnk {Umg,7'e;) 9i f{} ^/Q[${yv;79.Yy&.1-hBj+;uLx.jB7QKcPk=%DBY  nի*dgNچ_dW`x{``MF8wE6̃Bk3qA<^_wW$UFBX.aNXt8SfȳtuUFٹz&a߄jy_FnY WpUL ỂbHut f- 2F3Z J%n= ߡ(hiܷڃW9ΛORP^ ''w?A`Laz(`X0}b#8cSݔ4V}Yvo K|9r =||$r_rM[ӞTUx=|MP^alQZ4ח,+Qլ:}}>|}-(%ϭZִrZL)qGč(;Wf)y.(x_u`UD^mԈma%d{Q!dwO2~)=FHSid怢m$i- !fF dEXl Ȯ[X@kݢj~:YE>5 DrΨdf~of,"#W2v#51VbZun6sޖbILPqVǽ2z E{ɪSb%5qi"|v+S>@8`%G8 Fvw u``NzL~H\ji\ޠ? %-柷Na2w[W:r$?j.psD 8")1.NlE(!8wTf4 l)|P?յG ىy0@ԟ k/?%z!?/M`@ϟIԯ'@Жuncaf"(h;oY#yw_PC@/V|ҽ-4lHam"T/*2Tk"V:Af@ȧ9/M/-ޗ?JRvD7,QYoZ z{hА."TY5Km/PdfI-3";K4]E@1?.Ueձʭ-Էm P"@ nO8O[rVL/ŜSITFiXcE]WSj9=7*T:x}_bvzB j)r'^Pg8Ƶˌ*ZJ'ѓk*҆Vґ׉C`B\u &ql-sJ5&{M 0n٘&fVH%^V c|cp EP(r#Hp -;MyBA &G LGMj| ^\#Y8r۫Sn/#qFVEn9 q+A|ʉiHCyB}B{ZIݏ\e  [i~9?Caz zUrQyNr5Zc60_ }/{Y6 DDY̳A; *{B [%AzzƩX0ދw?Nyi${[P5%a_b1T UKc]h!fY=cs4~\g+!a9b60W;`/d:͜F5-' zyl0%7^oo; jEt'N:4Oi>M5YdE8Cfr%c3N?( 'ᛥզRTUfpdw M&g!CX`T0orSGUb]hVk-n;ۦк=\w 3L9{^+_Soa Cd^xc"g&рI"{^U-%Rr7yҕ LHϢ 0qc/ S!ET(5c)1BƎI# 0(_qȾ`a輨M/".pN40';yaٸHi?(;CZᗘv/܆7ӱÓnƼ>Q7Bh(Re-jw5'K \n.ے^)XXOTi{&g̅`HK8` #l8~ I` 5sܱGLV>#d8^FB kzOdEA^\#>];Cוr~m|llq`9spvE#@%]=G`6KDʐPQHX_0.r| ],*IPڈ'WyoIR}rY}@EE]t>OuVi#A.`' v䶔etyvwvNHam❄/}4 ȖH0b \8D=`nm`T:IW'H+8 $hE%;` E}(/P4b +md+10ZRXAB휤1\2>F63S57 ާ{sJO{dWQC~(zc _5y Cddc$J(_OC@ " 07O-${MQgqL-_d_ !S>^'Ҹ_Bar%΄q=Ko&;~ԄT~DmLl&I߮63P?~w a8rPP.wWOgF3Ti 1M5=\f][̩o꟒oF"/9F}mCOC!N ? (X&Hn>׊ptw|- %y 껁(;#iޭ8t߇b!@7{ @YVOv/@U{ MV3i5W#'ȰVÑke^anu2Uw?[-;%m;$ cf8( 2T2bZg,uzT1w&16o FjHVZyjLRC~/v t,߷t*M . k|AT嶠5!=B,|&aeR1%i &c1\!^ rIyٍ 1p>d >Ӷ È0lrqn/ބkD؋V9ñ/ʴ1x(o}2X~$ŗ{sa0-!!))*\e0,Ъ?\Ԟ, T ͆_wޠ:xV^V!\uㇳQ#wE)/i߯zpIJ[̘v9F څ8/sgD)k)I/•fgni~/%p^QS$jlD!>Yye)CA9y+WMN҂z) Gl ыiWw@~˳PM xQ VA$ VWUnaX $K'{UahwdlkDMfdi~կI/07O,5jsI@v;M(BDHsnL )_}Oao.w+᪐r<}F+YEEYTNmHo |cD_sVjprn] `yE`۩11\"NB\rr,%@N2N/@g#\xnu"xMkXnD O?H{wv#uV_F*+ (=8 6RJf;tQZרխly ueXJh&pSF\l(vk07h)҅6*$gk %huUD,eI40ʸ"W ubIb~U^vSEFmG,lLHg3|hC\2US `ߡWc톹^9283Ia7b^~N#tq܇&3@~C/ ^A (lؑ0~foo䬘s`*4-K6%░#% =HI6oJ8@CzT¼pOWAZ:TUY5|ūZǵޯ:G:S%e=~jT&IQwP[]Dlvȸ!`Xi[)Y;LJ]5UkLD5$bI/T81q(TH9)[u/@3+gf-V*o` ('Md)P,2\K6ޠ_AP! NhÁ\yCMIP8CA<?f϶&`ued$zHܩóf(` ߨ5mw 5k*HiMuN{:_Cg7I3BfΌAT:lG()G%7j+z \D7bB ntgr9X7EXVn0!$Eˆ)^18FXJNFFPx)C_$;,NmdTJOëoxnn<UV6;]޻a<tb3<L(m tyl{nwe\R0+@`>x7T0}ȧm2羾-yy"SuwXkxoZc\]3򎿰€vzҰyBq3j'`CP=Ăm+NvH%6f(NAa =IϺ߶_撮d:枨 +}?pP+ObZjyb.H@@Z,Қ"-E4S֙)nIloIrB~>VofblqTL+*)9ܰX򮞢RVLf.v9Si.Ӡߦi>҅tFL+OuvV]93x2#O=2]K&ǟ/<~~^O?v)f=oEӵ4+4NrgU="Ҩ`g8k0=8}cQXӐTyGawY-WSVXNcF.xe~yU@0ј5?P=@!IXLQ6p΃yǔqoKK0 ڽ5dw$,ϰ/ t*Bv-:7ޚޱ ,p) @$:7ϴNy ]H 1hZfB1?ru3 BQ\}mc@!d SWz13]oCqF8"ΔԸGi[bUfg N[GLoŽĸWrndzx]D`Փl 9_] c~2p PI) *m~SHX~;t.R/G~'ͤ![<z8BOv5`9'5ɯ{6 g{qp-^3TIZd,= p4wB&Ob$ҿF%dN>7`xͥE{_ v"1.{$%r_m LPm=O%#so(%Iy4azn|n6lTAV'JA<șgmB`{u $ž9g;?q0T;2dB̰E}JBp} W[z?Z MΤ(y043w;S7x倳Nhȳ~ 9|*OC/}"6ʢ7ߓ+$W4xgaoHR^^A$e.{@鎠XӐ[HV8Wrs޼[d1~OPa`{ I8,v%ѷ%$K vGX YѤf 0nN&Qd# Ph H!x-ML.RN8D( `hz=Skc|j9{Б/Uڅ?AZX_f ؐ53eiEVmv° GJBnI[#Q")yq~ ruo7ӎbwO$26󦻬^lW%㽨:Y*F                              A@@A@@A@@@@A@@@@A@@@@@A@AA@@@@@@@@@@@@A@@@A@A@@@@AA@@A@@@A@@A@@@@A@A@@A@AA@AA@@AA@@@AAA@A@A@A@A@                              @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@                             libdes v 3.21 - 95/11/21 - eay  ##%%&&))**,,//1122447788;;==>>@@CCEEFFIIJJLLOOQQRRTTWWXX[[]]^^aabbddgghhkkmmnnppssuuvvyyzz||        0 0 0  0 0  0 0  0           0  0 0 0 0  0  0  0          $$   $ $$$   $ $            $$   $ $$$   $ $                0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0                            ((  ((  ((  ((  ((  ((  ((  ((           """"    " " " "((((((((    """"( ( ( ( ("("("("cryptopcryptodesccrypto_waitcryptof_ioctlcrydevcuio_copydata: off %d < 0cuio_copydata: len %d < 0iov_copydata: empty in skipcuio_copydata: emptycuio_copyback: off %d < 0cuio_copyback: len %d < 0cuio_copyback: empty in skipuio_copyback: emptycuio_apply: len %d < 0cuio_apply: off %d < 0cui_apply: ind %d >= uio_iovcnt %d for offcui_apply: ind %d >= uio_iovcnt %d for lenswcr_encdecswcr_authcomputeSoftware crypto device cannot initialize!DES3DESBlowfishCAST-128SkipjackRijndael-128/AESARC4NULLHMAC-MD5HMAC-SHA1HMAC-RIPEMD-160HMAC-SHA2-256HMAC-SHA2-384HMAC-SHA2-512Keyed MD5Keyed SHA1MD5SHA1DeflateLZSbind failed krpc_call: sosend: %d RPC timeout for server 0x%x rpc denied, error=%d rpc denied, status=%d vm_map_lock_read: intrsafe mapnfs_read modenfsbioread nfsbioread: type %x unexpected nfs_write modenfs_write procnfsvinvalProcess killed due to text file modification nfs_doio: type %x unexpected nfs_boot: no suitable interfacenfs_boot: using network interface '%s' nfs_boot: socreate, error=%dnfs_boot: GIFFLAGS, error=%dnfs_boot: SIFFLAGS, error=%drevarp failed, error=%dnfs_boot: client_addr=%s nfs_boot: set if addr, error=%dnfs_boot: bootparam whoami, error=%dnfs_boot: server_addr=%s hostname=%s nfs_boot_initnfs_boot: bootparam get %s: %d nfs_boot: mountd %s, error=%d nfs_boot: portmap NFS/v2, error=%d nfs_boot_getfhnfs_boot: bootparam_whoami: bad reply nfs_boot: bootparam_getfile: bad reply vm_map_lock_read: intrsafe mapnfs_hashlocknfsnodeplnfs_inactive: pushing activenfs_reclaim: pushing activevm_map_lock_read: intrsafe mapbuild > MLENnfsrv3_accessnfsrv_getattrnfsrv_setattrnfsrv_lookupnfsrv_readlinknfsrv_read iovnfsrv_readnfsrv_writenfsrv_write: nd_mrep not freenfsrvw_coalescenfsrv_coalesce: bad offnfsrv_createnfsrv_mknodnfsrv_removenfsrv_renamenfsrv_linknfsrv_symlinknfsrv_mkdirnfsrv_rmdirnfsrv_readdirnfsrv_readdirplusnfsrv_commitnfsrv_statfsnfsrv_fsinfonfsrv_pathconfvm_map_lock_read: intrsafe mapnfsconnfscon sotypenfs send error %d for server %s nfsd send error %d short receive (%d/%d) from nfs server %s %s (%d) from nfs server %s impossible packet lengthEgad!! receive error %d from nfs server %s nfsreply nilis alive againnqnfstrynfs_requestbuild > MLENnot respondingnfsndlcknfs sndunlocknfsrcvlknfs rcvunlockBad kerb verifier Not fullname kerb verifier Kerb nickname short Kerb nick verifier bad nfs server %s: %s nfs getstreamnfsd wakeupvm_map_lock_read: intrsafe mapnfsrcnfsrv cachevm_map_lock_read: intrsafe mapbuild > MLENnfsm_uiotombuf: iovcnt != 1nfs S too bigvm_map_lock_read: intrsafe mapcld kerbnqnfstimrnfsd initnfsdmbuf siz=%d Bad nfs svc replynfsidlnfsionfsauth1nfsauth2nfs_getnickauth verf too smallvm_map_lock_read: intrsafe map\p(10build > MLENrootnfs_mountroot: root/root on %s nfs_mountroot: getattr for rootnfs_mountroot: can't setup swap vpswap on device 0x%x swap/swapnfs_mountroot: getattr for swap swap on %s WARNING: no swap nfs_mountrootnfsnfs_mount_diskless: vfs_rootmountalloc failednfs_mountroot: mount %s failed: %dnfs_args: retrying connect nfsconnfs_mountnfsdismvm_map_lock_read: intrsafe mapbuild > MLENopen eacces vtyp=%d EEK! readdirrpc resid > 0 EEK! readdirplusrpc resid > 0 nfs: sillyrename dir .nfsA%05x4.4nfs physio/asyncnfsfsyncnfs_fsync: not dirtynfs_fsynctag VT_NFS, fileid %ld fsid 0x%lx bwrite: buffer is not busy???vm_map_lock_read: intrsafe mapdev = 0x%x, bsize = %d, size = %d, fs = %s ffs_alloc: bad sizeffs_alloc: missing credentialfile system full %s: write failed, file system is full dev = 0x%x, bsize = %d, osize = %d, nsize = %d, fs = %s ffs_realloccg: bad sizeffs_realloccg: missing credentialdev = 0x%x, bsize = %d, bprev = %d, fs = %s ffs_realloccg: bad bprevffs_realloccg: bad blockno%s: optimization changed from SPACE to TIME %s: optimization changed from TIME to SPACE dev = 0x%x, optim = %d, fs = %s ffs_realloccg: bad optimffs_reallocblks: unallocated block 1ffs_reallocblks: non-logical clusterffs_reallocblks: non-physical cluster %dffs_reallocblk: start == endffs_reallocblks: unallocated block 2ffs_reallocblks: alloc mismatchffs_reallocblks: unallocated block 3 %d,mode = 0%o, inum = %d, fs = %s ffs_valloc: dup allocfree inode %s/%d had %d blocks out of inodes %s: create/symlink failed, no inodes free pos = %d, i = %d, fs = %s ffs_alloccgblk: cyl groups corruptedffs_alloccgblk: can't find blk in cylffs_clusteralloc: map mismatchffs_clusteralloc: allocated out of groupffs_clusteralloc: lost blockcg = %d, irotor = %d, fs = %s ffs_nodealloccg: map corruptedfs = %s ffs_nodealloccg: block not in mapdev = 0x%x, bsize = %d, size = %ld, fs = %s ffs_blkfree: bad sizebad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s ffs_blkfree: freeing free blockffs_blkfree: freeing free fragffs_freefile: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ffs_freefile: freeing free inodebsize = %d, size = %ld, fs = %s ffs_checkblk: bad sizeffs_checkblk: bad block %dffs_checkblk: partially free fragmentstart = %d, len = %d, fs = %s ffs_alloccg: map corruptedbno = %d, fs = %s ffs_alloccg: block not in mapuid %u on %s: %s vm_map_lock_read: intrsafe mapffs_balloc: blk too bigffs_balloc: ufs_bmaparray returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapffs_update: bad link cntffs_truncate: partial truncate of symlinkffs_truncate: newspaceffs_truncate1ffs_truncate2ffs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapffs_isblockffs_clrblockffs_setblockffs_isfreeblock?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@vm_map_lock_read: intrsafe mapVLg,LKPi<jlDnoHq(qM$ cffs_mountroot: can't setup bdevvp'sffsroot_deviceWARNING: %s was not properly unmounted WARNING: R/W mount of %s denied. Filesystem is not clean - run fsck ffs_reload: dirty2ffs_reload: dirty1ffs_statfsfs = %s update: rofs modinodeffsinovm_map_lock_read: intrsafe map%s: modeffs_read%s: short symlink%s: type %dffs_write%s: nonsync dir write%s: typeffs_fsync: not dirtyffs_fsyncffs_fsync: dirtyvm_map_lock_read: intrsafe mapdirremmkdirdiraddfreefilefreeblksfreefragallocindirindirdepallocdirectbmsafemapnewblkinodedeppagedepinvalidsema_release: not heldsoftdep_free: unknown type %dadd_to_worklist: already on list%s_process_worklist: Unknown type %ssoftdep???softdep_move_dependencies: need merge codesoftflushpagedepplinodedepplnewblkplbmsafemapplallocdirectplindirdepplallocindirplfreefragplfreeblksplfreefilepldiraddplmkdirpldirremplsoftdep_setup_inomapdep: found inodesoftdep_setup_blkmapdep: found blocksoftdep_setup_allocdirect: lost blocksoftdep_setup_allocdirect: Bonk art in the headsoftdep_setup_allocdirect: non-zero indirsoftdep_setup_allocdirect: lost entryallocdirect_check: old %d != new %d || lbn %ld >= %dnewfreefrag: frag sizesoftdep_setup_allocindir_page: Bonk art in the headsetup_allocindir_phase2: not indir blksetup_allocindir: lost blocksetup_allocindir_phase2: blknosoftdep_setup_freeblocks: non-zero lengthsoftdep_setup_freeblockssoftdep_setup_freeblocks: inode busydeallocate_dependencies: already gonedeallocate_dependencies: not indirdeallocate_dependencies: Unexpected type %sdeallocate_dependencies: Unknown type %scheck_inode_unwritten: busy inodehandle_workitem_freeblocks: block count handle_workitem_freeblksindir_trunc: lost indirdepindir_trunc: dangling depfree_diradd: unfound refnewdirrem: whiteoutnewdirrem: not ATTACHEDnewdirrem: inum %d should be %dsoftdep_change_linkcnt: bad deltahandle_workitem_remove: vgethandle_workitem_remove: lost inodedephandle_workitem_remove: bad file deltahandle_workitem_remove: bad dir deltahandle_workitem_remove: truncatehandle_workitem_freefilesoftdep_disk_io_initiation: readdisk_io_initiation: indirdep gonehandle_disk_io_initiation: Unexpected type %sinitiate_write_filepage: already started %s: dir inum %d != new %dinitiate_write_filepageinitiate_write_inodeblock: already startedinitiate_write_inodeblock: already doing I/Osoftdep_write_inodeblock: lbn order%s: direct pointer #%ld mismatch %d != %dsoftdep_write_inodeblock%s: indirect pointer #%ld mismatch %d != %dsoftdep_write_inodeblock: Unknown state 0x%xsoftdep_write_inodeblock: lost dep1softdep_write_inodeblock: lost dep2disk_write_complete: indirdep gonedisk_write_complete: not gonehandle_disk_write_complete: Unknown type %shandle_allocdirect_partdone: dangling dephandle_allocindir_partdone: dangling dependencyhandle_written_inodeblock: not startedhandle_written_inodeblock: new entry%s: %s #%ld mismatch %d != %dhandle_written_inodeblockdirect pointer%s: %s #%ld allocated as %dindirect pointerhandle_written_inodeblock: bad sizehandle_written_inodeblock: filefreehandle_written_inodeblock: Unknown type %shandle_written_inodeblock: live inodedephandle_written_mkdir: bad typehandle_written_filepage: not startedhandle_written_filepage: attachedsoftdep_update_inodeblock: bad link countsoftdep_update_inodeblock: bad deltasoftdep_update_inodeblock: bwritesoftdep_update_inodeblock: update failedsoftdep_fsync: pending opssoftdep_fsync: Unexpected type %ssoftdep_fsync: dirtysoftdep_fsync_mountdev: vnode not a disksoftdep_fsync_mountdev: not dirtysoftdep_sync_metadata: Unknown type %sflush_pagedep_deps: MKDIR_PARENTflush_pagedep_deps: MKDIR_BODYflush_pagedep_deps: lost inodeflush_pagedep_deps: flush failedrequest_cleanup: unknown typesoftupdateclear_remove: vgetclear_remove: fsyncclear_inodedeps: vgetclear_inodedeps: fsync1clear_inodedeps: fsync2softdep_check_for_rollback: Unexpected type %ssdsdtydrain_outputsoftdep_deallocate_dependencies: dangling depssoftdep_deallocate_dependencies: unrecovered I/O error%s: got error %d while accessing filesystem vm_map_lock_read: intrsafe map ( Pg,LKPjlDnoHq cmfs_mountroot: can't setup bdevvp'smfsmfs_rootmfs_mount: dup devmfsidlvm_map_lock_read: intrsafe mapmfs_open not VBLKmfs_strategy: bad devmfs_close: ref count %d > 1 mfs_close: dirty buffers mfs_closemfs_inactive: not inactive (mfs_buflist %p)tag VT_MFS, pid %d, base %p, size %ld mfs_badop calledvm_map_lock_read: intrsafe mapufs_bmaparray: invalid argumentsufs_bmaparray: indirect block not in cacheufs_getlbns: Invalid indirect block %d specifiedufs_getlbns: indirect block %d not foundvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapffs_inactive: pushing activeufs_reclaim: pushing activevm_map_lock_read: intrsafe mapmangled entryi_ffs_size too small%s: bad dir ino %d at offset %d: %s bad dirFirst bad Second bad ufs_makedirentry: missing nameufs_direnter: newblkufs_direnter: compact1ufs_direnter: compact2checkpath: .. not a directory vm_map_lock_read: intrsafe mapundefinedgroupuserchkdqufs_quota_free_blocks2: vnode is not locked %s: write failed, %s disk limit reached %s: warning, %s %s disk quota exceeded %s: write failed, %s %s disk quota exceeded for too longchkiq %s: write failed, %s inode limit reached inode quota exceededinode quota exceeded for too longchkdquot: vnode is not lockedchkdquot: missing dquotmissing dquotquotaon: mount point not busyquotaoff: mount point not busysetquotasetusedquotfree dquot isn'tdqsync: dquotdqsync: filedqsyncvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapchown: lost quotaufs_link: no nameufs_linkufs_whiteout: missing nameufs_whiteout: old format filesystemufs_whiteout: unknown opufs_whiteoutufs_rename: no nameufs_rename: lost from startdirufs_rename: lost to startdirrename: EXDEVufs_rename: same fileufs_rename: lost dir entryufs_renameufs_mkdir: no nameufs_mkdirufs_readdir: lost in spaceufs_strategy: spectag VT_UFS, ino %d, on dev %d, %d flags 0x%x, effnlink %d, nlink %d mode 0%o, owner %d, group %d, size %lld ufs_makeinode: no nameufs_makeinodevm_map_lock_read: intrsafe mapext2fs_alloc: missing credentialfile system full %s: write failed, file system is full mode = 0%o, nlinks %d, inum = %d, fs = %s ext2fs_valloc: dup allocout of inodes %s: create/symlink failed, no inodes free ext2fs_alloccgblk: cg=%d bno=%d fs=%s ext2fs_alloccg: dup alloccg = %d, ipref = %d, fs = %s ext2fs_nodealloccg: map corruptedfs = %s ext2fs_nodealloccg: block not in mapbad block %d, ino %d bad blockdev = 0x%x, block = %d, fs = %s blkfree: freeing free blockifree: range: dev = 0x%x, ino = %d, fs = %sdev = 0x%x, ino = %d, fs = %s ifree: freeing free inodestart = %d, len = %d, fs = %s ext2fs_alloccg: map corruptedext2fs_mapsearch: block not in mapuid %d on %s: %s vm_map_lock_read: intrsafe mapext2fs_balloc: ufs_getlbns returned indirect blockCould not unwind indirect block, error %dvm_map_lock_read: intrsafe mapext2fs_bmaparray: invalid argumentsext2fs_bmaparray: num=%d ext2fs_bmaparray: numext2fs_bmaparry: indirect block not in cachevm_map_lock_read: intrsafe mapext2fs_inactive: pushing activeext2fs_truncate: partial truncate of symlinkext2fs_truncate1ext2fs_truncate2ext2fs_truncate3ext2fs_indirtrunc: bad buffer sizevm_map_lock_read: intrsafe mapext2fs: e2dir->e2d_namlenext2fs_readdirmangled entryi_size too smallrec_len is smaller than minimalrec_len % 4 != 0reclen is too small for name_lendirectory entry across blocksinode out of boundsbad directory entry: %s offset=%d, inode=%lu, rec_len=%d, name_len=%d ext2fs_dirbadentrydirenter: missing nameext2fs_direnter: newblkext2fs_direnter: frag sizeext2fs_direnter: compact1ext2fs_direnter: compact2 %u %uext2fs_direnter: compact2ext2fs_direntercheckpath: .. not a directory checkpathvm_map_lock_read: intrsafe map%s: modeext2fs_read%s: short symlink%s: type %dext2fs_write%s: nonsync dir write%s: typevm_map_lock_read: intrsafe mapDisk overlap start %d, end %d overlap start %d, end %ld Disk buffer overlapvm_map_lock_read: intrsafe mapLެLKP4x<M$ cext2fs_mountroot: can't setup bdevvp'sext2fsroot_device%s: file system not clean; please fsck(8) ext2fs_reload: dirty2ext2fs_reload: dirty1ext2fs_statfsfs = %s update: rofs modinodeExt2 fs: unsupported revision number: %x Ext2 fs: bad block size: %d (expected <=2 for ext2 fs) Ext2 fs: unsupported inode size Ext2 fs: unsupported optional feature vm_map_lock_read: intrsafe mapext2fs_link: no nameext2fs_rename: no nameext2fs_rename: lost from startdirext2fs_rename: lost to startdirrename: EXDEVrename: same filerename: linked directoryext2fs_rename: lost dir entryext2fs_rename: mangled dirext2fs_mkdir: no nameext2fs_mkdir: blksizeext2fs_makeinode: no nameext2fs_reclaim: pushing activevm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap_i.h(( offset) & (PAGE_SIZE - 1)) == 0amap_lookup: offset out of rangeamap_lookups: offset out of rangeamap_add: offset out of rangeamap_add: replacing null anonamap_add: slot in useamap_unadd: offset out of rangeamap_unadd: nothing therevm_map_lock_read: intrsafe mapamappl/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_amap.c(( sz) & (PAGE_SIZE - 1)) == 0(( padsz) & (PAGE_SIZE - 1)) == 0amap->am_ref == 0 && amap->am_nused == 0(( entry->end - entry->start) & (PAGE_SIZE - 1)) == 0(( addsize) & (PAGE_SIZE - 1)) == 0amap->am_maxslot < slotneed(( (entry->end - entry->start)) & (PAGE_SIZE - 1)) == 0amap_wipeout: corrupt amapamap_cow_now: non-resident wired page in anon %pcownowcownowpageamap_splitref: split at zero offsetamap_splitref: map size check failedamap_pp_adjref: overshot targetamap_pp_adjref: negative reference countvm_map_lock_read: intrsafe mapuvm_anon_add: can not allocate %d anons uvm_anon_adddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_anon.cpg->loan_count > 0anon_pagein: uvmfault_anonget -> %dvm_map_lock_read: intrsafe mapuao_set_swslot: uobj = %p uao_set_swslot: attempt to set a slot on a NOSWAP objectdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_aobj.cslot == 0uao_create: kernel object already allocateduao_create: asked to enable swap on kernel objectuao_create: hashinit swhash faileduao_create: malloc swslots faileduaoeltplaobjpluao_flush: strange, got an out of range flush (fixed) uao_flush: weird flagsuao_getpageuao_getpg->flags & PG_RELEASEDaobj->u_obj.uo_refs == 0TAILQ_EMPTY(&aobj->u_obj.memq)(pg->flags & PG_RELEASED) == 0vm_map_lock_read: intrsafe mapudv_attachdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_device.cuobj->uo_npages == 0 && TAILQ_EMPTY(&uobj->memq)udv_detachudv_faultvm_map_lock_read: intrsafe mapfltamapcopyanonget1anonget2flt_noram1diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_fault.cresult != VM_PAGER_PENDuvmadvice[ufi.entry->advice].advice == ufi.entry->advice(pages[lcv]->flags & PG_RELEASED) == 0uvm_fault: uvmfault_anonget -> %dflt_noram2uvmexp.swpgonly <= uvmexp.swpagesflt_noram3flt_pmfail1uobjpage != PGO_DONTCAREfltagain2uobj->pgops->pgo_releasepg != NULLflt_noram4uvm_fault: want to promote data, but no anonflt_noram5flt_pmfail2(map->flags & VM_MAP_INTRSAFE) == 0start >= vm_map_min(map) && end <= vm_map_max(map)uvm_fault_unwire_locked: address not in mapuvm_fault_unwire_locked: unwiring non-wired memoryva >= entry->startentry->next != &map->header && entry->next->start <= entry->endvm_map_lock_read: intrsafe mapuvm_fork: uvm_fault_wire failed: %duvm_swapin: uvm_fault_wire failed: %dschedulerschedpwaitvm_map_lock_read: intrsafe mapuvm_init: page size not setvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapuvm_km_init: could not reserve space for kerneluvm_km_suballoc: unable to allocate space in parent mapuvm_km_suballoc: unable to create submapuvm_km_suballoc: submap allocation faileddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_km.cuobj->pgops == &aobj_pagerUVM_OBJ_IS_INTRSAFE_OBJECT(uobj)(pp->flags & PG_BUSY) == 0(pp->pqflags & PQ_ACTIVE) == 0(pp->pqflags & PQ_INACTIVE) == 0vm_map_pmap(map) == pmap_kernel()km_getwait2uvm_km_alloc1: non-released pagekm_allockm_alloc1wvallocwaitvm_map_lock_read: intrsafe mapuvm_loan: intrsafe maploanagainfltagain2uvm_loanuobj: object has no releasepg functionloanzero1loanzero2uvm_unloanpage: page %p isn't loaneduvm_unloanpage: page %p unowned but PG_BUSY!vm_map_lock_read: intrsafe mapvmmaplkvmmapbsydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_map.cnextuvm_rb_insert: duplicate entry?%s: %d/%d ownspace %x != %x %s (last)%s: space %d != %d %s: corrupt: 0x%lx >= 0x%lx %s: nentries: %d vs %d %s: lookup: %d: %p - %p: %p uvm_mapent_alloc: out of static map entries, check MAX_KMAPENT (currently %d)uvm_mapent_allocuvm_mapent_free# uvm_map() successful calls# uvm_map() back merges# uvm_map() missed forward# map lookup calls# map lookup hint hitsvmspplvmmpeplvmmpekplUVM_OBJ_IS_KERN_OBJECT(uobj)(align & (align - 1)) == 0(flags & UVM_FLAG_FIXED) == 0 || align == 0tmp && tmp->space >= lengthvm_map_pmap(map) == pmap_kernel()!VM_MAPENT_ISWIRED(first_entry)uvm_map_replace1tmpent->start=0x%lx, tmpent->end=0x%lx, end=0x%lx uvm_map_replace2uvm_map_replace3uvm_map_replace4uvm_map_replace5(start & PAGE_MASK) == 0 && (len & PAGE_MASK) == 0(flags & UVM_EXTRACT_REMOVE) == 0 || (flags & (UVM_EXTRACT_CONTIG|UVM_EXTRACT_QREF)) == 0map->flags & VM_MAP_PAGEABLEvm_map_upgrade: failed to upgrade lockuvm_map_pageable: stale mapuvm_map_pageable_all: stale map(flags & (PGO_FREE|PGO_DEACTIVATE)) != (PGO_FREE|PGO_DEACTIVATE)start >= current->startpg->uobject == NULLpg->uanon == anonuvm_map_clean: weird flagsfork: encountered a submap during fork (illegal)fork: non-copy_on_write map entry marked needs_copy (illegal)MAP %p: [0x%lx->0x%lx] #ent=%d, sz=%u, ref=%d, version=%u, flags=0x%x pmap=%p(resident=%d) - %p: 0x%lx->0x%lx: obj=%p/0x%llx, amap=%p/%d submap=%c, cow=%c, nc=%c, prot(max)=%d/%d, inh=%d, wc=%d, adv=%d OBJECT %p: locked=%d, pgops=%p, npages=%d, refs= refs=%d PAGES : <%p,0x%llx> BUSYWANTEDTABLEDCLEANCLEANCHKRELEASEDFAKERDONLY ZERO PAGER1FREEINACTIVEACTIVELAUNDRYANONAOBJPAGE %p: %b flags=%s, pqflags=%s, vers=%d, wire_count=%d, pa=0x%lx uobject=%p, uanon=%p, offset=0x%llx loan_count=%d [page ownership tracking disabled] >>> ANON DOES NOT POINT HERE <<< (%p) anon backpointer is OK checking object list page found on object list >>> PAGE NOT FOUND ON OBJECT LIST! <<< checking pageq list page found on pageq list >>> PAGE NOT FOUND ON PAGEQ LIST! <<< uvm_page_printitvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_mmap.c!UVM_ET_ISSUBMAP(entry)start >= entry->start!UVM_OBJ_IS_KERN_OBJECT(entry->object.uvm_obj)vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page_i.hpg->wire_count == 0lcv != -1/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_page.c(pg->flags & PG_TABLED) == 0pg->flags & PG_TABLEDuvm_page_bootstrap: no memory pre-allocateduvm_page_init: lost %ld page(s) in init uvm_page_inituvm_setpagesize: page size not a power of twouvm_pageboot_alloc: out of virtual spaceuvm_pageboot_alloc: out of memoryuvm_page_physget: called _after_ bootstrapuvm_page_physget: out of memory!uvm_page_physload: page size not set!uvm_page_physload: bad free list %duvm_page_physload: start >= enduvm_page_physload: unable to load physical memory segment %d segments allocated, ignoring 0x%llx -> 0x%llx increase VM_PHYSSEG_MAX uvm_page_physload: tried to add RAM after vm_mem_inituvm_page_physrehash: WARNING: could not grow page hash table rehash: physical memory config [segs=%d of %d]: 0x%llx->0x%llx [0x%llx->0x%llx] STRATEGY = RANDOM BSEARCH BIGFIRST <>!!!! number of buckets = %d obj == NULL || anon == NULLoff == trunc_page(off)free_list >= 0 && free_list < VM_NFREELISTuvm_pagealloc_strat: bad strat %dsaved_loan_count == 0vm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager_i.hrvpg != NULLemergva/usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pager.cnpages <= MAXBSIZE >> PAGE_SHIFTpager_mappppp->flags & PG_BUSY!uobj || obj_is_aliveuvm_aio_biodoneuvm_aio_aiodoneswap || pg->uobject == uobj!write || (pgs[i]->flags & PG_FAKE) == 0vm_map_lock_read: intrsafe mappagedaemon: deadlock detected! pgdaemonaiodoneddiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pdaemon.canon != NULLp->loan_count > 0uobj != NULLanon->an_swslot != 0uvmexp.swpgonly <= uvmexp.swpagesuvmexp.swpginuse <= uvmexp.swpagespagedaemon: pageout returned invalid 'unlock' codep->uanon != NULLvm_map_lock_read: intrsafe mapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_pglist.c(alignment & (alignment - 1)) == 0(boundary & (boundary - 1)) == 0(m->pqflags & (PQ_ACTIVE|PQ_INACTIVE)) == 0vm_map_lock_read: intrsafe map%s = %d Current UVM status: pagesize=%d (0x%x), pagemask=0x%x, pageshift=%d %d VM pages: %d active, %d inactive, %d wired, %d free min %d%% (%d) anon, %d%% (%d) vnode, %d%% (%d) vtext pages %d anon, %d vnode, %d vtext freemin=%d, free-target=%d, inactive-target=%d, wired-max=%d faults=%d, traps=%d, intrs=%d, ctxswitch=%d softint=%d, syscalls=%d, swapins=%d, swapouts=%d fault counts: noram=%d, noanon=%d, pgwait=%d, pgrele=%d ok relocks(total)=%d(%d), anget(retrys)=%d(%d), amapcopy=%d neighbor anon/obj pg=%d/%d, gets(lock/unlock)=%d/%d cases: anon=%d, anoncow=%d, obj=%d, prcopy=%d, przero=%d daemon and swap counts: woke=%d, revs=%d, scans=%d, obscans=%d, anscans=%d busy=%d, freed=%d, reactivate=%d, deactivate=%d pageouts=%d, pending=%d, nswget=%d nswapdev=%d, nanon=%d, nanonneeded=%d nfreeanon=%d swpages=%d, swpginuse=%d, swpgonly=%d paging=%d kernel pointers: objs(kern/kmem/mb)=%p/%p/%p vm_map_lock_read: intrsafe mapswapsysuvm_swap_init: can't get vnode for swap deviceswapmapuvm_swap_init: extent_create failedswp vnxswp vndswapdrum_addminirootswapctl: miniroot copy failedswapctl: copystrsys_swapctlswap0x%04xdisklabel regionswap_on: miniroot larger than swap?swap_on: unable to preserve minirootPreserved %d pages of miniroot leaving %d pages of swap diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../uvm/uvm_swap.csdp->swd_npginuse == sdp->swd_npgbadswap_off: swapdev not in listswstrategy: vnode type 0x%xsw_reg_strategy: swap to sparse filesw_reg_iodonevnx->vx_pending == 0uvmexp.nswapdev >= 1sdp != NULLsdp->swd_npginuse >= nslotswarning: resource shortage: %d pages of swap lost flags & PGO_SYNCIOswapmount: no device swapmount: no device 2 swap_deviceswapmount: copystrvm_map_lock_read: intrsafe mapswap_decrypt: key not initializedvm_map_lock_read: intrsafe mapsbrk: grow %ld failed, error = %d uvm_coredump: user process with submap?vm_map_lock_read: intrsafe mapuvm_deallocate with null mapvm_map_lock_read: intrsafe mapuvnsyncuvn_attach: blocked at 0x%p flags 0x%x uvn_attachuvn_deref: vnode VM object still has pages afer syncio/free flushuvn_termuvm_vnp_terminate: io sync wanted bit setuvn_releasepg: page not released!uvn_releasepg: kill flag set on referenced object!uvn_releasepg: pages in object with npages == 0uvn_flush: PGO_SYNCIO return 'try again' error (impossible)uvn_flush: obj=%p, offset=0x%llx. error during pageout. uvn_flush: WARNING: changes to page may be lost! uvn_flushuvn_cluster: offset out of rangeuvn_getpageuvn_getuvn_iosyncin6_pcbconnectHuh? Thought in6_pcbnotify() never got called with mapped! in6_pcbnotifygif%dgif_startgif_output: recursively called too many times gif_outputNULL pointer passed to ip_ecn_ingressNULL pointer passed to ip_ecn_egressNULL pointer passed to ip6_ecn_ingressNULL pointer passed to ip6_ecn_egressin_gif_outputin6_gif_outputin6_ifloop_request: %s operation failed for %s (errno=%d) ADDDELETEin6_ifloop_requestprefix ioctls are now invalidated. please use ifconfig. nd6_prelist_add succeeded but no prefix in6_controlin6_update_ifa: a destination can be specified for a p2p or a loopback IF only in6_update_ifa: prefixlen should be 128 when dstaddr is specified in6_update_ifa: valid lifetime is 0 for %s in6_update_ifa: the prefix length of an existing (%s) address should not be changed in6_update_ifa: failed to remove a route to the old destination: %s in6_update_ifa: addmulti failed for %s on %s (errno=%d) in6_update_ifain6_purgeaddr: failed to remove a route to the p2p destination: %s on %s, errno=%d Couldn't unlink in6_ifaddr from in6_ifaddr in6_unlink_ifa: autoconf'ed address %p has no prefix invalid argument to in6_lifaddr_ioctlin6_lifaddr_ioctlin6_savemkludge: no kludge spacein6_addmultiin6_delmultiin6_are_prefix_equal: invalid prefix length(%d) in6_prefixlen2mask: invalid prefix length(%d) in6_prefixlen2maskin6_ifawithscope: output interface is not specified get_rand_ifid%s: got interface identifier from itself %s: got interface identifier from %s %s: borrow interface identifier from %s %s: interface identifier generated by random number %s: failed to get interface identifier %s: ifid: %02x:%02x:%02x:%02x:%02x:%02x:%02x:%02x %s: no ifid available in6_ifattach_linklocal: failed to configure a link-local address on %s (errno=%d) ia == NULL in in6_ifattach_linklocalin6_ifattach_linklocalin6_ifattach_loopback: failed to configure the loopback address on %s (errno=%d) in6_ifattach_loopbackin6_nigroupbridgein6_ifattach: %s has too small MTU, IPv6 not enabled in6_ifattach: %s is not multicast capable, IPv6 not enabled in6_ifattach%s: didn't unlink in6ifaddr from list in6_ifdetachin6_cksum: mbuf len (%d) < off+len (%d+%d)in6_cksum: out of datainternet6m_pulldown malfunctionm_pulldown malfunction%s:%d: ip6q already locked /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/frag6.cip6q_lock%s:%d: ip6q lock not held ip6q lock checkicmp6_mtudisc_callback_registerm_pulldown malfunctionENOBUFS in icmp6_error %d ICMP6 checksum error(%d|%x) %s icmp6_input: unknown type %d(src=%s, dst=%s, ifid=%d) icmp6_notify_error: in6_embedscope failed icmp6_notify_erroricmp6_mtudisc_updateni6_inputshould not reach hereicmp6_rip6_inputsanity fail: off=%lx, sizeof(ip6)=%lx in %s:%d /usr/src/sys/arch/sparc/compile/GENERIC/../../../../netinet6/icmp6.cassumption failed in icmp6_reflecticmp6_reflect: source can't be determined: dst=%s, error=%d icmp6_reflect(src=%s dst=%s tgt=%s)ICMP6 redirect sent from %s rejected; must be from linklocal ICMP6 redirect sent from %s rejected; hlim=%d (must be 255) ICMP6 redirect rejected; no route with inet6 gateway found for redirect dst: %s ICMP6 redirect rejected; not equal to gw-for-src=%s (must be same): %s ICMP6 redirect rejected; no route found for redirect dst: %s ICMP6 redirect rejected; redirect dst must be unicast: %s ICMP6 redirect rejected; neither router case nor onlink case: %s icmp6_redirect_input: invalid ND option, rejected: %s icmp6_redirect_input: lladdrlen mismatch for %s (if %d, icmp6 packet %d): %s icmp6_redirect_inputicmp6_redirect_outputicmp6_mtudisc_timeout: bad route to timeouticmp6_redirect_timeout: bad route to timeoutip6_initip6_input: packet to an unready address %s->%s m_pulldown malfunctionip6_inputip6_savecontrolip6_pullexthdr: invalid nxt=%d ip6_nexthdr: m == NULLip6_nexthdrOpenBSD-currentcannot forward from %s to %s nxt %d received on %s ip6_forward: tag of length %d (should be %dcannot forward src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forward: outgoing interface is loopback. src %s, dst %s, nxt %d, rcvif %s, outif %s ip6_forwardip6_mrouter_doneregister_mifadd_m6ifdel_m6ifadd_m6fc: %s o %s g %s p %x dbx %p multiple kernel entriesdel_m6fccannot forward from %s to %s nxt %d received on %s ip6_mforward: ip6_mrouter socket queue full m_pulldown malfunctionip6_output: IPv4 pcb is passedip6_output: tag of length %d (should be %dassumption failed: hdr not splitip6_outputip6_ctloutputip6_setmoptionsip6_setpktoptionsm_pulldown malfunctionip6_rthdr0m_pulldown malfunctionnd6_init called more than once(ignored) nd6_setmtu0: new link MTU on %s (%lu) is too small for IPv6 ndopts == NULL in nd6_optionuninitialized ndopts in nd6_optionndopts == NULL in nd6_optionsuninitialized ndopts in nd6_optionsduplicated ND6 option found (type=%d) nd6_options: unsupported option %d - option ignored too many loop in nd opt ln->ln_rt == NULLln->ln_rt->rt_ifp == NULLrt_llinfo(%p) is not equal to ln(%p)dst=0 in nd6_timer(ln=%p)nd6_lookup: failed to lookup %s (if = %s) unspecnd6_lookupnd6_freend6_rtrequest: bad gateway value: %s nd6_rtrequest: malloc failed %s: failed to join %s (errno=%d) nd6_rtrequestdefault router list contains a non-linklocal address(%s) a router(%s) advertises a prefix with non-link local address nd6_ioctlifp == NULL in nd6_cache_lladdrfrom == NULL in nd6_cache_lladdrnd6_output: can't allocate llinfo for %s (ln=%p, rt=%p) nd6_storelladdr: something odd happens nd6_storelladdr: sdl_alen == 0, dst=%s, if=%s scope error in prefix list (%s) m_pulldown malfunctionnd6_ns_input: invalid hlim (%d) from %s to %s on %s nd6_ns_input: bad DAD packet (wrong ip6 dst) nd6_ns_input: bad NS target (multicast) nd6_ns_input: invalid ND option, ignored nd6_ns_input: bad DAD packet (link-layer address option) nd6_ns_input: lladdrlen mismatch for %s (if %d, NS packet %d) nd6_ns_input: duplicate IP6 address %s nd6_ns_input: src=%s nd6_ns_input: dst=%s nd6_ns_input: tgt=%s nd6_ns_inputnd6_ns_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_ns_output: insufficient MCLBYTESnd6_ns_output: source can't be determined: dst=%s, error=%d nd6_ns_outputnd6_na_input: invalid hlim (%d) from %s to %s on %s nd6_na_input: invalid target address %s nd6_na_input: a solicited adv is multicasted nd6_na_input: invalid ND option, ignored nd6_na_input: duplicate IP6 address %s nd6_na_input: lladdrlen mismatch for %s (if %d, NA packet %d) nd6_na_inputnd6_na_output: max_linkhdr + maxlen >= MCLBYTES (%d + %d > %d) nd6_na_output: insufficient MCLBYTESnd6_na_output: source can't be determined: dst=%s, error=%d nd6_na_outputnd6_dad_start: called with non-tentative address %s(%s) ???nd6_dad_start: ifa->ifa_ifp == NULLnd6_dad_start: memory allocation failed for %s(%s) %s: starting DAD for %s nd6_dad_timer: called with null parameter nd6_dad_timer: DAD structure not found nd6_dad_timer: called with duplicated address %s(%s) nd6_dad_timer: called with non-tentative address %s(%s) %s: could not run DAD, driver problem? %s: DAD complete for %s - no duplicates found nd6_dad_duplicated: DAD structure not found %s: DAD detected duplicate IPv6 address %s: NS in/out=%d/%d, NA in=%d %s: DAD complete for %s - duplicate found %s: manual intervention required ifa == NULL in nd6_dad_ns_inputnd6_dad_ns_input: ignoring DAD NS packet for address %s(%s) ifa == NULL in nd6_dad_na_inputnd6_rs_input: invalid hlim (%d) from %s to %s on %s m_pulldown malfunctionnd6_rs_input: invalid ND option, ignored nd6_rs_input: lladdrlen mismatch for %s (if %d, RS packet %d) nd6_rs_inputnd6_ra_input: invalid hlim (%d) from %s to %s on %s nd6_ra_input: src %s is not link-local nd6_ra_input: invalid ND option, ignored nd6_ra_input: invalid option len %d for prefix information option, ignored nd6_ra_input: invalid prefix len %d for prefix information option, ignored nd6_ra_input: invalid prefix %s, ignored nd6_ra_input: invalid prefixlen %d for rfc2374 prefix %s, ignored nd6_ra_input: bogus mtu option mtu=%lu sent from %s, ignoring nd6_ra_input: bogus mtu mtu=%lu sent from %s; exceeds maxmtu %lu, ignoring nd6_ra_input: lladdrlen mismatch for %s (if %d, RA packet %d) nd6_ra_inputdefrouter_addreqdefrouter_addifreq: failed to find an ifaddr to install a route to interface %s defrouter_addifreq: failed to install a route to interface %s (errno = %d) defrouter_addifreqdefrouter_delifreqdr == NULL in defrouter_delreqdefrouter_delreqdefrouter_select: called unexpectedly (forwarding=%d, accept_rtadv=%d) defrouter_select: there's no default router and no default interface defrouter_select: more than one router is installed nd6_prelist_add: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_remove: failed to make %s/%d offlink on %s, errno=%d prelist_update: failed to make the prefix %s/%d on-link on %s (errno=%d) prelist_update: nd6_prelist_add failed for %s/%d on %s errno=%d, returnpr=%p pfxlist_onlink_check: failed to make %s/%d offlink, errno=%d nd6_prefix_onlink: %s/%d is already on-link nd6_prefix_onlink: failed to find any ifaddr to add route for a prefix(%s/%d) on %s nd6_prefix_onlink: failed to add route for a prefix (%s/%d) on %s, gw=%s, mask=%s, flags=%lx errno = %d nd6_prefix_onlinknd6_prefix_offlink: %s/%d is already off-link nd6_prefix_offlink: failed to recover a prefix %s/%d from %s to %s (errno = %d) nd6_prefix_offlink: failed to delete route: %s/%d on %s (errno = %d) nd6_prefix_offlinkin6_ifadd: wrong prefixlen for %s (prefix=%d ifid=%d) in6_ifadd: failed to make ifaddr %s on %s (errno=%d) in6_ifaddin6_init_prefix_ltimes: preferred lifetime(%d) is greater than valid lifetime(%d) rip6_inputrip6_outputrip6_attachrip6_detachrip6_usrreqrip6_usrrequdp6_outputPF_KEY@@@@@(@(@PP @pfkeyv2_policyipsec policypfkeyv2_sendaes3desdesblowfishskipjackcast128deflatelzshmac-sha1hmac-ripemd160hmac-md5hmac-sha2-256hmac-sha2-384hmac-sha2-512pfkeyv2_parsemessagevm_map_lock_read: intrsafe mapiommu%s at %s unsupported cache-coherence?page-sizeiommu_attach: can't allocate memory for pagetablesbad iommu range: %d: version 0x%x/0x%x, page-size %d, range %dMB nameobiovmelvmesvme%s at %s addr %p vec 0x%x&)H&)@&)8&)(interruptcountereeprom unsupported rangesobio: PROM ranges too large: %dcould not find %s amongst obio devices namezsvmesattach: can't allocate intrhandvmelattach: can't allocate intrhandvme: PROM ranges too large: %d: version 0x%x vmebus: no rangesvme: spurious interruptvme: spurious interrupt vmeintr_establish: interrupt vector not allocatedvmeintr_establish: uninitialized vecvme_addirqauxregauxiliary-ioauxioauxregmatch no aux registeroclockeepromclocktimer delay constant %d%s [TOO SMALL?] oclock: calibration failing; clamped at %d mk48t02modelno prop: %s (eeprom) mk48t08counter-timercounterdelay calibration delay constant %d oclock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz clock; using 100 Hz clock0: cannot get %d Hz statclock; using 100 Hz oldclk statintr;Zx0NWARNING: preposterous time in file system WARNING: bad date in battery clockWARNING: clock %s %d dayslostgained -- CHECK AND RESET THE DATE! power ledleds sun4cpumidsun4csun4mno%s @ %s MHz, %s FPU: %s%s, %s; %s cpu_attach%s: %sphysical %s%dK instruction (%d b/l), %s%dK data (%d b/l)physical %dK combined cache (%d bytes/line)%dK byte write-%s, %d bytes/line, %cw flushthroughback%s%dK external (%d b/l) Unknown CPU type: cpu: impl %d, vers %d; mmu: impl %d, vers %dmmu-npmgmmu-nctxclock-frequencyvac-sizevac_hwflushvac-hwflushvac-linesizebad cache line size %dbuserr-typecache chip bug - trap page uncachedcache-physical?ncachesicache-nlinesdcache-nlinesicache-line-sizebad icache line size %dicache-associativitydcache-line-sizebad dcache line size %ddcache-associativitycache-nlinescache-line-sizecache-associativityecache-nlinesecache-line-sizebad ecache line size %decache-associativitywarning: couldn't identify cache [viking: PCR_TC is off][viking: turn on PCR_TC]UnknownTI_4_4TI_4_3TI_MS2TMS390S10TMS390Z50 v1TMS390Z50 v0 or TMS390Z55RT620/625CY7C611CY7C601/605 (v.f)CY7C601/605 (v.c)CY7C601/605 (v.b)CY7C601/604MB86907MB86904W8601/8701 or MB86903CY7C601L64811MB86900/1A or L64801psr-implementationpsr-versionimplementationversionOut of CPUsB5010 or B5110/20 or B5210RT602 or WTL3171TMS390C602AL64814L64812 or ACT8847L64804on-chipWTL3170/2L64802 or ACT8847MB86911 or WTL1164/5MB86910 or WTL1164/5version 0x%xmemregmemory-errormemregattach %ssync mem err: ser=%b sva=0x%x aWRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGaer=%b ava=0x%x WBINVALTIMEOUTDVMAERRparity error register = %b ERRMULTITESTENABLEBYTE0BYTE1BYTE2BYTE3memory errormemory error:sfsr=%b sfva=0x%xCSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWafsr=%b afva=0x%xSYSERR UNCORR TIMEOUT BUSERRAFOhard memory errorHyperSPARC async cache memory failure at phys 0x%x%x store buffer copy-back failure at 0x%x. Retrying... warning: got data fault with no faulting address. Ignoring. zsslavezsattach: expected 1 interrupt, got %d pri %d, softpri %d serialkeyboardmousebroken zs interrupt schemeintr%s: channel %dzs_set_speedttydttycttybttyakeyboard/displaystdin-pathconsinit: increase buffer size and recompile consinit: bogus stdin path %s. device_typestdout-pathconsinit: bogus stdout path %s. displaycninit: mismatched PROM output selector cninit: invalid inSource=%d console is %s cninit: zs not mapped. consinitfdc360KB/x720KB/x720KB360KB/PC360KB/AT1.2MB1.44MBfdSUNW,fdtwo drive %d[version cmd] CFGLOCK: unexpected responseintr pri %d, softpri %d: chip 8207%c fdprobe: %d stati: %x : %s %d cyl, %d head, %d sec : density unknown fdstrategy: b_blkno %d b_bcount %ld blkno %d cylin %ld fdstrategy: controller inactive fdc reset fdcresult: overrun fdcresult: timeout fdcstart: not idle %s: %s: state %d (st0 %b cyl %d) invldabnrmlseek_cmpltequ_chckdrive_notrdytop_head (st0 %b st1 %b st2 %b cyl %d head %d sec %d) end_of_cylbad_crcdata_overrunsec_not_fndwrite_protectno_amctrl_mrkbad_crcwrong_cylscn_eqscn_not_fndbad_cylno_dam fdcstatus: weird size: %d timeoutfdc: spurious interrupt: state %d, istate=%d fdcintr: spurious interrupt can't be clearedfdcintr: block %d != blkno %d fdcintr: %s drive %d track %d head %d sec %d nblks %d readwriteseek failedread failedwrite failedblkno %d nblks %d nstat %d tc %d fdc: %d -> threshold soft errorrecalibrate failedstray interruptfdcintr: impossiblehard errorfdioctl: impossiblefdformat: blkno %x count %ld fdformfloppy diskfictitious%s: %s Insert filesystem floppy and press return.sbusslave-only%s at %sdevice_type class %s %s slot %d offset 0x%x unsupported clock-frequency: clock = %s MHz burst-sizesrangessbus: PROM ranges too large: %dnamerelative sbus addressing not supportedsbus_establish: can't find sbus parent for %sreset %s:%s: dma card found in non-dma sbus slot %d: not supported  '&     1!2@ 3#!4$"5%#6^$7&%8*&9('0)(-_)=+*`~+,-=.//*12.345 6q7w8e9r:t;y<u=i>o?p@[{A]}BC D7E8F9G-HIJLM aNsOdPfQgRhSjTkUlV;:W'"X\|Y Z [4\5]6^0_`ab cdzexfcgvhbinjmk,m/?no p1q2r3vwxy z{}+ ]}&12 "3!'4"(5#6$7%!8&9\'0()~)-_#**|6a7z@A`$@M qVmMW%X[{dwj,?k;.l:/m=+w |<> &12~ "3#!'4{"(5[#-6|$7`%_8\&9^'0@()])=+}*6a7z@A$M qVmW%X*dwj,?k;.l:/m!|<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)|*'*`@AC LVWXk,;l.:m-_w|<>\ 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)|**`@AVWX\*`k,;l.:m-_|<>\ ]} 2" 3#6&$7/%8(`&9)''0=|(?\)*#^@;z@A+~LVWX[{dyjmMk,;l.:m-_w|<> 2" 3#6&$7/{%8([&9)]'0=}(?\)*^6qQ@;z@A+~VWX#'`dyjmMk,;l.:m-_|<>| ]}2" 3#6&$7/%8(&9)\'0=|('?`)^*@A+*~LV@W#X[{k,;l.:m-_w|<> 2" 3#6&$7/%8({&9)}'0=('?`)^*\|@[A+*]V@W#X~k,;l.:m-_|<> \|1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?) *<>@A*~NsSV+WX@dzZexXfcCjmMk,;l.:m-=w }][ 1!2" 3#!4$"5%#6&$7_%8({&9)}'0'`(/?\) *@@A*|~NsSV+WX<>^dzZexXfcCjmMk,;l.:m-=}][ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?)\*'*`@ALVWX|k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}(+?)\*|@AVWX'*`k,;l.:m-_}<> ]}2"@ 3#!4$#6&$7/%8(&9)\'0=|('?`)*^@*+A~LVWX[{k,;l.:m-_w}<> 2"@ 3#!4$"5%~#6&^$7/{%8([&9)]'0=}('?`)*\|@+*AVWXk,;l.:m-_}<> ]}2"@ 3#"5%#6&$7/%8(&9)\'0=|('?`)*>oO@^A+*~LMaAVWX[{k,;l.:m-_w}<> 1!|2"@ 3#!4$^"5%~#6&$7/%8(&9)'0=('?`)*\@[A+*]VW{X}k,;l.:m-_}<> ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*'*`@AC LVWXk,;l.:m-_w|<>|)'`A^~ ~^2"@ 3#!4$#6&$7/{%8([&9)]'0=}(+?\)*@AC LVWX'*`k,;l.:m-_w|<>| >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\ >}1+!2"@ 3*#!4"5%~#6&$7/|%8(&9)\'0=^('?`)*$;z@AC LVWX<{dyjmMk,;l.:m-_w|][\ 1+|2"@ 3*#!4^"5%~#6&$7/%8(&9)'0=`('?)*$;z@[A!]VW{X$}dyk,;l.:m-_|<>\1!|!3#(-_C 2" 3*`W'@X#~|\|2"#6&$7'%8(&9)'0(-=)^~*|@@`A[{V;+W:*X]}|\_ &@@ `&BZT&EO&C V&Kp`&BZM&FHj&Gh L&IP&J:b&Nb&Or O&L  &MX&P &@@N&EL&Dl O&LZ&CC&F,&Q&i&H< J&IK&JU&NU&P6 O&Mf  &MX&P       zstty flags 0x%xinputoutput (console %s)i/okeyboardmouse: %s zstty_attachzs_shutdown: not enabled?%s: device enable failed zsopen%s: %d silo overflow%s, %d ibuf flood%s szskbdkeyboard, flags 0x%x%s: no keyboard keyboard-click?true: keyboard, type 5, layout 0x%x: keyboard, type %d, layout 0x%x : failed to set baudrate : failed to set modes : reset timeout %s: reset: invalid keyboard type %x %s: %d silo overflow%s, %d ibuf flood%s smii_attach: phyloc and offloc specifiedmii_activate: phyloc and offloc specifiedmii_activate: DVACT_ACTIVATE%s: config_activate(%d) failedmii_detach: phyloc and offloc specifiedOUI 0x%06x model 0x%04x rev %d at %s phy %d!A  !@@@@mii_phy_setmediamiiautnsphy: %s, rev. %d DP83840 10/100 media interfacensphyter: %sDP83815 10/100 integratedDP83843 10/100 media interface, rev. %d qsphy: %s, rev. %d QS6612 10/100 media interfacelxtphy: %s, rev. %d LXT970 10/100 media interfaceLXT971 10/100 media interfacetqphy: %s, rev. %d 78Q2120 10/100 media interfaceukphy: Generic IEEE 802.3u media interface %s: OUI 0x%06x, model 0x%04x, rev. %d %s: no media present bmtphyBCM5201 10/100 media interfaceBCM5221 100baseTX PHY: %s, rev. %d scxsplgetxscannot allocate scsi xs scsi_free_xscould not get size scsi_donescsi_execute_xs: NOSLEEP and POLLscsi_scsi_cmdscsi_execute_xs: invalid return codescsi_execute_xs: impossiblescsi_scsi_cmd: buffer without nosleepscbusyunknown error category from scsi driver DEFERRED ERROR, key = 0x%x Sense Error Code %d at block no. %d (decimal) %s(%s:%d:%d): probeReservedMiscompare ErrorVolume OverflowEqual ErrorAborted CommandCopy AbortedVendor UniqueBlank CheckWrite ProtectedUnit AttentionIllegal RequestHardware ErrorMedia ErrorNot ReadySoft ErrorNo Additional Sense&|&|h&|@&|(&|&{&{&{&{&{X&{(&{&z&z&z&z&z&zP&z &y&y&y&yP&y0&y&x&x&x &xx &x` &xH &x0 &x &x &w &w&w&w&wh&wH&w0&w&v&v&v&v &v &vh &v8 &v&u&u&u&ux&uX&u@&u(&u&t&t&t&th&tH&t&s&s&s&sX&s &r&r&r&r`&r@&r(&r&q&q&q&qx&qX&q8&q&q&p&p&p&p &p`!&p8!&p "&o$&o%&o&&o&&ox&&o`&&o8'&]`(&o(&n)&n*&n*&nx*&n`+&n(,&n,&m,&m-&m/&mp0&mP0&m(0&l0&l1&l1&l2&l2&l`3&lH6&l(7&l9&k:&k;&k;&k;&kh;&k0;&k ;&k;&j;&j;&j; &j; &j; &j`; &j8; &j;&i=&i>&i?&ix?&i`?&i@?&i @&iA&hB&hC&hD&hxE&hXF&h@G&h(H&gI&gJ&gK&gL&gN&ghP&gPP&g0P&gQ&fR&fS&fS&fS&fT&fhU&fPW&f(X&fY&eZ&eZ&eZ&epZ&eP[&e@[&e([&e[&d\&d\&d\&d`&da&dxa&d`a&dPb&d0c&dd&cIllegal Mode For This TrackEnd Of User Area Encountered On This TrackScan Head Positioning ErrorOut Of FocusUnable To Acquire VideoVideo Acquisition ErrorLamp FailureSpindles Not SynchronizedSpindles SynchronizedRPL Status ChangeLog List Codes ExhaustedLog Counter At MaximumThreshold Condition MetLog ExceptionOperator Selected Write PermitOperator Selected Write ProtectOperator Medium Removal RequestedOperator Request or State Change Input (Unspecified)Updated Block ReadGeneration Does Not ExistUnable To Recover Table-Of-ContentsSystem Resource FailureSCSI To Host System Interface FailureMedium Removal PreventedUnload Tape FailureMedia Load or Eject FailedCartridge FaultErase FailurePosition Error Related To TimingWrite Append Position ErrorWrite Append ErrorOverlapped Commands AttemptedLogical Unit Failed Self-ConfigurationData Phase ErrorCommand Phase ErrorInvalid Message ErrorINITIATOR DETECTED ERROR Message ReceivedSCSI Parity ErrorUnsuccessful Soft ResetSelect Or Reselect FailureInternal Target FailureMessage ErrorPower-On or Self-Test FAILURE (Should Use 40 NN)Data Path FAILURE (Should Use 40 NN)RAM FAILURE (Should Use 40 NN)INQUIRY Data Has ChangedChanged Operating DefinitionMicrocode Has ChangedTarget Operating Conditions Have ChangedLogical Unit Has Not Self-Configured YetInvalid Bits In IDENTFY MessageMedium Source Element EmptyMedium Destination Element FullPosition Past Beginning Of MediumPosition Past End Of MediumRead Past Begining Of MediumRead Past End Of MediumReposition ErrorFailed To Sense Bottom-Of-FormFailed To Sense Top-Of-FormPaper JamSlew FailureTape or Electronic Vertical Forms Unit Not ReadyTape Position Error At End-of-MediumTape Position Error At Beginning-of-MediumPositioning ErrorMedium Not PresentSaving Parameters Not SupportedRounded ParameterRibbon, Ink, or Toner FailureTape Length ErrorDefect List Update FailureNo Defect Spare Location AvailableFormat Command FailedMedium Format CorruptedCleaning Cartridge InstalledCannot Read Medium - Incompatible FormatCannot Read Medium - Unknown FormatIncompatible Medium InstalledCommands Cleared By Another InitiatorOverwrite Error On Update In PlaceInvalid Combination of Windows SpecifiedToo Many Windows SpecifiedCommand Sequence ErrorCopy Cannot Execute Since Host Cannot DisconnectLog Parameters ChangedMode Parameters ChangedParameters ChangedPower On, Reset, or Bus Device Reset OccurredImport Or Export Element AccessedNot Ready To Ready Transition (Medium May Have Changed)Threshold Parameters Not SupportedParameter Value InvalidParameter Not SupportedInvalid Field In Parameter ListLogical Unit Not SupportedIllegal Field in CDBIllegal Function (Should 20 00, 24 00, or 26 00)Invalid Element AddressLogical Block Address Out of RangeInvalid Command Operation CodeRecovered ID with ECCMiscompare During Verify OperationGrown Defect List Not FoundPrimary Defect List Not FoundDefect List Not FoundSynchronous Data Transfer ErrorParameter List Length ErrorDefect List Error in Grown ListDefect List Error in Primary ListDefect List Not AvailableDefect List ErrorRecovered Data - Recommend RewriteRecovered Data - Recommend ReassignmentRecovered Data With LECRecovered Data With CIRCRecovered Data - Data Auto-ReallocatedRecovered Data With Error Correction & Retries AppliedRecovered Data With Error Correction AppliedRecovered Data Without ECC - Recommend RewriteRecovered Data Without ECC - Recommend ReassignmentRecovered Data Without ECC - Data Auto-ReallocatedRecovered Data Using Previous Sector IDRecovered Data With Retries and/or CIRC AppliedRecovered Data With Negative Head OffsetRecovered Data With Positive Head OffsetRecovered Data With RetriesRecovered Data With No Error Correction AppliedData Synchronization Mark ErrorPositioning Error Detected By Read of MediumMechanical Positioning ErrorRandom Positioning ErrorBlock Sequence ErrorEnd-Of-Data Not FoundFilemark or Setmark Not FoundRecord Not FoundRecorded Entity Not FoundAddress Mark Not Found for Data FieldAddress Mark Not Found for ID FieldUncorrected Read Error - Recommend Rewrite the DataUncorrected Read Error - Recommend ReassignmentMiscorrected ErrorNo Gap FoundIncomplete Block FoundData Resynchronization ErrorCIRC Unrecovered ErrorL-EC Uncorrectable ErrorUnrecovered Read Error - Auto Reallocate FailedMultiple Read ErrorsError Too Long To CorrectRead Retried ExhaustedUnrecovered Read ErrorID CRC Or ECC ErrorWrite Error - Auto Reallocate FailedWrite Error Recovered with Auto ReallocationWrite ErrorError Log OverflowSpindle Servo FailureFocus Servo FailureTracking Servo FailureTrack Following ErrorLogical Unit Communication Parity ErrorLogical Unit Communication TimeoutLogical Unit Communication FailureMultiple Peripheral Devices SelectedNo Reference Position FoundLogical Unit Does Not Respond To SelectionLogical Unit Not Ready, Format In ProgressLogical Unit Not Ready, Manual Intervention RequiredLogical Unit Not Ready, Initialization Command RequiredLogical Unit Is in Process Of Becoming ReadyLogical Unit Not Ready, Cause Not ReportableExcessive Write ErrorsNo Write CurrentPeripheral Device Write FaultNo Seek CompleteNo Index/Sector SignalNo Current Audio Status To ReturnAudio Play Operation Stopped Due to ErrorAudio Play Operation Successfully CompletedAudio Play Operation PausedAudio Play Operation In ProgressI/O Process TerminatedEnd-Of-Data DetectedBeginning-Of-Partition/Medium DetectedSetmark DetectedEnd-Of-Partition/Medium DetectedFilemark DetectedNo Additional Sense InformationDiagnostic Failure on Component 0x%02xASC 0x%02x ASCQ 0x%02xCheck Condition on opcode 0x%x SENSE KEY: %s %c Filemark Detected%c EOM Detected%c Incorrect Length Indicator Set INFO FIELD: %u COMMAND INFO: %d (0x%x) ASC/ASCQ: %s FRU CODE: 0x%x SKSV: %s Additional Sense Information (byte %d out...): %2d: %2d: 0x%02x%s, Error in %s, Offset %d, bit %dCDBParametersError in %s, Offset %dActual Retry Count: %dProgress Indicator: %dscsi_user_doneUser command with no buf User command with no ioctl host adapter code inconsistency unknown error category from host adapter code user_strat: No ioctl physio split the request.. cannot proceed cmdlen too big scistrscsi_do_ioctl: impossiblescsibusscsibus at %s: %d targets scsibusattach: can't allocate target linksscsibusattach: can't allocate lun links&&&&&&&&&&&h&&X&@&8&(&&&&&&&&&&&&x&`&X&H&0&&H&&&H&&&H&&&H&&&H&&&&&&p&X&&p&@&&p&(&&p&&&p&&&&&&&&&&&&&&x&h&P&H&8&(& &&&&&&&&&&&&&&&@&p&X&P@&&&&&&@&p&X&P@&@&(&&&&&&&!&&&&&&&&&&&&&&&&&p&&&h&&&`&&P&8&&P& &&P&&&P&&&P&&&P&&&P&&&P&&&&p&&H&X&P&@&(&&@&&&@&&&@&&&@&&&&&&&x&&&`&&&H&&&0&&& &@&&&@&h&&&&&H&&&@&&&@&&&@&&&&&&x&p&h&&`&P&H&@&8&&&0&& &&&&&&&&&&&&&&&p&h&`&p&H&@&p&(&@&&&&&&&&&&&&&&&&&p&&`&H&@&`&(& &`&&&&&&&&&&x&&&`&X &H&@&& &&&&&&&&&&&&&&&&&&&&&&&&&&&&&x&P&&H&8&&&(&&&&&&&&&&&&&& 1.14UJDCD87301.25CD-ROM CDR-N161.70CD-ROM CDR-S11.08SANYO CRD-S54PSANYO CRD-254PSANYO CRD-256P4.21NEC CD-ROM DRIVE:2731.0gMemorex CRW-26421.02MATSHITA CR-5741.00GCD-R580Bq01FX320SAC101CREATIVECD3630E1.07CR-2801TEBCD-24XBCD-16XSW03DALPS ELECTRIC CO.,LTD. DC544CSENASUN V1.9SuperVista S-12 AT3 1.60 ULTIMA V2.9Astra 1200S UMAX 1R08IS60 RICOH 02.2Model 3200 01.7Model 2600 02.4Model 1300 WangDAT 5150ES SCSI5099ES SCSIWANGTEK Python 28454-XXX2.2GVIPER 1500 21247VIPER 150 21247ARCHIVE TDC 3600 TANDBERGSDT-5200 3.SDT-5000 2.09SDT-2000 EXB-8200 EXABYTE TK50 TZ30 CP150 CALIPER DCASC3725SHP0002ST150176LWSEAGATE4421-07MICROP0001SD120S-200 NEC FC-1TEACG0661467ZIP 250ZIP 100IOMEGAjaz 1GBiomega6027MK538FB ST34501FC ST19171FCST296N ST296 ST157N ST125N SEAGATE RO3000S RODIME PD210S SUN0207PD1225S P105S 910-10-94xLPS525S ELS85S QUANTUM 0307D3847 SnapLink MST LXT-200S LXT-213S SUN0207LXT-213S XT-8760SXT-4170S MXT-1240S XT-4380S XT-3280 MAXTOR DFRSS2FKZ-CH3171-S20664IBM0663HIBM 0662SIBMRAID CP16CP15DK515CHITACHIA00MD21/S2 ESDIEMULEX RZ55 (C) DEC1588-15MBSUN0669MICROP 3.30MOS321 DELTIS 0800M2513AFUJITSU3.08OMD-5010 EPSON CD-ROM PX-40TSPLEXTORCyberDrv1.55R2626 JVC 1.04CD-ROM DM-3x1SShinaKen1755XM-4101TASUNSLCDTOSHIBA 1.10CD-ROM DM-XX24 KTEXEL 1.0BCD-ROM CD-56S 1.06CD-ROM TEAC CD-ROM CDU-8012 CD-ROM CDU-8003ACD-ROM CDU-561 CD-ROM CDU-55S CD-ROM CDU-541 SONY 1.01CD-ROM DR-124X PIONEER CD-ROM DRIVE:841CD-ROM DRIVE:5011.0CD-ROM DRIVE:210CD-ROM DRIVE:84 CD-ROM DRIVE:83 CD-ROM DRIVE:55 NEC 1.3CDR-H93MV MEDIAVISRENO CD-ROMX2A MEDAVIS 1.0bCD-ROM CR-5XX MATSHITA2.06CDD521/10 IMS C4324/C4325 HP VDRD-25X DENON RRD42 (C) DEC DEC CD-ROM CDS-535 CD-ROM CDS-525 Chinon CD-ROM CDS-431 CHINON %s offlinescsibusprint: impossible qualifiervendor-uniquedirectsequentialprinterprocessorcdromwormscanneropticalchangercommunicationenclosure servicessimplified directscsibusprint: impossible device typeunknown targ %d lun %d: <%s, %s, %s> SCSI%d %d/%s %s%sremovablefixedscsibusprintDECTZ30TK50 not configured vm_map_lock_read: intrsafe mapcd&(&(&(&(&(&(&&(&(NEC CD-ROM DRIVE:260 cdstart%s: not queuedcdioctlATAPI CD-ROMSCSI CD-ROMfictitiousdvd_authdvd_read_physicaldvd_read_copyrightdvd_read_disckeydvd_read_bcadvd_read_manufact. ./-/cd_scsibus_get_mode: Mode page %02x request bad size: %d bytes cd_scsibus_set_mode: Set mode request bad size: %d bytes cd_scsibus_set_pa_immedcd_scsibus_setchancd_scsibus_getvolcd_scsibus_setvol/0801`1hch&0&0&002009000SPECTRA %s: offline %s: %d slot%s, %d drive%s, %d picker%s, %d portal%s s%s: warning, READ ELEMENT STATUS avail != count %s: could not sense element address page %s: could not sense capabilities page vm_map_lock_read: intrsafe mapsd&&&&&&&&&&&&&&&&&& %s: %ldMB, %d cyl, %d head, %d sec, %d bytes/sec, %ld sec totaldrive offlineunformatted mediasdattach: unknown result from get_parms%s: WARNING: unable to establish shutdown hook sdstart%s: not queued, error %d sdioctlSCSI opticalSCSI disk%s %ssdgetdisklabel%s: ..is spinning up...waiting %s: removable disk stopped - not restarting %s: respinning up disk %s: respin of disk failed - %d WH%s: strange capacity descriptor byte5 0x%x sd_atapibus_get_parmsZ^D%s: mode sense (%d) returned nonsense%s: could not mode sense (4/5); using fictitious geometry %s: WARNING: cache synchronization failed &&&&&& &&&&&p&&`&H&&8& &&&& &&& &&&&&&&&&&&&&p&X&P&@&(&EEEE&&&????5150ES SCSI FA1501 AT4000s HP 263HEXB-8200 EXABYTE Model 1300 WangDAT 5525ES SCSI REV75150ES SCSI5099ES SCSIWANGTEK VIPER 150 21531VIPER 150 21247DMT780 ANRITSU CP525 SANKYO VIPER 2525 25462ARCHIVE TDC 3800 TDC 3600 TANDBERG st&&& %s: %srogue, drive empty density code 0x%x, %d-bytevariable blocks, write-%s protectedenabled%s: already open %s: cannot set selected mode %s: bad request, must be multiple of %d %s: bad request, must be between %d and %d ststart%s: not queued st_mode_sensest_mode_select%s: block wrong size, %d blocks residual %s: %d-byte record too big %s: bad residual %d out of %d generic&&h&`&P&&8&`&(&&&`&@ |`&&&`&@ |`&&&`&@ |`&&h&`&X.&&@&`&0. & &&`&Fujitsu M3096GM3096Gm FUJITSU UMAX UG-630UG630 UMAX UC-630UC630 UMAX IBM 24562456-001 IBM Ricoh IS-410IS410 Ricoh IS-50IS50 RICOH Ultima A6000CA6000C PLUS Ultima AT3 AT3 1.60 ULTIMA ss&&&&&&&&&&&&&&&&&p&&&X&&&@&&&(&&&&&&&&&&&&&&&&C7670A C6270A C7190A C5190A C6290A C5110A C1130A C2520A C2570A C2500A C1790A C1750A HP MUSTEK %s: %s %s: generic scanner %s: already open %s: not queued ss_set_window %s: MFS-06000CXMustek 6000CX Flatbed 3-pass color scanner, 3 - 600 dpi MFS-12000CXMustek 12000CX Flatbed 3-pass color scanner, 6 - 1200 dpi %s: not queued mtkrdymustek: lines actual(%d) != computed(%ld) mustek: win-size actual(%d) != computed(%ld) %s: C1750AHP ScanJet IIcC1790AHP ScanJet IIpC2500AHP ScanJet IIcxC2570AHP ScanJet 3pC2520AHP ScanJet 3c/4c/6100CC1130AHP ScanJet 4pC5110AHP ScanJet 5pC6290AHP ScanJet 4100CC5190AHP ScanJet 5100CC7190AHP ScanJet 5200CC6270AHP ScanJet 6200CC7670AHP ScanJet 6300C set_window failed compute_sizes failed %s: set_window failed %s: compute_sizes failed *f0S%s: trigger_scanner failed %s: not queued *f%ldP*f%ldQ*f%ldX*f%ldY*a%dR*a%dS*a0T*a0I*a3T*a0I*a4T*a1I*a5T*a1I*u2T*a%dG*a%dL*a%dKscanjet_set_window%s: interrogate write failed %s: interrogate read failed %s: bad data returned *s1025E*s1024E*s1026Escanjet_compute_sizesuk %s: unknown device %s: already open dmaledma[%s at %s] offset 0x%xespdmacable-selectiontpeauiburst-sizes: rev 0esc11+2unknown (0x%x) nameesp%s: line %d: CSR = 0x%lx /usr/src/sys/arch/sparc/compile/GENERIC/../../../../arch/sparc/dev/dma.cR_PEND%s: start %d@%p,%d dma_setup: dmasize = %d dma: cannot allocate DVMA address%s: intr: addr %p, csr %b INTERRDR1DR2IEN WRITEENCNTTCDMAON%s: error: csr=%b dmaintr: DMA wasn't activeDRAININGdmaintr: discarded %d bytes (tcl=%d, tcm=%d) dmaintr: empty esp FIFO of %d dmaintr: tcl=%d, tcm=%d, tch=%d; trans=%d, resid=%d lebuffer[%s at %s] offset 0x%xburst-sizes: %dK memory nameqec%s at %s offset 0x%x#channels: no channels : invalid number of channels: %d burst-sizes: %dK memory %d channel%ss nameranges%s: PROM ranges too large: %d %s: reset failed. be: expected 1 interrupt, got %d board-versionchannel#burst-sizes pri %d: rev %x address %s %s: device timeout %s:%s qstat=%b unexpectedRXSRXPRXLRXSMALLRXDROPRXTXSTXPTXLTXDTX BE%s: resetting %s:%s stat=%b RXRCNTACNTCCNTLCNTRFIFOCVCNT TX TFIFO TMAXPKT NCNT ECNTLCCNTECNTDTIME%s: rev %d PAL not supported. %s: no internal or external transceiver found. %s: invalid tcvr type %s: invalid packet size %d; dropping %s: bmcr reset failed %s: bmcr unisolate failed qe: no interrupt found on parent mace-versionchannel# pri %d: rev %x address %s %s: device timeout %s: excessive tx defers. %s: excessive tx retries %s: late tx transmission %s: tx fifo underflow %s: jabber seen %s: babble seen %s: tx descriptor is bad %s: tx late error %s: tx dma parity error %s: tx dma sbus error ack %s: rx fifo overflow %s: rx late collision %s: rx packet dropped %s: rx buffer too small %s: rx late error %s: rx dma parity error %s: rx dma sbus error ack %s: unexpected interrupt error: %08x %s: resetting... %s: invalid packet size %d; dropping hmeSUNW,hmeSUNW,qfe: expected 1 interrupt, got %d : expected 5 registers, got %d hm-revburst-sizeslocal-mac-address pri %d: address %s rev %d qfe%s: stop failed %s: device timeout %s: burst size unknown %s: setting rxreg->cfg failed. %s: reset tx failed %s: reset rx failed %s: link status changed %s: stat=%b, resetting. RXRCNTACNTCCNTLCNTRFIFOCVCNTSTST TX TFIFO MAXPKT NCNT ECNTLCCNTFCNTDTIMERXHOSTNORXDRXEEXLATERXPRXTEOPMIFTXHOSTTXALLTXETXLTXPTXTSLV SLVP%s: invalid packet size %d; dropping %s: mii_write failed %s: mii_read failed dma: expected 1 interrupt, got %d pri %dinitiator-idclock-frequency espattach: no dma foundintrespaudioamd|QEB;632*+,%#"""-+2LCBCA;;=43422$1*{*+#+,B.#%$+$#""A"#"3J!2,b2q"4R#z5& *c  # 3   > L!|"3"B2'"R:31,#"bQB;32*,%#"!  C3@DA1U BA` Br!" audio: expected 1 interrupt, got %d pri %d, softpri %d intrmulawmicvolumespeakerheadphonesmonitorsourceoutputinputsoutputsrecordaudiocsSUNW,CS4231: expected 1 interrupt, got %d : expected 1 register set, got %d burst-sizes pri %d, softpri %d intr%s: error interrupt %s: timeout waiting for reset mulawalawslinear_leulinearslinear_beslinearulinear_leulinear_beadpcm%s: timeout committing fspb %s: timeout committing cdf %s: timeout waiting for !mce %s: timeout waiting for autocalibration micvolumedaclinecdmonitoroutputmuteonoffrecordsourcespeakerheadphonesinputsoutputs%s: attempt to free rogue pointer cs4231_trigger_output: already running cs4231_trigger_output: bad addr: %x %s: trigger_input: already running %s: trigger_input: bad addr: %x depthwidthheightlinebytesfb_setsize: inappropriate bustypescreen-#rowsscreen-#columnsvm_map_lock_read: intrsafe mapwsdisplaydiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsdisplay.cscrdata->nscreens > 0%s: screen %d-%d added (%s, %s emulation) wsdisplay_forceclose: bad screen%s: screen %d deleted wsdisplay at %sdmuxwsdisplay_common_attach: no memorywsdisplay_console_inittedwsdisplay_console_device == NULL: console (%s, %s emulation), using %s !wsdisplay_console_inittedtype->nrows > 0type->ncols > 0crow < type->nrowsccol < type->ncolswsdisplaytty() on ctl deviceWSSCREEN_HAS_EMULATOR(scr)sc != NULLwsdisplay_switch3: not switching wsdisplay_switch3: invalid screen %dwsdisplay_switch3: screen %d disappeared wsdisplay_switch3: giving up wsdisplay_switch2: not switching wsdisplay_switch2: invalid screen %dwsdisplay_switch2: screen %d disappeared wsdisplay_switch2: giving up wsdisplay_switch1: not switching wsdisplay_switch1: invalid screen %dwsdisplay_switch1: screen %d disappeared wswaitwsmoused_sleep   !"#$%&'()*+,-./0000000000:;<=>?@00000000000000000000000000[\]^0`00000000000000000000000000{|}~00000000000000000000000000000000000000000000000000000000000000wscons: copybuffer memory malloc failed vt100Hhxtdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100.cedp->console == 1wsemul_vt100_output_c0c1: ESC in kernel output ignored edp->tabs != 0wsemul_vt100_output: kernel output, not consolewsemul_vt100: invalid state %d[>24;20;0cdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100_subr.cedp->tabs != 0P2$u%s%d/\P0!u%5\[?62;6c[%d;%dR[?13n[?21n[?27;1nwsemul_vt100_handle_csiwsemul_vt100_handle_dcs: bad type %d  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ $ %%% %%<%%$%4%,%"d"e"`  "% "# #!%## # #  ""#*"d"`"e"+"4"""""<"C!!"a"""")"*"'"("!!!!#@[\]^_`{|}~@[\]^_`{|}~|^_`#@_^_`#_#^_`^_#@^_`~#@^_`~^_``#_diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_vt100_chars.cnrc < sizeof(nrctable) / sizeof(nrctable[0])[34~[33~[32~[31~[29~[28~[26~[25~[24~[23~[21~[20~[19~[18~[17~[15~[14~[13~[12~[11~OSOROQOPOyOxOwOvOuOtOsOrOqOpOIOMOjOkOlOmOnOo[1~[2~[3~[4~[5~[6~[7~[8~OAOBODOCvm_map_lock_read: intrsafe mapwsevent_readvm_map_lock_read: intrsafe mapwskbdwskbd at %s (mux %d ignored for console) mux %dcannot load keymapdiagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wskbd.cwskbd_console_inittedwskbd_console_device == NULL: console keyboard, using %s !wskbd_console_inittedwskbd_console_device == scwskdetwskbd_detach: %s didn't detach %s: event queue overflow %s: connecting to %s %s: disconnecting from %s ABCDEFGHIJKLMNOPQRSTUVWXYZwskbd_get_mapentry: %d(%d): bad entrywskbd_load_keymap: %d: recursion too deepwskbd_load_keymap: %d(%d): bad entry%s%dwsmux_detach_sc: not allocated wsmux_detach_sc: not found %s: connecting to %s %s: disconnecting from %s sun,(`diagnostic /usr/src/sys/arch/sparc/compile/GENERIC/../../../../dev/wscons/wsemul_sun.cedp->console == 1wsemul_sun_output_lowchars: ESC in kernel output ignored wsemul_sun_output: kernel output, not consolewsemul_sun: invalid state %drasops_init: font table is empty rasops_init: couldn't lock font rasops_init: fontwidth assumptions botched!rasops_mapchar: no font selected????@`px|~ 08<>????????????????????????? @`px|~ 08<>????????????????? @`px|~ 08<>????????? @`px|~ 08<>? @ `P0pH(hX8xD$dT4t L,l\<|B"bR2r J*jZ:zF&fV6vN.n^>~A!aQ1q I)iY9yE%eU5u M-m]=}C#cS3s K+k[;{G'gW7wO/o_?wsfont_unlock: font not lockedbwtwobwtwo/p4model: %s, %d x %d cgtwocgtwoattach: impossible bustype: %s, %dx%d cgtwo_getcmapcgtwo_putcmapcgthreecgRDImodel: %s, %dx%d cgfour: cgfour/p4, %dx%d cgsixSUNW,cgsixcgsix/p4modelcgsix on mainbus? : %s, %dx%d, rev %d cgeight: cgeight/p4, %dx%dcgfourteen: model%s, %s: expected %x bytes of control registers, got %x %s: expected %d registers, got %d%dMB, %dx%d cgtwelve: %smodeldev_id (%s) %s: %dx%ducoderev, microcode rev. %spninekp9000: expected %d registers, got only %d : bt445 did not attach previously : rev %x, %dx%d btchambt445: id 0x%x, revision 0x%x pnozzp9100: expected %d registers, got only %d : unknown color depth code 0x%x, assuming 8 %s: rev %x, %dx%d, depth %d tcxSUNW,tcxmodel: %s %s: expected %d registers, got %d tcx-8-bit%s: %dx%d, id %d, rev %d, sense %d vigravs10vs11vs12model: %s %s: expected %d registers, got %dVIGRA,vs11, %dx%d agtenPFU,agamodel: model %si128_fb_physaddri128_fb_sizep9100_reg_physaddrffb_depthffb_widthffb_height, %dx%d, depth %d tvtwoPGI,tvtwo: %smodel, revision %s revision%s: old-style boards with %d registers are not supported freqcodehresvres%s: %dx%d zxSUNW,leomodel: %swidthheight, %d x %d %s: zx_cross_wait: timed out mgxSMSI,mgx: %smodel %s: expected %d registers, got %d fb_size %s: expected at least %d bytes of vram, but card only provides %d , %dx%d %s: lost carrier on UTP port, switching to AUI port %s: lost carrier on AUI port, switching to UTP port sbuslebufferledma: expected 1 interrupt, got %d pri %dbusmaster-regvalif_le: Lance buffer crosses 16MB boundaryUnknown3e/vmeonboardmultibus/vmeieie_mapie kmem_allocunaligned dvmamalloc breaksie pmap_extractunknown : RAM CONFIG FAILED! pri %d address %s, type %s %s: device timeout %s: parity error (ctrl 0x%x @ 0x%02x%04x) %s: receiver not ready ietint: command still busy! %s: send aborted %s: no carrier %s: lost CTS %s: DMA underrun %s: too many collisions %s: receive descriptors out of sync at %d ie_readframe%s: tbuf overflow %s: reset %s: abort commands timed out %s: disable commands timed out %s: TDR command failed %s: transceiver problem %s: TDR detected an open %d clocks away %s: TDR detected a short %d clocks away %s: TDR returned unknown status 0x%x ie: bogus buffer calc%s: multicast address setup command failed %s: configure command failed %s: individual address setup command failed xdcxdxddummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %dxdc malloc: couldn't read controller params : %s: : doesn't identify as a 753/7053 : Xylogics 753/7053, PROM=0x%x.%02x.%02x %s: controller config error: %s intrxdattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: write format parameters failed: %s %s: read drive parameters failed: %s %s: write drive parameters failed: %s %s: reading disk label failed: %s %s: <%s>, pcyl %d, hw_spt %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: write real drive parameters failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xdnfreexdsubwaitxdcmd nfreexdc_startbuf freexdc_startbuf bp%s: warning: out of DVMA space xdiorqxdc_submit_iorq addingxdc_submit_iorq wrap upxdc_submit_iorq%s: off-line: %s xdc_reset%s: soft reset %s: diag: xdc_reset miscount (%d should be %d)! %s: diag: lots of done jobs (%d) RESET DONE xdc_start%s: fatal error 0x%02x: %s %s: soft reset failed! xdc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries] %s: diag: IOPB miscount (got w/f/r/d %d/%d/%d/%d, wanted %d) FREE: %d WAIT: MARK: running %d: mode %d done %d errs %d errno 0x%x ttl %d buf %p %s: watchdog timeout xdc_tickSoftware fatal errorSuccessful completionIllegal cylinder addressIllegal head addressIllgal sector addressCount zeroUnimplemented commandIllegal field length 1Illegal field length 2Illegal field length 3Illegal field length 4Illegal field length 5Illegal field length 6Illegal field length 7Illegal scatter/gather lengthNot enough sectors per trackNext IOPB address alignment errorScatter/gather address alignment errorScatter/gather with auto-ECCSoft ECC correctedECC ignoredAuto-seek retry recoveredSoft retry recoveredHard data ECCHeader not foundDrive not readyOperation timeoutVMEDMA timeoutDisk sequencer errorHeader ECC errorRead verifyFatail VMEDMA errorVMEbus errorDrive faultedHeader error/cylinerHeader error/headDrive not on-cylinderSeek errorIllegal sector sizeSoft ECCWrite-protect errorIRAM self test failureMaintenance test 3 failure (DSKCEL RAM)Maintenance test 4 failure (header shift reg)Maintenance test 5 failure (VMEDMA regs)Maintenance test 6 failure (REGCEL chip)Maintenance test 7 failure (buffer parity)Maintenance test 8 failure (disk FIFO)IOPB checksum miscompareIOPB DMA fatalIOPB address alignment errorFirmware errorIllegal maintenance mode test numberACFAIL assertedUnknown errorxycxyxydummystrat%s: %s %s: WARNING: no `pcyl' in disk label. %s: WARNING: guessing pcyl=%d (ncyl+acyl) pri %d%s: can't alloc IOPB mem in 64K xyc malloc: %s: : doesn't identify as a 450/451 : Xylogics 450/451 [OLS disabled] %s: error: %s %s: 24 bit addressing turned off please set hardware jumpers JM1-JM2=in, JM3-JM4=out to enable 24 bit mode and this driver intrxyattach%s at %s drive %d: off-line : ERROR 0x%02x (%s) drive %d: ready %s: reading disk label failed: %s (drive type %d) %s: <%s>, pcyl %d %s: %dMB, %d cyl, %d head, %d sec, %d bytes/sec %s: %s and %s must be the same size! xy drive size mismatch%s: write drive size failed: %s %s: reading bad144 failed: %s %s: warning: invalid bad144 sector! %s%c: crash dump not supported (yet) xyc_cmd%s: stole control iopb xyc_startbuf null buf%s: warning: out of DVMA space xyiorqxyc_submit_iorq: stuck xyc%s: stole controller xyc_submit_iorq addingxyc_submit_iorq: xyc_chain failed!xyc_submit_iorq wrap upxyc_submit_iorq%s: off-line: %s xyc_reset%s: soft reset %s: DOUBLE ERROR! %s: soft reset failed! xyc_remove_iorq: controller DEAD%s%c: %s %d/%d/%d: readwrite [still trying, new error=%s] [recovered in %d tries]%s: watchdog timeout Software fatal errorDOUBLE ERRORSuccessful completionInterrupt pendingBusy conflictOperation timeoutHeader not foundHard ECC errorIllegal cylinder addressIllegal sector addressLast sector too smallSlave ACK error (non-existent memory)Cylinder and head/header errorAuto-seek retry successfulWrite-protect errorUnimplemented commandDrive not readySector count zeroDrive faultedIllegal sector sizeSelf test ASelf test BSelf test CSoft ECC errorSoft ECC error recoveredIllegal headDisk sequencer errorSeek errorUnknown errorsiswsi_attach: impossible bus type 0x%xsi: dma handle malloc failed pri %d %s: options=%b RESELECTDMA_INTRDMAsi: Set TheSoftC=%p TheRegs=%p si_minphys len = 0x%x. si_intr: DMA conflict si_intr: DMA bus error si_intr: spurious from SBC si_reset_adapter si_dma_alloc: already have DMA handlesi_dma_alloc: misaligned. si_dma_alloc: xlen=0x%xsi: no free DMA handles.si_dma_alloc: can't remap %p/0x%x, doing PIO si_dma_free: no DMA handlesi_dma_free: free while in progress%s: DMA timeout (while polling) si_dma_poll: done, csr=0x%x si_dma_start: bad pa=0x%lxsi_dma_start: dh=%p, pa=0x%lx, xlen=%d si_dma_start: Fifo_count=0x%x, xlen=0x%x si_dma_start: started, flags=0x%x si_dma_stop: dma not running si: DMA error, csr=0x%x, reset si_dma_stop: resid=0x%x ntrans=0x%x si: fifo count: 0x%x si_dma_stop: excess transfersi_dma_stop: ntrans=0x%x si: Got Left-over bytes! si_dma_start: adjusted up %d bytes %s: bad outgoing adj, %d != %d %s: bad incoming adj, %d != %d sw: DMA error, csr=0x%x, reset sw: short transfer Polled Mailbox Command (0x%x) Timeoutisp_mboxcmdInterrupting Mailbox Command (0x%x) Timeout%s index %d=> %s %02x%s:0x%08x:%sxA'W COPYRIGHT 1991,1992,1993,1994 QLOGIC CORPORATION ISP1000 Firmware Version 01.37 Customer No. 15 Product No. 00 $   qp \ pISpP p p?p 10 y8xc/   @B bxx xxO 85 xxx i8@h< !xh(hh hhhh#hh' i:  h hhhj-  i;  h? h2h7 h @hhdpx xdx1xGx62 ppxxxxx4xMx22xxxxp  p  z zp@xxVxU 8h!Ux'xx 8o!e@C 8j!!! `xOx> 8o 8i! @S @xx| a`@^|ppppp 8yn.. HW2 &cl{z 8yetrq @xsrq @p a` P @|qxp@x A A Sxppzxxxx ppISpP p p?p yx 10 Y )W Qp ar P @xUqrsp 10@psr Q I] ApO Ik Awpp qWpp@kp   B J &Sxp @kHk&Sxp &Sxqp! rxp%ppxprstprstҠ@xr@xx @xzz{~|vxxxxxxprstprst֠@܀x@xx @xz{|xxxxxx 8Y! rx 8A! x 8B! x a8@a bx 8E! x 8F! x 8G! x 8H! xyz xqā:jh@#kx$k xwxX kj 'x xHF a; `<F<xN   xS{zyx xwxX ijk xqġxxqġ 8A"~!xxq  "@pxxآ~ 8B"!~xxd2K a8@a bp`p`x a8@ap`xq  (@  2@  < a8@`~a#xx6xqġ 8G"!~xxqġ 8H"~!xxqrȡע!yx "z xxqā: rh~&@@@"" j @)@/@@@@@<xx@xx@r̂@rh@r a8@a(@Y2@_<@edHoxiPHoxiCHoqqrxj hhk qxwxX jk phph'x 85" p xqrs̡xxwxX jj 'xwxX jj h@xI 'xwxX jj h@xI 'xw A I Q xe 'jxwrswrsxh@'x x |  @x xww A! I Q xe a8@`g`xxI |wwwwƧ a8@``gxxI  A! I Q xeph>8< |xl 9 A! I QxX h i 8U?8?U ih0@@hK hH@pxyhK hH@px px y8x a8@```xxhh hF |xxx0qqyJ|tsrtsr y8 @x5@x@x>x` x 8h  # " $   , .%0~x1eeff``xI |p@xqpyxqq!hx ii -h p@x!p@pxqrs!!y/F[]_p@qrsxBp@pppwqx 1a&$0$"F3H 1aHx:x:x:UUwxX h0  'xwxX j4 'xw~ rȂxX l0j2 8''$xw~ rxX l4j6 8'$xy`qqġybxy`qxyTqqyVyXqqyZy\qqy^xyTqyXqy\qxp @pppqrs 0` Sx ppqp q p|p @pp pqrs 0x ppp  p 2q 2,Sp|xPe@=,xR c|~ y8xP b,xR| ]zR r@U/  xL | ;|xX)h**h.h i 8O! h@ ``h~ x ~he@`hxxx+'hhx+'ii |e@`` x>!x|`  @h(`h,`|~ q8@p@ʠ8- pB|~ q8@ 8r@!H!Ӂ!tB|xX hxe@/x,x`e@/` `,( 8O @/h` `hhxdx `d,h%`x`` xx+'hh | 9 A! I Q xe8:?8?: |h\ a`\xx]|@cxyeuw}uuuuuuuuxx0 x x xx0 x  8," x  xx0  xp a` @|,`, cxdxfxhyj@,xyn| ~ a8h- k`d`f`haj@-xanx+A |x@ ~`e@x `x>|xle@ xdxf,xnxj |xMytprТ"x@MxhM @xMx5@Mz|{x@! x$ @x@Dx>xxM xxxx xMxx`yN|VeVVVV 9xx``x`xx|x@lxVx`x`@x@xxxx|xxVxx|x@xVxg  `@  @ 9  @xxX- h+h/hh - h pxĂ@ xx>|xm,xx`x,h`x-`x`xxxxx `|.%0a`a@~x1eeff``gxX h@4 x x xxx` ;`"jh HJ@J 9xx, he@RaiVi!``hhxx h@@v@h x~~i0!h2i4i: xI xx|`` x xe@`x`xxx|ypxt xvpx@xh @|h )xle@x@~xą(x@ @| {yrpԢ"# |H | | q p?pr?? q@ x z{ `$@ @x@1xx? xxxx x?xxyx <xp֠ q | 8h ~ y 8@!b 8!bx0bbxD|~ # q8@ y 0^ +#@|x##S3xox xx pxpxpbxxxCxSx pG8pC | " x|  px" |  px¢! |  pxӡ" | "ϡ | ~ a`bc |" ~ a``` |" ~ a`` ` | ~ a``b `c  | ~~h@e a\xm@S a[ ~xm@? `p=x2xe[ q8@p``q` pxDxa q8@``q` pxD xg   |,@ `` ``x`xn| 8A"  ;"@ !!"|~h䠌 @堄`:p q@塌q~aap  @! x x pppp~aa!p |h~ qp. qpppÀ qp @ px~~~ #<~X|0}8?@@|0"x礜P"xy'!"Q"w$''((()bM7 'f7x  |pp?p0@Kp3 p\pyV^l^xx Fx&jpx9x/px~xxx x`xx[ x& ppp38px9x/qx~xxyxx`xx[ x& ppp38px9x/qx~xxyx qyx x`xx[ x& ppp38px9xx/9p hxox/,Phxn A xAx/9xp\ hox/,P`` hx 1 Ax0K x, t@@28 0qD*H) 8!de?!#qFpp?x9v@8qD&x.qF%h%Xu>,P`<p2~ / p"x"hhhh#x-ڠ-y"#"###--#--$$---$x禄@# x:xx9h@#hx/xii#3h#;h#+h@#xXx9@#;xXx9`@#@##Ix#c~Znxtzyx#V?k!hk"h@@#k~Znp#xx1x3exgx9x4jilk"@#""!|{##@~Znxgx9xg"#x3vx9x3x9xjx9xXx9xx$ i@#ši ~pH ````` x#@#i ~pH ````` ,H @#x/ x,X@#x`(x~X~Z#xUx9xix9~X$xXx9xjx9x-x- y@$xx$-#| @$%H$%x$'x#$z$'x$ $#@$=H$=x$#@$hh~X 0~Z`` ~pH `` ,H @$ax/ x-=x$p ~pH `` ,H @#x/ x,X@#x`(x~Z$xUx9xix9zx$#@$H$x$-x-x-x-xx@$xzx-y$-+-,آ$xx-xix9$xx. xix9P$x#y$$%%@$x p:py$$$$''L&$$x禄$x1M@%xh@%W%`` x*@%Wx+x1Mx%>(%Wx1M`` x+4`@%>`@%4@%4`x%>h(hx%`0@%.`` h@AhhpT ~ `h` `h-%T``xA~x&hh'o@%%%t`@%txzh.j*:"%x%" @%h%x&xA@%@Aih@%p8hix+ x+%`` h%x+x%pT `h`xxAH%x"y%%%%%xp@%x-xixjx9xxy@%x-xjx9hh&x-x& @&xx. xix9x/x0&&y||`&&h/h+x&&5hH5&5x1M| @&_xЀ&Cx4xx4y@@&Mh/h+x&2hH5@&Gp8&Yyzi.j*x&2@@&ih/h+x&2hH5@&cp8&uyzxЀ&|?i.j*!&x&2x4|@&`` hj(i,j:i>h+h/h3 hh py&&&&&&&&&xh&x+x&pT,P `h`*` !8W$@& x&-" k|wx.x/`@& ~ \ h  !\  x!j@&~ ![~  x!j@& p&x&8&xAx+ x+h'xox4J~!G@'x'/ ~h:`` x/kh@'9i ih@'@h !8Wh "j8ip2"y)-)))-xp)x+x1Mp4` x)p@)p \ hp>p2"y))))))xx. xix9p)x+x1Mp4` x)p@)pzx| i\--qV h@)h@* hx)p \ hp>p2~ / p*x)jhhh#n~Zh @*mx.x*mp*$x+x1Mp4` x*)p@*pzx|yy[--qV h@*Hh@*ahx*;p \ hp>p2~ / p*Yx*Rjhhh#n~Zh @*mx-~Xx*m~: `pJ`pN`pR`@*klih*{{||ަ~Zx3vx*h!#$@*{{||h~Zx3x/ j@* i ~Zy-p>: Hx9` @*̀`"`` p`&|x1Mhhh@hpy****+****xx+ x+xxAppy*********y pxAhx'h+ ``|x+'`@++x``` |x+4`@+&`|~~ 8.!@+1 |~~ 8/!@+> |~~ 80! |~~ 8/! |~~~ 8.! 8/#  80|x/hx+x/hx+x/hx+wx/q[-- h+xAhr@+hx+h hpx+ h+x+x+hh xxA-}~ii@, i@+H+@+ 1++x.@+x,x+x.O ~)```x, ii~X~Z+xUx9xix9 ~)```x, ~X,xXx9xjx9 ~pH `a@,KbH,@, &,$"0bp(,4,: x,: ,:  ",?"(x.S++x.@,Kx,x,Ox.Ox,xXxZ xix9 ~)``,r@,l,la | 2 x,bp(,, x, ,  cH,@, xxxz{hh | ~qH!` 5~`x~fxx`x7``` | ~pH ``xxx`xx |-zii@-i-x-cx,ȩ x/ x,X@-x`(x~X~Z- xUx9xix9~X-xXx9xjx9-%@-/qH! -/ x.Ax-cx,xXxZxix9 ~~)``  -S-Qax-` xxxzhh | ~pH `@-k @`xxx`x`` |~p@-x-x-֦ @-x@@-x@-{?-@--@-Ҡx4xx4yx-֦@@-x-?-Ҧ~Zyz -Ƣyyzzx4xgx2x9xgx9xjx9x. xix9x-xix9h#x.i ih@-hxix9 x.  x. x.  x.  x. xx~Z|~?;;: y@./x```88y@@.?x```|xxxxzx`x| 1 )2xxxx}~x`x|~ xy 8F (@.} !.  x. !/  d$@. #p.x.|~ 8F"2H.@. !.   2x.(@. !.  x. !/  d"@.H.̄ #p.x.|d.xpx x전@.$. !x.$|02BDTVfhxz  2BRbrfvxz|~"2BRTdtvxz|~xF| ;|yzxЀ/%?|~ y 8@ !y/5/g/?/?/?/?/?/=/=xxKxH/AxKxH/Hh@hxX@xZx0/g/gh /exx/gx | ~h:` /a@/`/`~ii  @/! x/ x/ ````~ii!` ` ` |xjx9xix9xXx9xUx9xx9xx9xx9xx9xx9xx9pxFx9~x0/xx x전!@/xx |xx |x0@00 x|xx x전!@00x~xx |p@0. ~-`/hx-x,h hxX?hh/h+xKx!̠ @!x전@!!x- ~h: ` HpJ`pN`pR | b G  0 8~*89(œèd;0(â0 (GajV:(✠d)0 0(ᜠ( dgo;p#vwxn> (+dgo;p#vw> i( D! ܢr<no00 Ht.?a22!ℨhe*#`B`*!0 ׈"(H0(0(= 0 &:  ~*8~ " I1Mprr p@1_x1dp |p1q1qx2.x1ip @1p1p1p@11ipx1@1x31@1ix1p |d$@1,p 91'hh 0h)!@18'1pu@1 91x1| ~ " y8 qp pp q p pp Ix | I1p2pqp1䡄0@101p2p 2q 21x2hppp2 pqH2xp I|~~~~ "qx2. |r!qp 2p 2p y2H2R2b2p2b222p2xp2[ Ix2_x32[x|p2ix2mx32ix|px1x/+h@2}h|xxx2rqp (x@2xx2x2',X`c ""c!$@22 +`x2+`1=,holkpx1|8'2`@2 ` 91Q@2p| Q|P9'2 91`d2-`|~ ~ " h `hklW1~ h@@2~ yxX@@33pp3p@3x$3!x3^,X'``~p`p !3N@3N3Nppvpx`p`pb $pb#pvp+`x2x3`x33^ |~ ~ " pp3lp |~ ~ "  I3vpp3~ h@@3h$@3 P 91-`x33 |~~~ ~ " ~ h@@3 I3h$U@3-p.` 91'hh "hH3ՊQ3x8'3pu `@3 91x3" i $"i#3x q x3 |p@4'!p!p!p!p~ yxX@@44vpx2|~~ ~ " I4 q4*h$@4:x1dx4:q42x2.x4pq44x2.p4p4p I |~~~~ ~ "  I4J 1p h&ppp@4hSpp4j Ip |~~ ~ "  I4yh `hklW1~pp4,X'``p`pppvp 1 4qp 4 H4x2pklp Ip | 4Ѣ4̀|~ @44H444x4#4~2 |~2x45c `x x"5[x$x" 84!5  ~?x/ `d5 i8@h@58@58h0 @58!@58 @6@ a;  `<@5N`>5N`@5N~xIp5Tx5> @5[ x5>x5xx5fx5x7 |x<x>5wx@x>xH@5wxJ5wxI|x4x65x8x6 xD5 xF[ @ e@5` @5`"@5`,@x5|x(x*5x,x*x05 x2;#@5ˢ "@5À 5# xI| i8@h@5h<@6@goxXh 6= 8+!@5`#x6=h!``?````` BgoxXh@6hhh h6xh`/`+,hx i8@gh xD A! I Q0xe 85"j>86" 8+  8, i8@h | 8O!d ix`hX?``H``/`+h0@@6|hK hH@6ip6ix6`hK hH@6vp6vx6m p6|x6xhh hF 8h xLxJ | y8x6x6x6x6x6 83 84 x3xGxK|  8F"<@6 {*{.| 0 8F"2@6 9"<@6 '{6{:|  8F"<@6  "2@6  {>{B| / 8F"2@6 9q"<@6 &&{"{&|  8F"<@6 ~ 81# 82# | 81! 7U 82! 81 83!7  ;"#@7U"@7@@7@@7@@7@ 7U #  !~ xI|nPTI,ptispptispSUNW,ispQLGC,isp: expected 1 interrupt, got %d clock-frequencyispPTI,ispISR 0x%x SEMA 0x%x%s: cannot allocate request queue %s: could not mapin request queue %s: cannot allocate result queue %s: could not mapin result queue %s: kdma handle already allocated%s: Request Queue Overflow++ %s: kdma handle not already allocatedvm_map_lock_read: intrsafe mapcnopen: recursivefpu_cleanup 1 fpu ieee trap, but no exceptionfpu_cleanup 2fpu sequence errorfpu hardware error (%s[%d]) %s[%d]: fpu hardware error fsr=0x%x fpu errorbogus fpu queuefpu_cleanup 3fpu_addfpu_explodefpu_ftosfpu_implodefpu_rightshift 1fpu_rightshift 2WARNING: matchbyname not valid on sun4!%s /obio/interruptinterruptbootstrap: could not get interrupt node from prombootstrap: could not get interrupt propertiesbootstrap: less than 2 interrupt regs. availablebootstrap: cannot support capability of > 4 CPUsbootstrap: PROM has invalid mapping for processor interrupt register %dbootstrap: PROM has invalid mapping for system interrupt register/obio/countercounterbootstrap: could not find counter in OPENPROMbootstrap: could not find counter propertiestwas brillig.. vmelvmesx%cc%c%cobiosiswespbootpath_fake: unknown system type %dfdsbuslecdbootpath_fakebootpath: /%s%x/%s@%x,%x:%c WARNING: %s map is bogus, using default sd-targetsst-targetscpu_configure: no memreg found!cpu_configure: ROM hasn't mapped memreg!device_typecpuPROM root device type = %s (need CPU)mainbusmainbus not configuredPROM sync command%d%s at %s %saddr 0x%xiono PROM root devicenameproperty lengthreghierarchical%s "reg" %s = %d (need multiple of %d) warning: %s "reg" %s %d > %d, excess ignored address%s "address" %s = %d (need multiple of 4) intrinterrupts%s "intr" %s = %d (need multiple of 8) WARNING: %s interrupt %d has nonzero vector romprop'n'n 'qled'rX'rP'r@'r0'p0'r('r'r'q'q'q'qvirtual-memorypackagesoptionsopenprommemoryinterrupt-enablealiasesauxiliary-iocounter-timereeprommemory-error'n8'p0'r'r'q'r('r'q'q'qeccmemctlSUNW,sxSUN-4/%d series: %s obio missingfbno options in OPENPROMcould not find %s in OPENPROM audiozsfindzs: unknown zs device %dfindzs: no obio nodeslavefindzs: cannot find zs%dpre_panic: makememarrmakememarrmakememarr: hope version %d PROM is like version 2 makememarr: limited to %d makememarr: cannot find "memory" nodeavailablemakememarr: no memory foundmakememarr: WARNING: lost some memory WARNING: getprop not valid on sun4! %s node 0x%x property %s length %d > %d getpropintsearch_prom: null nodeiommuWARNING: opennode not valid on sun4! %s ' line# >body >user %lx ! ' column# >body >user %lx !stdout @ is my-self addr line# %lx ! addr column# %lx !romgetcursoraddrPROM exit failedPROM boot failedraidrdstxdsdxyuse one of: %s[a-p] %sparsediskno memory for mountroot_hook%s%dsetroot: device name too longroot device (default %s%c): swap device root on %s%c can't figure root, hope your kernel is right setroot %cconfig_attach: device name too longgetdevunitcache enabled cache_enable: can't handle 4M with hw-flush cacheDVMA coherent vm_map_lock_read: intrsafe mapfp align without being the FP owning processfixalignstray interrupt ipl 0x%x pc=0x%x npc=0x%x psr=%b EC EFSPSETcrazy interruptsAsync registers (mid %d): afsr=%b; afva=0x%x%x SYSERR UNCORR TIMEOUT BUSERRAFONMI: system interrupts: %b fVMEfSBUSbKbSbEbAbSCbTbVIbMIbFbVbMbIbMEbMAnmiintr_establish: level (%d) > block (%d)intr_establish: strange block level: %dintr_establish: level %d interrupt tied to fast vectorintr_establish(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xintr_fasttrap: already handling level %d interruptsintr_fasttrap(%d, %p) 0x%x 0x%x 0x%x != 0x%x 0x%x 0x%xsetrunqueueremrunqueuevm_map_lock_read: intrsafe mapreal mem = %d startup: no room for tablesstartup: table size inconsistencycpu_startup: cannot allocate VM for bufferscpu_startup: not enough RAM for buffer cacheunable to create DVMA mapunable to allocate from DVMA mapdvmamapunable to allocate extent for dvmaavail mem = %ld using %d buffers containing %d bytes of memory WARNING: not updating battery clock attempting to power down... WARNING: powerdown failed! halted rebooting dumping to dev(%d,%d), at offset %ld blocks dump area unavailable mmu memory @%p:%d device bad device not ready area improper i/o error succeeded error %d Frame pointer is at %p Call traceback: pc = 0x%x args = (0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp = %p mapdev: zero sizemapiodevcurproc = %p, pid %d no curproc uvm: swtch %d, trap %d, sys %d, intr %d, soft %d, faults %d stack trace with sp = 0x%lx stop at 0x%lx 0x%x(0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x, 0x%x) fp %p end of stack trace g0 panicw: case 4 w: unknown case %ld w: arg not allowed warning: ldcontrolb called in sun4m vm_map_lock_read: intrsafe mapmmrwmmrw: out of space in kernel_mapvm_map_lock_read: intrsafe mapVA2PA: Asked to translate unmapped VA %ppmap_page_upload: no memory?mmu_reservemon4_4c called on Sun4M machinemmu_reservemon4m: no existing L0 mapping! (How are we running?mmu_reservemon4m: can't handle ROM 4G page sizemmu_reservemon4m: unknown pagetable entry typemmu_setup4m_L1: unknown pagetable entry typemmu_setup4m_L2: unknown pagetable entry typemmu_setup4m_L3: PTD found in L3 page tablemmu_setup4m_L3: unknown pagetable entry typeme_alloc: all pmegs goneme_alloc: LRU entry has no pmapme_alloc: stealing from kernelme_alloc: LRU entry's pmap has no segmentsme_alloc: LRU entry's pmap has no ptesme_free: no segments in pmapctx_freepv_changepte: pm == NULLpv_changepte: no segmentspv_changepte: pte == NULLpv_syncflags: no segmentspv_unlink0pv_unlinkpv_link_4_4c: allocation failedpv_changepte4m: pmap == NULLpv_changepte: invalid PTE for 0x%xpv_syncflags4m: no pte pmap: 0x%x, va: 0x%x pv_link4m: allocation failedpmap_bootstrap: unsuitable number of segments (%d) rp->rg_segmap == NULL! pvplL1 pagetableL2/L3 pagetablepmap_release: segment list not emptypmap_release: releasing kernelpmap_rmu: no segmentspmap_rmu: no pagespmap_remove_all: empty vregpmap_remove_all: empty vsegpmap_page_protect !PG_V: ctx %d, va 0x%x, pte 0x%xpmap_protect: last segmentpmap_changeprot: no segments in %d pmap_changeprot: no segments in %d! pmap_page_protect4m: empty vregpmap_page_protect4m: empty vsegpmap_page_protect4m: !TEPTEpmap_enter4_4c: can't fail, but didpmap_enter4m: can't fail, but didpmap_enk4m: can't enter va 0x%lx below KERNBASEkvm_uncache: table entry not ptekvm_uncache !pg_vtrapsvr4 gethrestimesvr4 gethrvtimesvr4 gethrtimesvr4 setpsrsvr4 getpsrsvr4 setccsvr4 getcckgdb exec4.4 syscallsvr4 syscallinteger overflowfix alignrange checkclean windowsflush windowszero dividebreakpointsyscallv8 insn access MMU missv8 data access MMU missv8 store errorv8 idiv by zerov8 data errorv8 cp exceptionv8 unimp flushv8 cp disabledv8 text errorv8 r-reg errorlevel 15 intlevel 14 intlevel 13 intlevel 12 intlevel 11 intlevel 10 intlevel 9 intlevel 8 intlevel 7 intlevel 6 intlevel 5 intlevel 4 intlevel 3 intlevel 2 intlevel 1 intwatchpointtag overflowdata faultfp exceptionalignment faultwindow underflowwindow overflowfp disabledprivileged instructionillegal instructiontext faultasttrap type 0x%x: pc=0x%x npc=0x%x psr=%b EC EFSPSET%s[%d]: unimplemented software trap 0x%x trap T_RWRET 1trap T_RWRET 2trap T_WINUFfpe without being the FP usercoprocessor instruction T_CLEANWIN T_RANGECHECK T_INTOF text fault: pc=0x%x ser=%b WRITEINVALPROTTIMEOUTSBUSERRMEMERRSZERRWATCHDOGkernel faultdata fault: pc=0x%x addr=0x%x ser=%b text fault: pc=0x%x sfsr=%b sfva=0x%x CSERRPARITYSYSERR UNCORR TIMEOUT BUSERRFAVOWdata fault: pc=0x%x sfva=0x%x sfsr=%b syscall cpcb/ppcbsyscall trapframesyscall nargsvm_map_lock_read: intrsafe mappagemove 2dvma_mapin: null page framedvma_mapout: extent_free failed vmapbufvmapbuf: null page framevunmapbufcpu_fork: curprocsdcddisk label read errordisk label corruptedno disk labelSunOS disk label, bad checksumi7i6i5i4i3i2i1i0l7l6l5l4l3l2l1l0o7o6o5o4o3o2o1o0g7g6g5g4g3g2g1g0wimynpcpcpsr kernel: keyboard interrupt kernel: %s trapFaulted in DDB; continuing... prom?%s(0x%x, 0x%x) at i7fpi5i4i3i2i1i0l7l6l5l4l3l2l1l0o7spo5o4o3o2o1o0g7g6g5g4g3g2g1g0fqwstateotherwincleanwincanrestorecansavecwppiltlpstatetbaticktttstatetnpctpcillegalasrfprspcasiccryxcciccfcc3fcc2fcc1fcc0pageone_writen_writesone_readn_readsfqtoifdtoifstoifdtoqfstoqfitoqfqtodfstodfitodfqtosfdtosfitosfxtoqfxtodfxtosfqtoxfdtoxfstoxfdmulqfsmuldfdivqfdivdfdivsfmulqfmuldfmulsfsubqfsubdfsubsfaddqfaddd34efaddsfsqrtqfsqrtdfsqrtsfabsqfabsdfabssfnegqfnegdfnegsfmovqfmovd4efmovsswapaswapcasxastwa8r7rprefetchaqrprprefetchldstubaldstubt2ds2dcasaldxaldshaldshldsbaldsbldswaldswstdastdstqastqsthasth6q6pstx5q5pstbastbe8e7eqepd8d7stadqdpstlddalddldqaldqlduhalduhq6p6ldxq5p5ldubaldub8e7eldfaqepeldf8d7dldaldmovrgezmovrgzmovrnzmovrlzmovrlez1jdmovrzsdivccsdivretrydoneid2dpopcudivccudivrestoresdivxudivxsavemovomovulemovugemovuemovlgmovulmovugmovuojdmovvsmovvcmovnegmovposmovcsmovccmovleumovgumovlmovgemovlemovgmovemovnemovn0jdmovasubcccsubcflushTdsmulccsmultvstvctnegtpostcstcctleutgutgetletgtetnetn0F12FtaWdumulccumulqpreturnPdUNDEFINEDmulxqdpdjmplYdrdaddcccaddcimpdep2sraxsraxornccxornimpdep1srlxsrlornccornFPop21Edsllx1DdsllandnccandnFPop1mulsccsubccsub1iT12Ttsubcctvxorccxor1iW12Wtaddcctvorccor1iP12Ptsubccandccand1iY12Ywrtaddccaddcc1id12daddfbofbulefblefbugefbgefbuefbefbnefblgfbulfblfbugfbgfbufbnap,mfbabrgezbrgzbrnzbrlzbrlexap,1lbrzap,ubvsbvcbnegbposbcsbccbleubgublbgeblebgbebnebna,mbaCdsethimilltrapncallnop undefined %s,a,pt,pn %%%s%%f%ld0x%lx%%asi0x%-2.2lx%%fcc%ld[%%%s + %%%s] %ld[%%%s + 0x%lx] %%asi%%fsr0x%lxl#%s%%hi(0x%lx)%%psr%%tbr%%wim%%y(UNKNOWN), vm_map_lock_read: intrsafe map/emul/svr4vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapsvr4_readdir_callbacksvr4_readdir64_callbacksbrk: grow failed, return = %d svr4_setinfosvr4_waitsvr4_sys_statvfssvr4_sys_fstatvfssvr4_sys_fstatvfs64vm_map_lock_read: intrsafe mapsvr4 socket cookie mismatchsvr4_sock_ioctlunknownsvr4_sys_xstatsvr4_sys_lxstatsvr4_sys_fxstatsvr4_sys_stat64svr4_sys_lstat64svr4_sys_fstat64svr4_sys_uname0unsupportedvm_map_lock_read: intrsafe mapti_bindsvr4_stream_ti_ioctlsvr4_sys_putmsgsvr4_sys_getmsgsvr4_term_ioctlpc or npc are not multiples of 4! svr4_sendsigT_SVR4_GETCC T_SVR4_SETCC T_SVR4_SETPSR (sparc) svr4_sysarch(%d) vm_map_lock_read: intrsafe map/emul/sunosvm_map_lock_read: intrsafe mapsunos_sys_ioctlvm_map_lock_read: intrsafe map4.2ffsnfssunos_sys_mountsunos_readdir_callback1sunos_sys_unameMagma 2+1HS SpMAGMA 2+1HS SpMagma P2 SpMAGMA,P2_SpMagma P1 SpMAGMA,P1_SpMagma 8+2 SpMAGMA,82_SpMagma 4+1 SpMAGMA,41_SpMagma 2+1 SpMAGMA,21HS_SpMagma LC 2+1 SpMAGMA,21_SpMagma Fast 16 SpMAGMA,16HS_SpMAGMA,16_Sp_2Magma 16 SpMAGMA,16_SpMagma 12 SpMAGMA,12_SpMagma 8 Sp - 422MAGMA,_8SP_422Magma Fast 8 SpMAGMA,_8HS_SpMagma 8 SpMAGMA,8_SpMagma 4 SpMAGMA,4_SpMAGMA_Spmagmamttymbppmagma_prom %s (unsupported) clock pri %d softpri %d: %s magma_attach%s%x: fifo overflow %s%x: ring buffer overflow : %d tty%s smttydcd: %d port%s mbppdelaymbpp_sendmbpp_recvspifsttysbppSUNW,spif: expected 2 interrupts, got %d : expected %d registers, got %d revlevverosc: rev %x chiprev %x osc %sMHz stcpri %d ppcpri %d softpri %d : %d tty%s ssttycd%s-%x: ring overflow CCR: timeout : %d port%s bppSUNW,bpp: Zebra : DMA2 : Unknown type %s: draining still active (0x%08x) xboxSUNW,xboxmodel: model %schild-presentfalse: no devices write0-key ranges%s: PROM ranges too large: %d %s at %sexternal battery discharginginternal battery dischargingexternal battery charginginternal battery charginglid downexternal mouse attachedexternal keyboard attachedexternal VGA attachedexternal battery attachedinternal battery attachedmain power availabletctrluctrl: expected 1 interrupt, got %d : expected 1 register, got %d pri %d intr%s: %s%s, %s: (op=0x%02x): unexpected data (0x%02x) %s: (op=0x%02x): unexpected ack value (0x%02x) %s: (op=0x%02x): unexpected data (0x%02x) in state %d %s: SHUTDOWN REQUEST! %s: VERY LOW POWER WARNING! %s: LOW POWER WARNING! %s: main power %s removedrestoredremovalinsertiontslotts102ranges: expected %d memory ranges, got %d pri %d: %d slots pcmcia socket %d%s: slot %d still busy after 3 seconds, status 0x%x %s%s: unable to create event kthreadtslot_event%s: invalid slot number %d %s: invalid event type %d on slot %d %s: %s event lost on slot %d %s: spurious interrupt on slot %d isr %x stp socket %d: rev %x pcmcia%s%s: unable to create event threadpcicevstp4020_event_thread: wayward socket number %dstp4020_event_thread: unknown event type %dstp4020_queue_event: can't allocate eventstp4020[%d]: spurious interrupt? stp4020: preposterous delay: %ustp4020_delaySUNW,pcmcia: only %d register sets : expect 2 interrupt Sbus levels; got %d : attach: cannot map registers pri %d and %dpcmcia pcmcia_card_attach%s: error %d detaching %s (function %d) %s%s, " (manufacturer 0x%x%sproduct 0x%x)at %s function %d "pcmcia_function_init: function is enabledpcmcia_function_enable: function not initializedcard has intr handler, but no function doesfunctions have ih, but the card does notdisestablishing last function, but card has no ihchanging ih ipl, but card has no ih%s: can't alloc memory to read attributes %s: can't map memory to read attributes %s: CIS checksum failed %s: CIS version PCMCIA 1.0 PCMCIA 2.0 or 2.1 PC Card Standard %d.%d unknown (major=%d, minor=%d) %s: CIS info: , %s %s: Manufacturer code 0x%x, product 0x%x %s: function %d: unspecifiedmulti-functionmemoryserial portparallel portfixed diskvideo adapternetwork adapterauto incrementing mass storageSCSI bridgeSecurity servicesInstrumentSerial I/O Bus Adapterunknown (%d), ccr addr %lx mask %lx %s: function %d, config table entry %d: memory cardI/O cardcard type unknown; irq mask %x; iomask %lx, iospace %lx%s%lx-; memspace %lx%s%lx%s%lx@; maxtwins %d; mwait_required rdybsy_active wp_active bvd_active io8 io16 irqshare irqpulse irqlevel powerdown readonly audio%s: %d errors found while parsing CIS pcmcia_parse_cis_tupleV1-1FD605 PCMCIA EtherNet CardSVEC%s: using CIS quirks for , %s %s: couldn't establish interrupt : function enable failed : unexpected number of memory spaces %d should be 0 : unexpected number of I/O spaces %d should be 1 : can't allocate i/o space : can't map i/o space port 0x%lx/%dep_pcmcia_attach: impossible, couldn't establish interrupt:'@'0z'('  '''''''''''@''@''''p'h@3'X'P'H'(' l''X'H''X''''''''`''''X'''X''xHT'h'XGC'`'P'p'H''8 '0'''HT'''@CGCZ)IeI'''ZIZIIIII0I0PI0''IE0'']IE0''PI I''''@"'p'h'p-/'X'@'X'('X''X''''X' ")''u '''x'p@&  @& 3BIE0@IE0HTIE0''@I@#(01.00CFE-10CompactCard EthernetXircom8041TX-10/100-PC-Card-V2SMCcorega FEther PCC-TXDFEther PCC-TXFcoregacorega FastEther PCC-TXcorega EtherII PCC-Tcorega Ether PCC-TDcorega Ether PCC-Tcorega K.K.PCLAI-O DATAE-CARDLINKSYSDFE-670TXDDE-650Ver 1.0EtherFast 10/100 Integrated PC Card (PCM100)LinksysFast EthernetETHER-C16Fast-Ethernet10/100 Ethernet CardiPortEthernet CardR01NIC-2000pGVCTAMARACK004743118001ANDCLNT-10TN1.0VFastEthernetNE2000DCN40BC EthernetCNetP/N: EEN10B Rev. 00Seiko Epson Corp.V1-1FD605 PCMCIA EtherNet CardSVECAdapterEthernetW89C926ETHERNETEN2212ACCTONEP401 Ethernet NE2000 CompatibleRPTICISV100EP400RPTI LTD.DE-660+DE-660D-LinkUE2212PCMCIADEPCM-XXDIGITALPE-200PMX AMB8002TAmbiCom Inc: unexpected I/O space configuration : unexpected number of i/o spaces %d should be 1 or 2 : can't allocate I/O space : no suitable config entry : can't get subregion for asic : function enable failed : can't map NIC I/O space : can't map ASIC I/O space port 0x%lx/%d: can't match ethernet vendor code no irq %s: couldn't establish interrupt %s: can't alloc mem for enet addr %s: can't map mem for enet addr %s: can't alloc mem for LAN iobase %s: can't map mem for LAN iobase V'ΐ'pw'p'`'H'('`'''''ͨ'͠'͐'̀'`'H'8'(''P't'̸t'̸V'̰'̠''xV'h'(''H'0'8'''V'˸'ˠ'ː'pV'h'H' ''''V'''ː'ʰ'ʘ'ʈ'h'̀'X'8'o'o 'P'ɰM'ɘ'p'Pk'0&'h'= '='Ȩ s'ȀPs'X'0SpeedStream 1021 Wireless PCMCIA CARDAirVast WN-100 Wireless LAN PC CARDNetgear MA401RA Wireless LAN PC CARDNOKIA C110 Wireless LAN PC CARDNOKIA C020 Wireless LAN PC CARDACTIONTEC PRISM Wireless LAN PC CARDProxim RangeLAN-DS/LAN PC CARDDSSS Wireless LAN PC CardLA4111 Spectrum24 WLAN PC CardLA4111 Spectrum24 Wireless LAN PC CardSymbol TechnologiesEMTAC A2424i 11Mbps WLAN CardBUFFALO AirStation 11Mbps CF WLANBUFFALO AirStation 11Mbps WLANELSA XI800 CF Wireless LANGEMTEK Prism2_5 WaveLAN CardEval-RevAPRISM 2_5 PCMCIA ADAPTERIntersilI-O DATA WN-B11/PCMCabletron RoamAboutRoamAbout 802.11 DSCabletronAddtron AWP-100AWP-100 Wireless PCMCIAAddtronNTT-ME 11Mbps Wireless LAN PC Card11Mbps Wireless LAN PC CardNTT-MENEC Wireless Card CMZ-RT-WPVersion 01.01Wireless Card CMZ-RT-WPNECTDK LAK-CD011WLContec FLEXLAN/FX-DS110-PCCCompaq Agency NC5004 Wireless CardXI325 Wireless LANXI300 Wireless LANNANOSPEED ROOT-RZ2000 WLAN CardNANOSPEEDSMC 2632 EZ Connect Wireless PC CardSMC2632WSMCLinksys Instant Wireless NetworkSamsung MagicLAN SWL-2000NIntersil Prism IIVersion 01.02HFA384x/IEEEINTERSILIntel PRO/Wireless 2011Corega Wireless LAN PCCL-11ISL37300PWL PCCL-11coregaCorega Wireless LAN PCCB-11Wireless_LAN_PCCB-11corega_K.K.Corega Wireless LAN PCCA-11Wireless LAN PCCA-11Corega Wireless LAN PCC-11Wireless LAN PCC-11corega K.K.3Com AirConnect Wireless LANWaveLAN/IEEE: function enable failed : can't alloc i/o space : can't map io space port 0x%lx/%d%s: couldn't establish interrupt %s: already detached MD5Final  %c  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc  !"#$%&'()0123456789@ABCDEFGHIPQRSTUVWXY`abcdefghipqrstuvwxy0123456789abcdefghijklmnopqrstuvwxyzvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapCLGET: returning %x ttcompatgetflags: %x vm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapvm_map_lock_read: intrsafe mapcompat_25_sys_statfscompat_25_sys_fstatfscompat_25_sys_getfsstatvm_map_lock_read: intrsafe mapsparccompat_09_sys_unamecompat_43_sys_acceptcompat_43_sys_getpeernamecompat_43_sys_getsocknamevm_map_lock_read: intrsafe mapOpenBSD3.4GENERIC#61 @(#)OpenBSD 3.4 (GENERIC) #61: Tue Sep 9 11:39:05 MDT 2003 OpenBSD 3.4 (GENERIC) #61: Tue Sep 9 11:39:05 MDT 2003 deraadt@sparc.openbsd.org:/usr/src/sys/arch/sparc/compile/GENERIC (3sun4c compatible0 0 f8000000 15c6a0 map-pages(3spurlev1lev2lev3lev4lev5lev6lev7lev8lev9clocklev11lev12lev13profd'(4B"  <<d d@@((HI5wG1vuF-|E@ @D@H  0 0    # ############͸#Ͱ#͠#͘   rNOPQRSTUVWXYZ[\c]^_gd`bfeh !"CDEFG}~HIJKuvwxB&'(9:;#$&'z{9:=>2<=?*({P({h(Up(X););(Up(X(((Up(YH(Ұ((Up(YH(( (Up(YH(4(L(Up(YH(((Up(YH(((V(Y@(|(Ԕ(Up(YH(|(Ԕ(V(Y@(|(Ԕ(V((Y@((,(V0(Y@((,(V8(Y@(Ԩ((Up(YH(Ԩ((V(Y@(Ԩ((V@(Y@(P(h(V((Y@(P(h(VH(Y@((((V(Y@(@(X(Up(YH(@(X(V(Y@(՜(մ(Up(YH((((Up(YH((((V(Y@((((V(Y@((((V(Y@(x(ݐ(Up(YH(x(ݐ(V(Y@(x(ݐ(V(Y@(x(ݐ(V (Y@(x(ݐ(Up(YH(x(ݐ(V(Y@(x(ݐ(V(Y@(x(ݐ(V(Y@(x(ݐ(V(Y@(4(L(Up(YH(4(L(V(Y@(((Up(Y((((Up(YH((((Up(Y`((((Up(Yd(\(t(V(X(((V(X(((V(Y($(<(V(Y(P(h(V(Y(|((V(Y(((V(Y(((V(Y(((V(Y(|((Up(X(((V(YD(((V(YD(L(d(V(YD(((V(YD(( (V(YD(((V(YD(((V(Y@(((V(Y"(((V(Y (( (V(Y"( (8(V(Y"( (8(V(Y (L(d(V(Y ((x(Up(Y\'(((Up(Y\'(((V(Y ((s(V(Y@((s(V(Y"((s(Up(Y4'((s(V(Y ((s(Up(Y'(`(x(Up(YH(`(x(V(Y@(`(x(V(Y"(((V(Y"((l(V(X((((V(Yt\)0l)0(V(Y")0l)0(VP(Y@)0l)0(VX(Y@)0l)0(V`(Y@)0l)0(V(Y )0)1 (U(Yh_)1|)1(V(Y )2,)2D(VX(Y@)2,)2D(V`(Y@)2)2(V(Y )2)2(Vh(Y@)2)2(Vp(Y@)2)2(V(Y )3<)3T(VX(Y@)3<)3T(V`(Y@)3)3(Vx(Y@)3)3(V(Y@)4L)4d(V(Y )4)4(V(Y )5)5(V(Y@)5)5(V(Y )6)6((V(Y )6)6(V(Y )7 )78(V(Y )7)7(V(Y )80)8H(V(Y )8)8(V(Y )8(tP(Up(YLb)8(tP(Up(YPb)8(tP(V(Y")8(tP(V(Y@)8(tP(Up(Y:b)8(tP(V(Y )9)9((V(Y@)9)9((V(Y@)9)9((U(Yh_)9)9((U(Yh_)9)9((U|(Yh_)9)9((U(Yh_)9@)9X(U(Ylc)9@)9X(U(Ylc)9@)9X(U(Ylc)9@)9X(U(Ylc)9l)9(V(Xg)9)9(U(Yh_)9)9(Up(Yh_)9)9(V(Y(o):0):H(U(Yh_):\):t(V(Y@):(st(V(Y ))(V(Y ))(Up(YXr))(Up(YXr),)D(V(Y )X)p(Up(YTr))(Up(YTr))(V(Y ))(V(Y )H)`(V(Y@)|)(V(Y )$)(V(Y )T)@(V(Y.s)L(t(V(Ypy)(th(V(Ypy)(t0(V(Ypy####θ#Ψ#Π#Θ#ΐ#Έ#΀#x#p#h#`#X#P#H#@#0#(`P  j + C  +X0C<8L Y@ 7|Llx######X#H#8#(##########x#h#`#P#@#0# ########x#`#P#8#########h#X#@# ########h#P#8# #######x#`#H#(####X#H#8#(######H#(#0#####x#h#`#P#@#0# ###### #x########x#X#8#x# #########x#h#X#H#8#(##########p#`###x#h#P##(# ########$ # $ %$ $$ $ 7n$ $"THIS is A memory TEST pattern+a'+e(t $:   t  $T+sx$=@$=8 $=(u$$=$=|$= $=$=$$=xP$=p$=h$=XEL$=P$=HZ($=T$=`$=l$=x$=$=$>$>'$>#$>#$>($>V$>[$>[$>h$>xh$>p$>hY$>`Y$>XH4$>PH4$>@IH$>8IH$>0H$>(H$> H$>$> $>$=8 $>(uT$=(v$$=$=_$?  4!@!!!xx+~+~P(xh(t-q$EP(y8$EH(z$E8(y4$E((y,$E (y0(z+X2$G0$G($G $GH$G8$G(@iimm$GPL$K $K$K$K$K$J$J$J-Pa ##$8@ ;T++^_`_|_PXv|w4TF{|PN|RR}xCE}ST~`NMxzCLz0PLz0RE{@RR}xCE}ST~`SLw\RR}xCE}ST~`ER~hCE}ST~`( c(@e(l(( (((0(H`(tH((( c($(P( a(((4(l(((( (L(x b(o$(o(((,(Td(X((((( b+(}( (0(H`(tH(o$(o(((,((+(~( 2(0(H`(tH(o$(o(((,((( b+(D@ 4)|d)s(!native!(@!tnative!(%d!$eH$e8$e(0((1   ,#h ؀ 0 | ( ո d 8iL # #$T  44 t         <# p#ˆ0A PL   ٤ L   ###0#100#DkD d P00 4  ##4##0#Ʉ0 0 h ,  , ##nj#!!   t0 #<##D# #ƈ #0 L0 H T  8#\ <##  ה H P    x0 ##ɬ##Ȩ#0#| # #d0000K###00 000!0000000 , \00000080000  h  G\X  0 ܜ  ht  0YdYdYdYdYdYdYdYdYdYd0  0 0X  0 P l00000X000000000 1   H  p p (  x   ԰  < (0000000    T0  (0`<((((($(,$p$p$p$p$p$p$p$p$p$p$p$p$px$pp$ph$pX$pH$p@$p0$p $p$p$p$o$o$o$o$o$o$o$o$o$o$o$ox$oh$oX$oH$o8$o0$o $o$o$n$n$n$n$n$n$n$n$n$np$nh$nX$nP$n@$n8$n($n $n$n$m$m$m$m$m$m$m$m$m$m$mp$m`$mX$mP$mH$m@$m0$m $m$m$l$l$l$l$l$u`$uX$uP$uH$u@$u8 0 (8(@(H(HB@(Yx$~x$~`$~P@H@( eff,fx p $$$$$$$$$$$$$$$$$$$$$x$p$h$$`$X$H$@$8$0$($$ $ Ä́<8 \\l ttyclsttyopnttybgttyinttyout 6 6 7 8T \ =d @ GL Y T =< = Y > \ =d @ GL Y T =< = } } ~ , ~l =< > / 0 1| ; 4H > o q` r t x h P = Y > ht h i j $  0( H( H|<Dp$ 'h .(( D T |P%ffsT%mfs%Pext2fsP$_hcd9660$Pmsdos% nfs}$ɸprocfs $Xnull $јunion$pumap $portal$fdesc$tkernfs ((((Ō( (Ɣ((`((((p(((|$°$((|(~(<($(((D( c c2lockf@` $8$0$($ $$$$$ ( c(( 0( (( c(( c ( @( cX,l(l T h   l$$( $(8 $(d $( $( $( $( $(@ $(l $(($8($H( $X($h(H$x(t$($($( $(( $(X $( $( $( $( $(D $((p$8($H($X( $h( $x(L $(x$($($($(($(T$($($((((((@(l(((((H(t(((($(P(|((((4(l(((( (L(x((((((T(((((0(\(( c(@ h(l ( ( x(( (H (t ( ( ($ (P 0(( (4 (l ( ( ( ( (L (x ((( (( c (T L( 8( ( cX( ( (,t(( c(@ $(l(( (p(((H ((t +( 0h( 0($ 0( a(P 1$(((4 2T(l((( 2|( -(L 0(x b( 1`( 1( c(( c (T 2( 2( 2<( cX( 1((,x($ $ $ $$( c(@ 2(l :( :( 2( 9( :(H :(t :( 5( 6(($ 7(P 8@(| :( a(( :(4 :(l :( :( :( :( :(L :(x :( 8(( c(( c (T 8( :( 9( cX( : ( :(,(0 ;( ; ; <@fifo aw( c(@ E(l(( GT(( G\(H G(t I( I0( I($(P( a(((4 L(l((( M( J(L(x b( L( L(( c(( c (T MD( MD( L( cX( LD((,(( \(@ |(t (H ( 8( (( ( p( ( ( ( ( ( ( (T h( c(@ S(l(( U(((H Z (t [ ((($(P( a(((4 \D(l((( \l( [@(L(x b( [H( [h( c(( c (T \( \( \,( cX( [((,(\$h$`$X |$P$H i$@ e$8$0 $( $ $ $ $x $p ( c(@ }(l z( z( x0( x( }(H z(t }( rH( rH($ y@(P z( z( z(4 zl(l z( z( z( z( (L \(x b( y( y((((T yH( z( z8(( y( z,(ldevopndeviodevwaitdevindevoutdeviocdevcls( c(@ (l (( (( $( ( (H (t ( ( (($ (P (| D( a( ( ((4 ((l (( (( (( (( ((L ((x (( (( c(( c (T P( ( 4( cX( t( ( b,(( (@ P(H ( (l ( (( ( p( ( ( ( (t ( 8( ( (T h( c(@ (l H(0 ( p( 8( ̔( (H l(t ( Ѹ( ( Ӹ($ (P @( Ԅ( 8(4 ֌(l x( ( ( D( (L 4( L(x ( ޴( 0( H(( (T ( ( ( |( ( . .. ( c(@ (l =( @( @4( @<( A0(H A(t D( G( I( c($ O(P O( O( P<(4 P(l P( X ( \ ( \( ] (L c(x b( ,( ( c(( c(T dD( d( e( d(( f( f( d( b,L(  zL {20123456789abcdef^^3333$$$X$ߜ#$%&'()*+;,-.;/;0;1B@C= D$E= F$cdeB@LK@B@((8(p0123456789abcdef#2F$We6tHZl~3"VG,ud>ɍ@ۮRdv!0g&vD4UJÎXn|1 wf.TE<ˬBُPftBSap '26L^׈hzRC q`(7&:DV`rcr@Q%"40N\թjxsbPA5$*8FTbp,ӥ>@+R:Nd_mv|ҭ$6 H;*Z^Ol}l~ .<ѵ)B8 Pof~Lt]&н49(J Xnn\M| ׅ(:JD[iVx `/r>֍ 2ZKLyh^ h?.zՕ*8kFzHTY-b<pԝ"0{jNXI\=,jxiiiiiiiiiiiiiiii0123456789abcdef  T  4 `    4   H    4   H           $($$$x$h$X$@$0$ (|<4p%l((,2(08(|$8{`(,]TrPk(MbZy(T(<T~x(T()T(@T?0HJ(3T(2<T(a\T(lTH(/T(7HTP(T%p(( dX}E#(D<8Q @X,2(@AAA==(A* d @@@@@@@@@$((% % pAACIR% `((++6% XZZ[[`(|%A8%|HHHU$U,U4U<6666666666666666666666666666666666666666666666666666666666666666\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\%Pqrr(r`%Xrrrs0%`8sXstss%pt t<tXt% tttu, % uuuv( % %tttt% X#xvp#y% \v% `vP% hv%00 v%@@ tv %X#xvp#y %(\v %8X#xvp#y%@\v%HZww0%PZwPwP' @d@Y4I(l-k`3?q(L@      ?BEFF'' EF''' ?F''F'' F''' F'' EF'' ?EF''' ?EF''' ?EF''' ?EF'''' ?F'' ?BF''' ?BEF''' ?EF''' F'''' F'''''F''FF''FF''F''((((((((( (&(B(^(|(((((($(0(:(D@( c(@L(l(( ((|(H|(t(((($(P(| c( a((;(4Y(lE(((h( (L4(x b( (( c(( c (T(\(( cX(((($,<(( (((H|(t((((( (( c(( c (( cX,8(( 2(((H|(t((L(( (( c(( c (( cX( b,(x%%%%A?<)3N( c(@(lN|(0](N(O(O(P(HQ(tS(s(w( c($Z|(PZ(|( a(|<(Z(4[\(l_P(j(o(q( r(Lt(x b(((u((u0(T(ux(v(u\({({(( b,((L( (x(P(HQ(tS(w(w(|<(((u((u0(v(u\,$(Ŕ( 2(y(P(HQ(tS(yT(y(|<(((u((u0(v(u\( b,,(%%%%%%%x%h%X%H%8%0%(%  ( c(@(l(((L((H(t((($(P( a( ((4(l(((( (L(x( (l( c(( c (T((( cX((( b-(%@%8%( ... ...\\\ ((D(( c(@(l(0((O(,(H|(t4(\(\( c($Z|(PZ(| c((x(4(l(d((( L(Lx(x b(( (u((u0(T((ux(v(u\({(( b-(Ȝ( (x(,(H|(t4(w(w((( (u((u0(v(u\-(( 2(y(,(H|(t4(yT(y((( (u((u0(v(u\( b-(L&&'+/ 245 55\(((˜m<pp,s<||`{h <rD0123456789abcdef()c, p(|,`(,|[rPkZy(Xh(:4XhXN`(<$(+((,0(3(2 (lH() Xh( Xh(gXh(Xh&((@ ߄@2X Xd$`2(@AAA==(A*gQ (Ь(Ь &&P0(8|D<`<~<~bb<,`b~ `~B`bBBbbvvBb<~ <~ b<,`@ ~ `~BvBBBBF@BvvBvH,d&'D( &(D(&(D(&(D(X&(0 &+ 0,&+P0P&+X0&+`0P&+h 0T&-T x&-߿sparcsparc&-x(L&- x! $( !4!!!!"#$( !4!!!!($l( @L!!3($l 0t!!l!!!<!3($l( L!!l!!!?(?0?H?d???@ ,(&7&7&7&7&7HHHHI\J&98$lP @&9TP `&9x #P(&9h *P(&9X *PP&9P #PP&9H *P(&9@MO&9PDrr&>&>&Q&Rww@&U&VHx`4D,&X D,&Y(D,&YƼ(D,&Y PD,&Z pxD,&ZXTD,&Z&]&]&]&]&]&]&]p&]`&]P&]@&]0&] &]&]&\&\<DL&0X&P h11&&H&@&8K>>ApAhB&XFRHlKT_t_&zdi& ~D~p&\,L ,&8&&0&P&h&x&4&0&&T&ht&&8&0Pt@&,tvl,H&amd7930xaudioamd$d,4h  4 ,` `!%*++++,8|&SUNW,CS4231aonboard1@%+>IV"k}3 3 D &ǐ<<==^^T^&܀&(d&(& &&&&&&&&&&&&&ָ&ְ&֨&֠&֘&֐&H&@&8&0&ט&א&׈&׀&x&p&h&`&X&P&ذd2d8  D++#aa@(([//\))](-{/-|)-}!!c/l-y-soxoco<<>>??  ` ~ ^ "' AAA AA'CEEEEIIIINOOOOOUUUUYaaaa aa'ceeeeiiiinooooouuuuyy"A"E"I"O"U"a"e"i"o"u"yA^A`A*A~ACE^E`EI^I`I~NO^O`O~OU^U`UYa^a`a*a~ace^e`ei^i`i~no^o`o~ou^u`uy&&&&&&&&&&&ݸ&ݰ&X&P&H&@&8&0&(& &&Boldface(">""""&n@T((T`px|~~|xp`>~~>8|8888|8fffffffff~t0xs; x8|8888|88|8888888888888888|8 003f$ff$<~~<wfllllllll||| 0 `F8ll8vv0 000000 0 0f<ffff<~~~~`0``|```0||~~0  0~ 0`0 ~p~vv8ll8 Pp lllllx0`|||||||Gallant (000` 3ff?ff`f>``f`?8`DDE9  2 2 a>wc`aaa?`  0  0f`vvf`    ` 00`000000006??a@ 0  @````@``@? !? ?1```@```0 00`gop``````p@??`@@000  000 ``````p?```<     `xx``88`9  ?0```g ollg`0? ? @@`@`````a``````````` `````` 0 @a``````````````````@a0@0@000?00000 0 0@0@000?000000x` ````a`` `0````````````````````````80acflxx|ngca`px00000000000 0 p`pppY`Y`Y`M`N`N`D`D`p` p x X L F G C A@@@`0 ````````````` @0@00`0`0`07000000x `````````````0@8@#a````|ngca`p0`` ` p<@`@``F p` ` ` ` ` ` ` ` ` ` p@?`@000 f f f v w@3@7@;;p` 0@8   @`p` 0@ ?   ?``00 || ||1`0009 ```gop````````p`xO1 ````p@0`````1 ````````p9`p0``````0`   1```1?`? `@ @ ?0p00790000000y 08````acf|x|ngcnf`f`f`f`f`f`f`p'y0000000y ````````p@8q``````````@p````  ````````p`8````s48000000x00@8 0?  @y00000009`p` 0@0@ pf f f 7@;@;@p@8  ` 0@0@  xp`A8 p`8    8 >`6gC0000~|V`s@ o`?0000?o`@ ``00`0?a00`0`00/@)@(@(@)@/@0``0`0`?` 6ll6 `??0/@)@/@*@*@+@0 33 ???<f0`~<ff< y00000009>`0000x?```?````````` 8<0`0`0`?l6 `` 6l08@@@@08 8D8D8@@@@ 000@9  ? @@` ? @@` ? @@`  ? @@` ? @@` ? @@`   # ##CCC` `````` 0 @  0@0@00?000 0 0@0@00?000 0 0@0@00?000 0 0@0@00?000 0  100`0`0``0`0`0`0`0@1 p` p X L F C A@@`0  ``````` @0@ ``````` @0@ ``````` @0@  ``````` @0@ ``````` @0@ 0`  0` `!!c`c`f`f`l`l`8@8@8o p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` ` ` ` ` ` ` p@?p` 0@ ``````````8```acc````````ac 000900090009 0009000900096@&``?fff v@;1 ````p@0  0``````0`0``````0`0``````0`0``````0` Dl88lF ````p@8 'y0000000y  ````````p@8 ````````p@8 ````````p@8  ````````p@8 ````````p@8``#c`f`f`l`|@8?`` y00000009`y00000009`y00000009`y00000009`` 0@0@  xp````aaaaa`` 0@0@  xp((  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͳɿپ̴ް)$)%2)%))%a)&)&x)&)'4)'D)'T)'d)'t)')'  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~)(@o))))p))x))))  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     )*0a?)+0)+)+)'&))!)+std)0)08PQS0SSR@PLM&std)0)0VWW$WWXP@ST$&std)1 )1H_aaala|b`X[\&(1+$A'* + + std)1)1egg,ggh<cXc&Xstd)2X)2mono4oDphhi&std)2)3{8}|||}<xyH&std)3h)3 X`}~D&std)3)4$l\ &std)4x)4 8d8\&4Hl&std)5,)5T$`&std)5)5@,<&Hstd)6<)6dH0@` &std)6)6tĄX(L&Hstd)7L)7tȴɈ8ʔʤH`Ƅ&std)7)7͸Ό<X,&std)8\)8ڌۄ,܈ܘܠH@؈&HT&&&&(p& P  @' 4 d' , W( W' X [ \,'  ipژ  ' '  $ P x ' |  0 ` 'o'v'v'v 'v 'n'u'n'u f b ip c cp h|Q0BELFL4U$T,7:;TDLLLhР * &L , '8 & +acHh4m4~<W,XxPhhh l p!!YYYYYY D 4 ,      58!-!.!.!.!1!1PQ f b h hL c|4{@ 4 58=t==At?8?BELKLL4acHl|lm4244D4 Z [ \@ ^p k _X kX 4 58 `x aP a c k kX f jhǬ<  * &L + + '8"*$,4<W,XxYY4h l   pstu\vDw,x$!2!2$!2ACDDELFRE 4N(O8TT""X"<"͜"0"D" 4 58"׼"t"٬"""8""0""D"0"" 4 58""$"4"L"t"l"T""|# k| l l n ph x| y7:CDTD,-D8<(5ABdOSSYYYYYYST[_b^^Ph$,}  |  !8)V)Vx)V!7!8D'''''p'`'H'8'(''''('('('('(''''''''x'h'X'H'8'('''''('('''('('''''p'('('('('('('('('('('('('('('('X'('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('('P'@'0' ''''''''('('('('('('('('('('('('('('('('('('('('('''x'h'X'H'('0ޭ'-ph'-pl'-pp'x-pt'p-px'h+W'`-p|'X-p'P-p'H-p'@-p'8-p'0-p'(-p' -p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'-p'x-p'p-p)\'!'''''''''''''''''''''x'p'h'`'X'P'H'@'8'0'(' '''''''''x'p'h'X'H'8'0'(' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' '' ''''''' ' ' ' ' ' ' ' '' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ''''' '' '`'P'@'0'(@''''''x'p'h'`'h'X'h'P'h'H'h'@'h'8'h'0'h'('h' 'h''h ''h''h ''h''h''h@'p'@'`'@'X'@'P'@'H'@'@'@'8'@'0'@'('@' '@'' @''@'' @''@''@''''$'''' '' ''''@''@''@'' @'' @'' @'x'@'p'@'h'@'`'@'X'@'P'@'H'@'@'@'8'@'0'@'('''h''h''h ''h ''h 'x'h'p'h'h'h'`'h'X'h'P'h'H'h'@'h'8'h'0'h'('h' ' ' ''' '''' '''' '''' '''' '''' ''''ȁ '''' '''' '''' '''' '''' '''' '''p' 'p'''h ''` 'X' 'X''P' 'P' 'H' 'H' '@' ('8'( '8''0' '0'('('( '(' (''( '' '' 0''0 '''' ''0''0 '' 0''0 '' '' 8''8 '''' ''8''8 '' 8''8 '' '' @''@ '''' ''@'''' ''H'x'H 'x''h' H''`'X'P 'X'HP'@'P '@''8' '8'P''0'(' '(''' '''' '''' '''' '''' '''' '''' '''' '''' '''' '''' '''' '''' '''' '''' ''X''X '''' ''X''''P ''H`''` '''x' 'x'` 'p'h` '`'h` 'X'h` 'P'h` 'H'h` '@'h` '8'h` '0'h` '('h` ' 'h` ''h` ''h` ''h` ''h` ''h` ''h` 'p'` '`'` ''` 'H'` ''` '0'` ''` ''` 'X'` 'P'` ''` '8'` ''` '@'` ''` '''' ''h''h '''h' h''h '''' ''p''p '''x' 'x'p'p'hp 'p'`'X' 'P' x'H'x 'H''@' '@'x$'8'0x'8'x('('0x'('x,' '0x ' 'x4''0x''x8''0x''x<''0x'''h' '' '''' '''' '''' '''' '''' '''' '''' '''x' 'x''p' 'p''h' 'h''`' '`''X' 'X''P' 'P''X' 'X''P' 'P' 'H'@ 'H'8'0'( '0' 'H' 'H''0' '0'(''@( ''8''( '' ('H'( 'H'(''( ''0''@0 ''8''( '' 0''0 '''' ''8''@8 ''8''( '' 8''8 '''' ''@''@ '''' ''H''H '''x' 'x'P'p'P 'p''h' 'h'X''X '''`' '`' 'X'P'X'Hh'@'h '@''8' '8'h'(' h '(''' ''p''@p ''8''( '' ''H ''Px''x '''' ''聠 ''ȁ@''ȁ`''ȁ''ȁ''ȁ''ȁ ''ȁ@''ȁ`''ȁ ''ȁ@'x'ȁ`'p'ȁ 'h'`@'X'``'P'`'H'`'@'`'8'` '0'` @'('` `' '` ''` ''` ''` ''` ''` ''ȁ@''ȁ`''ȁ''ȁ''ȁ''ȁ''ȁ''ȁ''ȁ''ȁ ''ȁ`''ȁ''ȁ''ȁ''ȁ 'x'ȁ@'p'ȁ`'h' -  !" _`abcxyz{|}~ZN]Y^YBYYYYY.YYYYsvr4)q"\)t!|!t ",0  0((1   !|"! ؀ "  |" " d 8"h"@$ #$T00400"'"@"8X"J00!")0 "7p0 "0ˆ"00"2" H"0" " "00"J\ h "h   !"\000000000000"*(00   "000"c"` "@X ٤ L4  8  "5<"7$"1 "04"6d"700"%l"&T00"!P0"000"L\ " d"L1 ( H T "@ "A "B"$0"" ")|00 <"F"* "x "H`0800000000000"H"K"p"(4 00000000000000!!!p000000000")X")t0000l00000X"(0000000000 "D ""C"D"E0"'00!`!!T !0000 ":   t # , P##\ #ƈ#nj # H # #d L 000sunos!)|%d!0((1   ""X" ؀ "  |0 " d iL0 #$T004"h"@000000"00 <"00"xˆ"000000" "0"0 ٤ L "  #0#0 100"kD d P"D0 4 "P 0#4##0#Ʉ0 "0 h ,  , ##nj#0 " t0 "4##D# #ƈ #0 L0 H T  8#\ <## 0 H P    x" ##ɬ0""#|000 #d00 0" "L""|"< # #\0"<"""###"0 "d ("`00000"d0 "$"2Kn,X  `  % K2Kn,X `%K@  @@ @  !"#'''p''`'P@`''@'0 @`'' ' @`'''  @`'''''' @`''' @`'''p''`'P@`''@'0@`'' '''''''@'''@""'4"Ǥ"'"ְ"'"4"x'""'4""'D""'# #\'@''''''x'h'H'(''#@#d' ''##'#@#p#x#####8####'`# T# t# |# # # # #!#$#$#!#$(#%#%'@p#'#'c0' c'c055/ ޸5)),5))=)),=))()H)())l''')),\#\#]#`@#`b5= V@t@#a#c#h#i$#n4#nP#p|#qK%  `   X,nK22Kn,X `%K.symtab.strtab.shstrtab.text.rodata.data.sbss.bss@ #x!#x# )'Ә'/)<)S`5)@)S`߈)S`:)U  +1@#x'Ә)<)@(<($)53 > 8K- DX[8c|(hԴ0Lp`,0(Ō m(L rH(8h !  <,#+p9a|Md@_*$(jlv͔G|)T|tZ+t(( -!8 а0 *V4xA)N(cn(Dy( (Ȍ)W~D, :  [ (8*f8d;( BlV(pbb`q B$~HD%  @}L+ #!!#l-(68<?$H<R,Dar<04, D,XX"toT)^r4P0 #<T \"B-H$:(H$K !V#lTy(xh8# x|xK@ O"-\$)80XKА_(ph߄8x((LDX((U4=$4$> mD"4 /\_*`;$G4O-Z8[ !Dh y(I@\-V(( v H ),, p D|,` T< }4' 4p@B$4R\`id tp(w!m$\( \X"0 L(o0 c d ( #:lt 8(X Br R( [(8 m ` #$@ , < Oxt  +   s, A  ",| 0p '!1 . ; @ K ],( l, s!2   X` )2X( ( (( F@ ( t - <@ ,$ ^ , 7 `$ E?, P( gY r#` w(L 8  H< (  + Z g$ u, "H  (x , 8T 6( @  G  U(Ŕx h, h r(H ~); , ,D p| S@H  < )5T ^p + "F G(8 e  &( 7d H9 V y b T@ l-\ w(h p Ep "D )@ +lP 0 ( , lL 8L$P4DE#x$pN$@[lmq0(WX@P%|h\0Apt e()6H(0%x4<pI) TT\e( { c cp\Y4,`4":8 P 8 N =d$(Ɣ")\&< 1(S:)0(J)0[8n!{r,ռ0 p@)#DH(4 1Dh` @D%\+,5F#9(VFajh#]|(tP@ +^8'H'U '^!o'iD'rl'mx','(h' 'U'+ 'H4'(U'!@( c(P<(!q (.,(= V$(L(T x$l([ O|p(c)V(lKTt(wo\(xl(\(i( (!H(+(<( ( ) l|)(8)#!D)0)>)J,)X&)fP)r#xH)p4)(@)H)p<)\|)r) )*n*8X*"8pd*6 P5) p585U# <5_t5l5-q`5X5(X5p5,,5 551L55"k6 ( 6,<6$ 461,6?6Jp6Zh6h-X6n߸6&6"`6Ո6"xH606*T6(6 q`6D607H7,(7)>7& <71#P77 T 7@7VD7k7z ӸD7 G7I7t7(7TX7(77 >7<`88 (X8(8$dl48@r8U)X8g(\8wq8,8q8j8"\888S8< 8|8#89,L4909,9'095 D9>$9K 9S9b$9p)9l9v"`9!99-Wx9#9 99 9(9)8(9,: L$:,`:!:.:8!\P:H(WP:R D:coD:u=d:~A: ``::$(:fH:l:$: 5: 0`:TH:ʰ;(;,@; h;&(;7p;G 'h;W;f";t>;~b; pH; t<; 0;1P;#dd;HX;(WT;9;, ;+e;"@<@<$<(l<4,4-\>wP > p>, h|>3l0>@۠ >Lp>\HLl>l"D>+X>,\>)3>l$>+(>XT>$>pH>8?`? X8??1 p?9(?W G$?_(\?hT?u +0?}(?'A?# t?F@8?tX??#4?"D?(?):@ N(x@(`@@.(@6(@@F @D@Sh@`)t@p$@z(@(h@+@t@P\@,`@(h@(h@@(|@(A 0(0AA(A*A3(| AB_DA\(Ag(AnHAw A AA)9AA<TA8AU A+l`A(AB(B"tB.T,B5PB@ BLBY BeBp($BHBWPB$4B,Bh\B&\xBRDB ɠ\BHLB fDC֤$C(C4C+(z<C3+ldCA(CK($CU@C[tCb+Y(Cj( Cx!LxC(C#C-\C dC-Z<CTCgCC tC)VDDu(DD& D1hD>pDH DV(T\D`hDh ,DtPD{8\D0D(HD"`DhDPD#$D$D#E@E(ELPE'(ԔE0E::plEM DEY4EeyEwtE tE' EhEL|E zEYlE,E<E(E- @FF $F(F#s(F/ 4F<0FF LFR =DFgP(Fu h||F,@FHF(`hFN F#tF4FIF):FΜFlF G K\G+f|G(ݴG'8G4#GI,GP QGX<$GeGp>pxGxnG(xGG(G!HG.xG+0G-6G<XG(P G TH `H qH QH+XH%+~hH2lLHCcXHO+H]"-X|Hp htH &(H|THyDH tdH THm@H,HXH@H zXH If|0I !4I. dI:`dIJ IU[IbA@Ip `II x|I(@I\<I( IlpI#i\J,HJJ'|<HJ1 (pxJ<|JP8J`o\JjpJv&J( J(4JEJ GtJ\JJ"LJ!8J:@K)3h(K0K$4K- K8G,KH(KQTK\<Kl KwK-K(KLK(SK`KDKdK cKL4$K,DL+Y,L [ L+DL'Ј%L(L<*LGvPtLQL_0Lo^PL| 4L)7L+@LdL hL hLȴL\pL\L(L M(M% M+:lM:@0MN<lMV-D M_PMo(M"tM,LM(M=M)4M LM)VM#+TNNmdN%(N?uxxNL!`4Nd D,NuN d4N+N|N4NLN @N*8|N(N(O (O(O4O( P8O7לOHOOlOZr`(Og(Ou#TO-\O 4OLOdOYHpO(tO!O,O(dP\P)$P;pPK /HPWPjDPu(P{"PaPTP- P|P(P P(@P\PtQv Q(<Q!(Q*\Q? (QK$(QT`Qc|QrQ~(4Q"%lQdQ<TQ+X QQ(`Q(Q,QH4dR-URHRxTR$ udR34R;&FRNv(R`RkchR{#2\R-V\R(RCtpRtR(ИR R)9R-V8R`S,<S)$S*(S0 S=SF-WSU$Sah<Sp!`<S"͜`SS):S-\xS TS xSS(LS"lT +4T 8T#nLT- lT7N|hTB$TNTZTf!]XTpToT :`T,tTdT T i4T ;T TU U)U*(U*J4U>܈UN UY;Uj,Uw IU#pUU)ZU\UDU+|U#jh V( V `V\V"#$ VA h0VN# V[,PVi8VxxV(,V#V 9V IVPV)1'V( Vm4xV4V4WݤW\W&08`W:WMWZ,Wa /dWiwW|c(W DW(PWl WǬW+8W^DW`W tW-<X"@X-X' X3 1`$XB# XP)8X^, Xm(xX X-dX!4XHX8`X XX,tX X+spYY#Y&Y)_Y0"lY;tYJ#\,YZ,HYc+@YmvY{,PY<tY"Y((YY<Y(h Y<YvLZZ E Z 0Z4(,Z> >ZK% 8ZVZc"Zu&Z Z(Z+8xZ($Z tZ8Zt8Z Z(Z  <[)Hd[ <[+ld[A `[H [Y(l[m,[{ x[|`[+t[t|[( [(h[8[".[,[7\!0L\# \2Fx\<-\\H <\W<\b8\o(H\&\ 0\(τ\(\!\ \!@P\+X])1|] <]z,X](] 8 ]-$]8 ]E(p ]T]]48]hV8]z'H]t] ] ]h,]L]`]$cx]H]>|](0$^h^ [H ^"^84^G"-^],^k0^}^((^!x^-6^-X^^@`P^(|$^^(_ _d_:(y _M(_Z @,_h+_x<T_(D__",_ D _p(P_<_= _!_44` ޴|`h `#`4 LDt`D)7`M `X`e!4`v +HX`)<` wd``(d` ,h`t<` D`,`ha0a`La%(va6)@aITaa^av,Pa-Xa-6aWaaa-\a ,Lae,a3La1hb$bDb#, lb+)9b1?|b=):tbC"* bTb]bp|bm,db (PbތxbPb);bxb(b۠`bcNdcRpc+(c6 c@#tcR4Pcj 8cv")tc$<c {Xc+tc(4cDc(Dc $$|cc 4\d +d hd d..dRHrF(\rR- `TrY( rglLrur r-\r0d4r=Pr ,r\r%r 4DrϐHsƌ0s0|sw0 s1GPs>@sH(<s\(@sn#\0ds(s(s$$s+stts s(s)sPDt t"t)t1($tA `tP 4tW tfHLtt x t T@t- tLt-6t(t$Ptpt,t(Lt,u|u(u, ,Lu:huN uV),u_#ud$usu#u!׈u(<u u pu+hu#uhuOud u\hv(Uv (v v/);@ v@(v[(ve+nvr#ahv!v-\vdv#'$v, v|v($v)3<v\PvT8w"h`w w0,w>(DwH 8\wS R@w_wod w})]w {lwLPww.waLwPw}w, w"pw (<x L4x( $x((sx/\ x<#@xM lPxZ7xf,|xr(zx}Tx(HxQ \xx)@xlx\pxx Rx T xdy Py<y""y1 y; hyI yV<yd Lyl|yuy(yay(y,y0,yTy(Фy|`y y2Pxy|0z Ozz | \z(ؘz<)dzRdz_xzn(z$z#6 z2dzȰz)\z#(z hz(z(z-P`h{ ({ ){/d{% p{/ @ d{6,({?!Lp{Nd@{]|`{h{v(}({,{ d{{"h{p${lD{+{(ӌ{,{#l({L|T X| hd|*)|2)7x|Cd |M |^ |m(T|~t|h(|@| | D||||l4|RDD})} <}8}2(}C }R}[,}m0$}}(T$}`})0D(}4}d}<8}+$8}@}R88}\~)Tt~ ,~~*Tp~F&LD~W\D~g! ~s+$~|~#`@`~l\~~~vP ~6~(P)0<(%)- XX9ME Q(]xPHlsh L`@(Ƥ8 L ,( <|,{7$F-S(]# i+ q,{(@` 4 t , (,sϨ $0)(x($P-#kJ 8Yg+r(e(8$lls P"2( #wT@ +x0tA!SO] |n}v }@# p8(u$0@T΀,H(t$ (UX$ zT+&J>iL<I#(SsD^ G<g(yp" =3d0X(՘)0(, ;<|T %Xi<# 0 p< D PK!8Z ac,n* () 7 &N \p |<#y)X"oLx@ &+|$|1}xArMbTqe|,P,~d<!<,S x-W|K@$ p8! 2<d<1pI g\&Orn#x$x"H`L7d(X5$G<fx@"/(=(I d_(h(U4$pT}a+ xPL(xCpQHl<tHy\D e`t;-XK$R<4<` g"8x"٬>xHGl0vt hP(X :X(+<- p<, <!Q.:(`F*O@](dils!r P d & W$` ܌DPd `H!`h ($t4(S;F(dMk`\al,ܴ~(0#p|h,  l P lP`" |/ h7WC ؀$LP\+e):p,,~h%,((,LX \, | 008&(|1#4Ht0O pTV @d {H,oL`$# D\HSDqx(p8"+_(/  >({V# T m\hz ,PhP 4!V0L4H+fh  `v"(L)($5hBDU-\]&Ep`yH0@)9 -H( pd(gt h):+)5X<,J S]l`z\(0@WF d hL H ,h "׼!(/F< PH; S p\-dg pv o<48+(4̈́P@$ @d+#H8vx4!"P<h3 8<L(zU dy<r,y|)3(#4(`$(T,)6(?l, H 4H( 3 :#h4NGV`k v(˜((4!<P @-XD)4"{(D( +x"(@5J 8[&Sjh|,LL3` LP(+X( tl &(  L$(84 lElLl\|Hk!-PzD6(l, +dh L o P/,=)5IS 4 \- ih!8D$!.NM# J4)0 8T)Tl#d-\5JWf?<y (W, Ph9n($,` 2\ xl(0KnTV L_ Lm8X(0 x0Sd+-|#*Dߠ"L)3/:Gx,H |S@_mxdwlgx#ɬ (9D(+mH( `@ P}4,KP9+_,D)2DNLa6m%X$ژ<DXx (h `4</#<@D,JXYYTg+Hq)s(L{u4@(nt c$ v(X 0!vd):eL(<)֌L9+`I Xk`d"{")|4($Yd0 ~ @T-HoH$  TP"-\  8\$ U'Ә%)9.#\HJWVdarO|D"p ( $)1 (l ,!+X\ ll-[D"L1>K $^ ,i &u4 b$ $4<  !. P(y d( \!-, 9FHX]U4jx |(!$8(P4@#$|' 4 kLZP&1?+`H<N"@4](<d ~(`(p 0,0(  ,)7()@ -% x1!xA(M,U\lPd8}W8)]d!$( H,L E($ hGP+ 42 ?LdX ptds(8|a<8 0h<ٔx))8( lBt-|8iG+nX\`Ԝp[l X D <XLtdt 2 * h,<0$#+*T6$ј8C(N8m#3\( Td)9X <QX$D X ($,TrT&(u:(hC PI>`WGte;n4`w,(S-\| / tP 08 O0  -\&p)(45 +$C}PL"d\-\dm"T| P! (y<P`(T ,0(,D h0 ,H&#. ̔x:(x$K Wp,g!<y\h Dlt!<-\EtZs\(SC /L:(y8C <J~V8_ j,tyqpt((t%8 ((˘U$,  #0H% 8-#vT7BZU8b>lj(ty :(w@(\8W$d ,#!,t((U =l,P (P-#c|><I<W|ao|p)5(~H@Hx``( ?8~`# o$t((H" \ 0 O@>(Yx`E \,RVĐ]1Lk(v x,",v<hh P p<)9LH) ` (H+!8xDDx@SzZ(i+`xLpD#YlU,  1|0+f8<( ;@+D< |<,4,p?+stN#-`\b,Hjwq$h(9x,\;\@Ҥ X\d4( (0+$ l$3}8A$L ,]f+oSTw, d \(+ 0VP@& -\)9,X @):*5tTD$K! \)dTk)1H{ xptɬP- 4/d0(Әh+<4D\. \;-E(O#dU h(y ݔh( %p(H ; +HoxT  (\)VV(x(ϔv 1 \ > H([eD8rl,0|EL!ta xd ;@,T"7EPQ#^ j y@w TD| <X  0<l܄@(,d( GLc,#"7$L7#\,N+pY`fw<L A @{+ ( z-qt)<#7 @B(lO hL0W2|m+az((L${` "@X4\(-]\< 9#q$,D7{0DH 8`8nPzd (~ 8)):\-df{8X`xd T!8<1-4IRI]8k(`"$ ( PX z, &H< k|8 )0&C+s5h< 0JV&Ph Dt#\ ?dt!K`6ptlD: hLwD  \ H#%(<7 sF tN4\s(\( MDDx""<0 (-U,#lIU\_-]f]TXs hԴ"P(D L |$8- "!Pt,L)|Wl\+-]AMl^(m+Xtd,d($($ 0(l(pHplkP- tA ytQ L(]eo-]x $<+~l|"Zp h(+(@/xl  %#H10 9 8pFPVPb|mcHu4DD}- 8`X(( `"DL v<H+87LGhD Q8\,hh Cq, y"/Lh4 "@,(!-l0 h_E o,,X* t3 4I&Y"xTd(s 20"$(P)W  -<l-W̼x ,, # L$$8$/` (; &\BolOh_`j!_@P(p@%ۀ  t  nx(,  p$($3(<,TL"\)2(m||s0+x)3_t,1,x 90((P y e(p# MT0#x6E{@PK 0Y#@`Lhgt 2<( h8p ƨLL<+\| #@lf8-x,HF(M#\b ,i\,8-,  ɀ+@;DW\,-] L&#pX0`? O`(\^(`qzT‰(h“ 2Ÿ r¨ۤD° 8½(T"0H(L`h(Z,lh !h T @-L7 0>)L Z@`f" vtD H\Í"pÜ(ê(úֈ0`TX8@4  d++|3t ?"R`Ȕ q"x | h|Ĉ(Đ!dĘ6ģ,ĭ( ķ(Ľ"ޘLDTSDdh(Р(l, ()5 /x\> lL3HZoEłiXDŒ(ŢŪ#`Ž(L(@$ 502 :,3ADL<U+L_+aqL,{S4Ƈ)pƏ"6dƣ/p8Ƴ,ڈ4ƻe| ?(  p T'` 'P+d#u,h4"h@C"XM D[ H,k=t(s dž 4Ǎ#\ǘ+oǣ,tǬ#ǵW$ %l8UJ  8`7 GeXUja($p2Ȁ)6hȑ,ȝ,Ȭ ȸ-X 0<C<X(ːL< kX0Xy @(4("`8 tDEt0VgLu cɆ90ɗɳ):ɻ 7 !PXx)7(((8 #80*(=D J l W x4h_ʁ(ʌʡndʴ]+@&܀(Z"` @ < !D%z(/-CtP7xc, xjht 4@{\ˇH˖ Tˡ)V<˪˷(|[lD-]l QlH(ˀ(՜$804<#%J WXTT8dY|O`̎&FH̠!1̨+~p̰!̸&E x`(`4 ,`Q0{,\D*H> nHIQ Z`nl} dD|͊ 88͔8͢"/Lͺ(4/ P)7L(PL( [hP,0((π70J $HT c k-X΂|tΎ Ξ lΪtpμ(8i>@p@@ "(-,`%:2`AG!:Z"H$k^ v, σS$ϔ)0ϝϧ,϶ _H$t8hDHL L+X#.8<4QY(ˌk+j0 {X8Ѓ TЏ-\ИШ,ж(,pqL(o4#0# P(T-( A0XO`[d`)1T(ё+ў@ѧ(tѴtѽDXO z !0$zd+ $;HG'$TO8fsZPҀ%ґ ?4ҙ Ҡ%HҽC@4!X@5#|#DT'(.S8A-]L,^DmX${# ӈ($ӗ Ӧ(Ӵ+n,ӽ" \#hX+a, r   L"@*z85,C 40K(Ь<V]<]er0|(4ԇ(uԟԪ fDԻ4ָL<,0.$vD  ,#2CHK+PZ)7th(TXs$~ DՆt՝"X0խ( չL(TL($!L8(`!D8D 0$0(pG-VdTvc \ud@փ ֎(T֨8ָl H q<`&Dl +T/ |7 J~pS"44d t |׃ ׉[ח(ת׿(b4,x<'P $|Px H8HB@M(b+l#{(؇ nlؓ)9؞-YXغ(|, )08+$l4 T )-^:(HkQ 8_(o#u\wWT0~!وK0ُ(όٟˆ٩fL02 8 \dj@Xx!WT\ P,d$ x\1(yA+ M<(bu p0چ-^ڏ({ڡ#0ڧeڸ" |DD",pL &P (6?H? GhM#v Vd5m-Vw$ۅ"c8ە ~dۜhۭ > 0ۼ x,, (8CD,XST "*(,/H: phC,Q" \8Xi{#\\܌<ܚ"@ܢh4ܮHܺ&\p"@ x3\x(T8&)(07LF l<S(`+Dl#(~[ ݓ(Xݥݵ, W ` L,l(0  :4-D/ll80xF E$T+x\,$eoނLTޖ Pޡ-^8ެ!($ <-WT((u  "KHZ# =PJ@lR>T4__`$x f߉ Eߓ+P ߡ ߭hXߵ-T`L@ W0 VdT   .$(4٠`(Q4pF `PU p`(8l"<|/tbDμ\+6xd+b(U`m4X%P0+b9&BZM ([ h!y,u}x0(U\X D j!oh&(0 +Pq8 +$"$!%(|2(>XT e!(| hhd 8 c(-X d('x8);x%h:,xD &HQ# 4`(iO8r  YDx;`!((t,(y0M#'L+58hD(T,|\"ll0|" -(D` H (xd"  "D-)U40hC#`H_!,e;u P| T34ax D #Px-\D `4Xx(&!D<((DNQ8\,Tf G,s$,$)`&Gh  i(t({<)XX7vGxQ [xdgpv-Xv ZbLD< (00Pt\!<,|s< /S<(Q\hxe `q d~#xL@# =(y$ >PP(($# (n C4(T( 3CXS+b^ h p0q"X ~(<\t({P!$H+T #tL$-9Ϙ,G,R#$Df"7pPt hT,  "W,L, |!@#0s ;<$9 h%,8-AW4LtX<Y(|i v4' d !(אL! t(8dɄD(<QP#]t-#9="h8II\R \,j!z($C @(ldZ|*$T,@P4-V H W \/Ԝ<)3J4a lhht $ Z#`(|)1(< |` $1(('y1@B' R"*_ mwlt VPt D $#+f!0( 9 *(T/(?*X$GtT!|g!.op|, 00"48i<T!HlH t((H "X (40<> j(J]4Z 4fsHt-(| p ($- l`< )1L PL 8*|\?-M([\<,h(w(0 :+p \hIHH #!,@18$d(+ i;ʜK x| U<0_ pqSz((< + ; qp((+LGx+H E8 | P%Y/<(8(D"04\W c_mx|o<{< k  mt?(y+c\,)H , 8$($,(:+qCJ@ [j"hsHUHp L (T&P6 `1(,| $D(V8"R<.-^@B`TsX`jq L4r(( x4$ fw\u oH rP'd@)J8\uG2 (v$p@ )$!,0M$D'4h+gl ,  ,D XH. @8(<M [#u-m  0D DL"&P*# "-,[ 9adN_h pv k|~Bx ,0+ -Uj( T(y4,d,>l|\E( Q,[|p=$( @ HHl8t( (T)4L1" "T++P( Z 7 6 GAxR,\( d(4l(@{ +$);(x"8T (, pX"t",.+\;m0I(L@]T@i,l|" Mh0(lP0 ThYP #njT,@*B48tLKq(lT|lb  tp)80v-\, ]x)6#%$]@)6G@8&L  TX!( 8)2AkK dX f8k-nDv10D!-8#)8d!` XD,x(>xo\,mh4?tH|Vtes(X(`l_8Zd 0 ((X|L!)|  L",$4 L:4KWp|k, x4פ+ #0Tٰ Ԅ!DD(+ -\x( oXd&46P>"@$4L sXX($eR $t(|!$@P HPL< ,_|x-X H`X )p9DEP<Xttj!9,s2y<( L(-W ͤ`Rd#|:$(< P @0`(,2'$>%Jc<p(| x(!>,,H-nH+`Hh<_P  dH# -"!V.(7LTD M 5<TOX]|j~+nH X(,X qP(s(4< a0* (S @ , ,@ (H\ D0$ Qr(8 ] ,l d vX$T ~(X  R  (  ,  ( $°  X  $#v -#` =Z M \4 ^ p( m#p s!98X })1 <D  vHd d( t H ` ux  $ @8 d, ),4 6 '8 G+D O  ]M m(x s X , )5 (d l| "LX ՠ  @ <  $ $# + - ,(x 3Ҥ >d UΠ` g"5<( | ? !| (x J Z , up pt0 , Ed +  (y n  &$P8 5 B J F< W!X j@ V 8 #h + (  O BL \ (  , ,&\7 pA+Jd4f-v P"!(-WX  d Ƅ0hxS,@ d5($G $Q)|dL\?0e 8s"Ǥ<~ gxA @  Q{pDx!l,&I$ |3":C3 ,N4l\",dxl 8wX@ @L |t8` <OS <(T,\t8D,R%[($f2tn- |l#-x` r3D,D0, o4 @'# ?ۄHqtS(e(dr }(!ODXH0L Pd <4T,-nL# + &Mf"-V`*{6_CTT<_=g ul ֌w`!-nP,0m8 (L\@L ):H( d@<x G P(Z#n Zvج$@D XP((8<, +p h(( $0|>tNtx`byTDo `|+ _D< 6 6p H,h(L L",4/` A O$he(tPku !'R@ -\H![t"(+c3)W<LV Qx`Tl+X\v P7H|,|#t\ #޸ #@T-`l 'r6 ǘtC O p[#@Hbtp˜X~ h($ @(| p`P((#8"(1,8!L6 dVpll~ } 4!Q+!LHܠ8c_@B- |P\X#qp5#DDGh<R!h^3iqT}  ?t<0< DL #<P($،H,hh C,)2(& Ll-:8pG cX,\(w)8~)V5tT < PĄ&,!nlo8RH#c,PX,$+X2,x=(T F@Wڌa \pd)2-W(\((x0(`L)(ˈ.,: PI I XfTn,h~!,,|# [\l הD)3  dD#FX*\9-VE<0T_#TdU$k Ьx # |HhHl-Vμ#J#T#`,#g,8#n(z#x# 7# +#{#(($#($#!#0p$$($?0$$!8$5qhD$D$$Vʔ$h $vvP$(8$( $#x<$+X $-V$,$Q$%8$m @$% %  p(%$%&Z\%4+Y %A(88%M X %[;4\%s"d%,`%(% W(x%0<% |`%"%X%"%%t& &(& \l(&*($&8,<&@ H&Hì<&Vl&b#w 4&k"\@&{&<&(T&ѴL&m&&# &(& J&p&X' (X'+8'")8')"4':#p'ID'R8'\l'jl\' 4'H0' , '( '4p'D' '' x'^Th'2(P0( ,(1hX0(An`(S 4(Z p(h 4@(s, (#(( ( @4()Z(( a(( 90(D)() )h)( )6)D,)S x)`)m :X,)w)( ) )(l$))!p )Ŵ)`@)H* -*(\*%*5*@ c*T z(*cW*o* *#*T*C*(u*#n4* l*,*#`*!(+Nh+  ++*,$+2+?,(+G+|+N+W-+e,ިH+p+'π+T$+"p+<++7+R\+t+<,(|,,$,1,M((,e)4$(,xd8,sD<,-,,^$,-,(x, Y,U<`,Ҁ@- \D(-+- @-$@-3xH-F,p-KD-V8-gp-t- 4t-|-E|@->8--- -$-)-&L. <H.+:d.A`.Q!`.`)H.ik((.t+.}#.CL.( .lt.R0. .LH. 'h$/%P8/L/% L<//+/:/Gt,/U,X/^ /k#jH /} / : d/!/Ɉ/</n0/#/ /#/]0,0 ;(`0#03)0; ;X0I0R+0X#v 0` @<0nD0wجp0+d04p0<|0H0 H0l0 p0+0e0pl1 ۈ13\1& z13"1D1ZT1m(1"<1u0,1#`1"\|1rP1+11#y11(l$22 (L2,#-(2A!o02Mh d2]2l,D2to|22Z2 ,22+2(`2b`2^<2 D3Y@3(3l43,0 38"`$3J(3Zl|3f a3nyT3$3ZH3 PL33!$ 3-3 3[3+^,4,@4 X4#(44+ 4=84HG<4a 844k<4s-4+^04f|4Px4+e448 4 ۘ4 X4 c,4td55$ D50 X,55,p5Dp5Lߔ45T,5a"j85s!5x5&h5(5$p5+e505+H5)>|5T66%46#$6;5D06N8t6\<p6h<l6uLLT6}(<6!s6@6p6(6 6#  6'6t6 H6 `867`7#71M7>47N 7W7`p7k#7y ((7(ݐ7(S707l7$7M,X77 07|,T8a88!8/(H8E W\8O!x8j#nP,8{T8!p@8Lp8$8(H88(H8 48 f 9 "|(9[T9+ ADP99 9HM09R9`X9j<,9vL<9(99!-D9d 9)P9v 9P9h9(:)8H:=:, :5+:?e l:I`:Q|:b!ӌ:k(:u :(z:J:<8:D:L8:)3T:":(;(;5l;Z;( \;1!P;D(|;U t;d0,;u;(L;t<;T,d; ;x;(Ȝ(;,;4x<X(<< (<<.8<@\,<(˔<50\<P<P<(`@= l4=\H =+ =5 b4=I_P=R1D=[!=c\={Rl= x=LP= p=ɠ|= D>(Ԩ>:>+0>(2>6KH>=0>H(>W(>` ;`>q"A>(>,l>+<>Zd>>x>?,>(>=P>);@>$?Y$? &?# (?' L?8(?D X?O ?b`?uM<?+L?H?-n`?dx?ؐH?oT?&@@?H? d?(D@)@#(H@0q4@?WL@R(X@bH@t9@*p@+P@@ 1t@\H@@$\@L@ H@L@-A TAX<A-A<"zXAS$Aa(AsA} A tAeHAe<A(A LA"A)0(A(ϘB(B(0B$B0(մB7#]BJ BV HB`!HBh, Bq? 0B|YB!B4BDB@B,tB 9( Bެ B+BKHBϠC hCC UC2 tC?(CF <CN! CW<lCe-Cv($CC C, C+CC_PCTCU(dC4C(D (D@D# D,$D>v((DR XDc!ېPDp(D'(D(D,(D"xD<@DBpD w0Dl DKdE#!E(P$E/#8E@EOE[-WEfY40En``E)8E(E5L,E,E G\@E(E)5`(ESEhE |FHF hFTF" ,F.)8\(F< DHFGKFR);` Fc)4FqF#tLF"7F$F+(F(FXlF\F#DF($G G(XG XG( 0G7)0lG@gPHGI(ϜGX 0Gd @GnXG}ɔdGhXGXG!GXG\l@G-ndG5G P8HgDH( H'H3H;/HMf,LHd)3Hr!tHH,H(HtHH3 HH(HƼlH(XHCHHH-XI+nXII*IDPIN,,IW,(Id,pIq I yII!HI)0II(I(I  I J)^DJf0J >J#0J4((J>"@JO J`(Jn0Jx!J|J YLJ(J78J# <J7J K"0xK!hK. ,K8#i$KK(KU,Kb(@KkDK($KK!K |K(TKK&KhTK|$ DK\K)VlL<`L-L#HL/(L9-nhLHrLT L^+xLu"4L-\LLxL(L(XL (L)4dL"t8L P(L X4L,0L\L9P4M,$M M/!ìhM< t<MR4MgZMrM!TM|MMMTM M(M-qxPM!2$N {N lN%|$N$lN54lNG+ntHNU00Nb"T8Nq0(N(t$N)<N"<`NplNx8N N NuNTPO 58O#%O!)WO* O7n8OG(ONфOZ (Oe$Oo-V@O~Oa O4O$xOpxOLO@OpO,xP!P P,\P-( P4,@(P? J`PNldP^tPp"sPTxP!P%@PrPW\P-qP <P(P ,P-Q zxQM\<Q#Q7J$Q?=X0QMYQ`QxH0Q,Q<PQ TQ thQ-6 Q AptQ HQݜQHR:RclR @R.R8+hXRF)W8RR R[+Rk4`R|@R$8R#RR hR#RR&NR PS+(`S  S S#ɔS6|SF SR(S]DSq"tS-Z,SS, S)W$S L<S,LSS_@SS!S֔dTT#T)DT94TA$TK,|T^,4Te ?Tp0(T~,T 7dTXTT7|lT T 8Tg T OLxT@ThhUX<U.&QU@nT|UL\U_ }UmkUv UUHTULU(,U#U-$U+UJ|U, V # @V!G\V-lV?x,VQ, VX!DVh&Vt&V"VwV( V!DLV(Vm<Vt4V V6HVV <\V+| WgWFW')5W0-HW=(tWJx|W] @Wg"0lW8W, tWl, W!!W!W W( W#W WtX(lX&)TxX.ELX; DXHT(XW TX_ hXlC@X, X 5X}LX(hX-X)6(X(t XpX-VXx$XHY t<Y# PY.XY; $YJF4YV% Yf,Yr*LY xYaYT`Y-Y0Y DY, Y-nlY\YZ$Z DZ-Q4ZB ZI,4ZSZ_+eZl Zt k,Z| \Z+,`Z Z8ZhDZYhZ, Z4tZ(ՄZtZZ(Z[ ,p[ h[!,[0[<[G-[T[^`[n~,[-[[\p[ [)5([[8P[D[# [!=H\H\8\"tp\+p\9 T\Cˬ\MN\X(y\f(\o,d\yH4\\#\\)9(\&\ Q\pp\x]\]-nt]V P](]3(xx]E`]Y`$]e VH|]t,@]{#¤t],](]q`],]/@](@],]<]] \] xp^(z ^!^-Y^7!8^L(^X,d^h&MX^^ ^^yH^^"|^S^u\^j@^(Ɯ^-ot__t _)((_24_B_S+h`_e$8_u((_y-o|_ _(L_o_H_ {_ _(@_(z` 4` `|`!``2-o`Ej`U PH`_ X `mLx`(th`_4`x`"J`U` `(А` paa  |a(Шa" Ha+~<a2(aB#raG(aV$ap&Ra aYa"aa(TPa@a'ҸaBa D8appa* b # b!b/hb9|bD,8bWtb`+bftDb| jb(pbb.b 8b @b(b(bb0c<c<c%{8c1dc=~0cG dPcTddcbjckWcu lc~ðc(ctc c,dcalcccxdc `ld ed jd(y d, h 8d5LdB,hdP&<daddr-\Pd|(d(d!XPd d4dWd(<d( e(e)1e"e0 e; HeF)4eWtege|ece`efe*|e 8e($e"e!(f ,f($f/ f@fTdfa@fgft 0fhf#f``f @ ff!pTfUf,hf +0g Og+Tg=g" pg,,\g4,HgE(PgU!lPgm(|gv)\g{gLg(g|gg-g gg;T8ggfT<h th Xh*h6\hAZ<hT h\o$8hp#|4h Hh`h@h h(zh h^xhL\i ݔ$ii&Di3hi?%iI 1iR(TTiWR`iaZ ivb|i .iii i pi(@iDi4iu\jLjg,Dj' 8 j5HjC"EjT \j_+jj hjv jHj!mT`jΠ8j5$jTjXjj =<(j,tk);k ,@lFY8lZlh|ltV ll,Hl(l, `l (llDlbplP$l$plHlUdlm qTm ԰m!9m($ɸ8m6mF4m^xmi @my`mh`mlm(0mhLm [tmlmKPm(4m8m nLn( n`n)4(n.n:e|nKUnW(ݤna&ns(Јn}Pn n)snA nnd|nҬn =d,n(\n <0nco@o$o#(@o-(so<-oI ,DoRd o`doohoho(Ơo"*(4oK8o-\ow<o 08o oo(Pp 0p(tp%@`p3"'pB#pZ^pipELppTp Spzpgp, p (`p<4q (qq+#q9pqK-qWmqg qsD,qXqq ѸPq vq( q#$q)2q(zq(r v8Dr dr&S,r1%8rL 1TrT"rdj8rs!)T(r& @r((r"d,r,lr ,r+r.xr7|xr *Hs+~|s)7s!s+0s8($sChsQ(xsj sq+Xs{,,ss$s+<s sLssrXs(\s,tsdst $t-8t: ULtF'PtVtm6tAt@tpt#t!4t*tdt(pt,<t+nu :uE tu%R$u4fuCuM8uWu_ftup |uy(lu xhu"PTu%u,<u tPuuP$Puiv{ v<v+(Lv3Jv>@vN vX 8vg#<v$_h8v `v ?<v $v0v($v-\Xv%hv#] vw p|wX$0wH w+G`4w6>4w?4wH,,wU-owkwv+iDw I0w hwywf<w w)Lw+Lw,ڼw_Dx xhDLx%vx/.`0x: xC(xL(xU#@0xe $xo#dx|Z|xJxX(xx-Px@x xD0xex(x \(x ٤,y`y"py~Dy0 q0py7llyGyY\yn,pyz yQ(y[\8y|y,y Ly ~ly|Py(4y(pzh$ z  <z<@z.zA10tzN#ƈzdzl)\z)4z-Z0z$z<z)z(UzD(zT@z-6{({TX{+n {3Ő{H({Q$p8{_ H{k,{o 2|({}{H{ d4{{{{ `{ ?L{<{H|,|`|!!X|0|Cʬ8|R $|^\|jp||D|#|X|+e| r|+ |%\|):|&J:} h}"4},1(}6Xl}?<}G(}V#4}n(@}y(4}(<} <} } yH8}$} l}-W}(ψ}V}( ~ d~x~)^~9(4$~GD~S((~^P~mad~t24~{~~?~~ٰD~"$L~"8~~(( ~S0\-.9 0B(\$V4|b *zD(&Q&XQ f\fa(k<@~$d 4dp8 2T(-p(@m\"h8Q0t tl4( M(7,LDhV#l$t+-({8$)6d-X (,  ( Ql'Ap>,p<JL4\)Tpd 0lt P ,d(P(Uspec_vnodeop_opv_descwi_set_nwkeytcx_screenlistpfslowtimounion_lookupuvm_map_callrandomreaduvm_page_lookup_freelistnfsv2_procidpf_normalize_iplongjmpp9100_ras_eraserowsimport_flownewblk_in_progressffs_vnodeop_opv_descxyc_unbusyprocfs_rwvfs_opv_descskdb_trapvfs_allocate_syncvnodepcmcia_printcgthree_show_screenscsi_do_safeioctlarpresolvedp8390_readchange_displayparamzsc_intr_hardchrtoblktblsys_minheritbridge_startsystr_policy_pleeprom_takepfkey_addrfdesc_readdirchild_returnhmewatchdogne2000_write_mbufsearch_promfdcresultuvm_map_initne_pcmcia_caipsec_soft_first_usebpendsleepnkmempagesncr53c9x_scsi_cmdcopyinstrsys_getgidfpu_dtofext2fs_vnodeopv_descsdofilewritevdumpmagssmatchttyflushsys_setsockoptipcomp_inputvop_lookup_vp_offsetswihap_sta_disassocdefrouter_lookupinetswpowerhook_establishwdog_periodcgthree_burnerkernfs_xreadip_reassin6addr_anyrt_maskedcopyfdesc_startVOP_ACCESSip6_get_prevhdrscheduler_startdb_log_insquestp4020_chip_io_unmappmap_changeprot4_4cdisk_findp9100_show_screennsphy_cdzs_printhme_mintsys_closebmsafemap_poolin6_purgemkludgeffs_inode_allocnfs_receivedes_encrypt2mountlist_slocksys_setsidsvr4_sys_semsysbridge_timerax88190_init_cardprefetchaudio_attach_mitcx_setcolor__ashldi3vn_statsvr4_sys_fxstatbtcham_matchvop_getattr_descunp_detachcompat_25_sys_fstatfsnd6_nud_hintether_ip6multicast_minsys_msggetchange_sign16_swap_bytes_be_mtsam7990_watchdog__mainsppp_lcp_downepreadufs_quota_deleteportal_mounthardclockpf_get_wscalenptesgmgx_scrlisthandle_workitem_freeblocksipsp_is_unspecifiedmyip_ifpin6_domifdetachdevopnnfs_syncfilt_audioreadwskbd_cndetachvop_whiteout_vp_offsetsdb_get_variablezs_read_datacd9660_vgetcrypto_dispatchtprintf_opensbppreadtcp_del_sackholesisp_reinitwsdisplay_burnerdest6_inputgsignaloptionsnodefdesc_statfspf_socket_lookupipport_firstautowi_txeofmii_mediachgcpu_hotfixipsendredirectsbpf_setifVOP_SETEXTATTRunp_internalizetk_rawccfc_lfcemptyvfs_export_lookupyieldifnetm_freemtbclosefilt_seltruesc_print_addrcgfourteen_promcgthreeattachlogvn_writechkemulswpmap_alloc_cpusoftdep_count_dependenciesin_ifscrubshmid_n2omttyioctlzskbd_rxsoftdp8390_media_initpdevnames_sizevfs_stdextattrctlalaw_to_slinear16_be_mtsroute_dstch_usergetelemstatusinit_execbridge_rtdeletewskbd_cdwsemul_sun_detachsys_getdirentriesbcmpcypress_cache_enabledb_set_breakpointsnd6_dad_startmsg_freehdrexec_maxhdrszam7990_stopblf_zerokeydb_force_whitespacesvr4_to_bsd_sigsetipsec_delete_policymmmmaprasops1_initxdc_remove_iorquvm_map_spacefitsnewblk_hashtblsetjmpopenpromopenxyc_e2strwsdisplay_switchcgsix_stdscreenproc_targetsuvm_deviceopspppioctllogread_filtopsrasops_cursorvndxfer_poolfilt_fifowriteffs_specop_ptcp6_mtudisc_callbackcopyoutstrmainbus_matchpromcngetcext2fs_fifoop_opv_descuvm_swapin_remmodule_hypersparcimport_saxldcontrolblxtphy_servicess_cdcs4231_get_propssd_scsibus_get_parmsswcr_newsessiontcp_attachsunos_sys_setsockoptwskbd_cngetcvop_print_vp_offsetsbuf_dirtysoo_writem_zeroagten_putcmapffs_specop_entriesunp_gcingpf_pull_hdrbdevswbaddynamicportssemu_listau_set_lr_valueX_db_line_at_pcuvm_mk_pclusterp9100_scrlistptsstartdomainnamesvr4_sys_unamelockinitswap_encrypt_ctlgetdirtybufttywrite_filtopstcx_alloc_screennd6_ns_outputbpfkqfilterVOP_LEASEpmap_rmu_pzs_init_regnfsfifo_readttyunblockmttystopremovedepfr_sinsi_dma_allocgetproplenigmp_timers_are_runninguvm_deallocatefilt_procattachufs_quota_free_inode2mfs_closefilt_procdetachcbq_remove_queue__divdi3amd7930_opensys_clock_settimepfr_destroy_ktablebstp_designated_port_selectionlocnamesnfs_vinvalbufdisk_busydb_breakpoint_alloctcp_pulloutofbandsddetachprocfs_domeminfoagten_screenlistpool_set_drain_hookmouse_copy_extend_linebe_tcvr_readarprequestsiginitepconfigfdesc_vnodeop_entriesvn_default_errorxydumpnfsrv_mkdirpf_frag_tree_RB_MINMAXsvr4_sys_socketip_sysctlsppp_ncp_checkunion_mountxdc_e2strmsdosfs_vptofhffs_fifoop_opv_descsvr4_sys_nicebstp_inputtrapbasecgtwo_accessopscgtwo_screenlistrasops24_putchar12setdisklabelpfr_lookup_tablenfs_disconnectdeflateknote_removemtty_catslot_create_event_threadroutedomainfdesc_reclaimicmp6_errorimport_identityVOP_MKDIRrtl80x9_media_initepgetip_protoxsys_settimeofdaypcmcia_read_cissdstrategyaddlogpf_purge_expired_fragmentsep_pcmcia_attachep_cdpf_osfp_flushuvm_page_physgetmsdosfs_syncbppclosestackgap_randomvlanattachendtrapcodeffs_clrblocktcp_timer_freesackbpf_filterchgproccntpriq_getqstatsip_draindb_map_print_cmdpflogstartsoqremque__adddi3nfsrv_initcacheuvm_map_inheritfifo_printinfosvr4_sys_pathconfbridge_flushrulecd9660_synccgtwo_setcolorsvr4_sys_sigaltstackin6_ifawithscopevop_inactive_descaudioreadfdc_cdnfs_rootuvm_schedulercgtwo_burnersync_printnchashvnopspool_cache_initsys_lchownmsdosfs_removecd9660_readdb_read_tokenwi_get_idlayer_setattrzeroin_addrbmtphy_cdprocfs_startuvm_map_protectwsfont_enumprintfin6addr_nodelocal_allnodesxdioctlencifrandomwriteprelist_updatenfs_sigintrhmac_ipad_buffercrypto_drivers_numsppp_pap_closeinit_machclkip6_protoxsys_shmdtsys_recvfromcs4231_opensun4_hotfixswcr_freesessionunion_dowhiteoutttrstrtsys_sbrkpv_unlink4_4crandombt_loadcmapfdmatchzsnull_stintsysctl_doprocaudioattachkcopyvigra_stdscreenwsdisplayopenext2fs_inittiocm_to_zsrtfreechiptotimeagten_cdmgxmatchunion_checkcuio_getptrcd9660_linkhypersparc_get_asyncfltsbpp_rwukattachhostnamelencgtwelve_stdscreencd9660_specop_entriesmulticast_register_ifm_tag_freegre_mobile_inputnfs_flushttyopensunos_sys_nfssvcnfsrvhashraw_ctlinputxyattachccdlookupnd6_ioctlppp_softcxystrategyipsec_in_useipsec_exp_allocationsbpfclosedevwaitsoftdep_setup_removesys_writevsys_setprioritypfr_setflags_ktablescopywordsm_tag_prependsys_undeleteip_defttlsppp_auth_type_namearpintrfd_mountroot_hookalaw_to_mulawkqueue_registercred0in_delmultipfr_ina_definenfs_fsyncuvm_forkmgx_show_screenvfs_op_descsnd6_rtrequestncr53c9x_selectuvm_km_suballocsun_dkioctlrasops_eraserowssunkbd_keydesc_esbpfdetachfifo_ioctltunkqfilterttydefcharssigexithidirtypagesepsetfilteruk_cdfpu_normin6mask128umap_findiddead_lookupisbaduvm_amap_poolin_pcballocVOP_LOOKUPdb_shift_exprxdcloseclockmatchpcred_poolenqueue_randomnessbridge_ipsecipcomp_initemul_nativeienab_bis_4_4cwskbd_inputmachine_archdes3_zerokeysppp_cisco_sendcgsix_ras_copyrowshypersparc_memerrnfsm_strtmbufcrypto_getfeatvop_rename_vp_offsetssys_ovadvisehme_poll_stopsl_compress_initlockmgr_printinformc_delete_classwsmux_attach_scwsemul_sun_cnattachwsdisplay_kbdholdscreenufs_quota_alloc_inode2ipcomp6_input_cbVOP_WHITEOUTpnozz_cdtimerattachsocket_poolesp_read_regnfs_realign_countpgrphashsys_setpgidaltq_enablefd_set_motorkernfs_findtargetprofhzcache_enterdb_watch_tablefdesc_vfsopsexec_elf32_makecmdspf_osfp_insertumax_uc630_swext2fs_bufatoffsys_setlogindb_trapiommu_matcham7990_rintsys_setresuidgre_in_cksumsppp_attachlayer_node_createcrypto_kinvokeauth_hash_hmac_sha2_384_96dp8390_debugrn_deleteberintiskmemdevstat_rush_requestsreq_clear_inodedepsccodescgfourteen_loadcmapzs_get_speedsppp_ipcp_scrwi_watchdogpcmcia_poweripsec_def_compfc_lmdistancecs4231_sa_hw_ifnch_poolsomaxconnip6_mrouter_veripsec_exp_timeoutsystrace_processreadyxyc_remove_iorqip_directedbcastisp_cdfixalignbe_tcvr_writesvr4_emul_pathuihashtblscsi_get_xsau_get_portaudiommapdma_cabe_tcvr_idlepfr_validate_addrfdcswintramap_initffs_flushfilesffs_blkprefetherip_allowkernfs_vnodeop_picmp_sysctlsys_lseeksystrace_iomapdevexec_aout_prep_zmagicaudio_check_paramsoclock_capool_cache_getnprocsdes3_decryptllinfo_arpfpu_implodepmap_enter_pdiradd_poolmsdosfs_accessaddupc_intrdvd_read_bcasunkbd_keydesc_noam7990_copytobuf_contigwsevent_fininfs_connectip6statnfs_doioienab_bisviking_memerrvmebus_translateuvm_pageboot_allocpf_rm_rulepf_state_tree_RB_REMOVE_COLORmii_phy_updateswwritepfr_enqueue_addrsasync_daemonmmu_reservemon4magten_scrlistether_crc32_lecgfour_alloc_screennfs_numasyncrn_searchcgtwelve_free_screenipipstatcompat_25_sys_swaponsecureleveldb_consolesvr4_sys_aclwsemul_sun_output_haveescarpt_keepbstp_topology_change_detectionencrtrequestdb_printsympcache_flushsys_seteuidvmeprintbtcham_cdmax_protohdruvm_map_checkprotmixer_opendes_is_weak_keyep_isa_mediazsops_ttyextent_findepstartesp_sysctlpfr_destroy_ktableseeprom_cabufpagesrandomkqfiltervnddkdrivertbr_dequeuebridge_outputsys_keventcopyargsarc4_reinitmi_switchcd9660_statfsrndwrite_filtopssysctl_sensorskern_sysctlcgtwo_ioctlnd6_delaypmap_enu4min_pcbinitfdesc_selectnfssvc_addsockcompat_43_sys_recvsbppwritetdb_walkie_hardware_namesfdremoveuvm_tree_RB_NEXTigmp_fasttimoscsi_user_donekillprocp9100_ioctluserconf_cmdbuflinear8_to_linear16_lewi_get_pmaudio_init_recorddb_print_loc_and_instpf_reassemblevop_pathconf_vp_offsetscgfour_mmapamd7930_query_encodingsppp_ipcp_downumapfs_mountvigra_putcmapiommu_printauxreg_cauvm_map_entry_poolcrgetsttywriteunp_bindtcp_delackcsignalreaddisklabeldb_print_cmdwskbd_set_displayvirtual_availtunopentcpstat_udivreplace_endatapi_mode_sensep9000_free_screenfree_msgmapsdb_break_tablencr53c9x_pollfillmapentrynfsspec_accesstcp_timer_persistssioctlnfssvc_iodrelookupsys_umaskfpu_comparefilt_fileattachsysenttcp_setpersistwsscreen_lookup_syncufs_ihashlookuppmap_extract_pread_machclkienab_bic_4_4cicmp_rediracceptledattachvop_reclaim_descwsemul_vt100_detachdb_boot_halt_cmdsoftdep_setup_inomapdepbridge_stopip_outputbpf_mtapfdc_resetfindblknamecgsix_ras_do_cursore2fs_i_bswapnfs_reconnectmfs_vnodeop_opv_descpool_initpcmcia_card_attachbpfreadpool_putm_copym2bus_mapunion_newuppersysctl_structpf_statusam7990_startxdcmatchpmap_pinitnfs_ngetsysctl_rdstringuvn_attachlasttimefiforead_filtopscnkqfiltercryptoclosesysctl_disklockpf_state_tree_RB_MINMAXdesiredvnodespmap_redzonemsdosfs_readlinkp9100_setcolordes1_encryptspec_vnodeop_pxygetdisklabelukmatchlookupnchinitexec_mapdb_qualifysnprintfext2fs_readlinksoftdep_setup_blkmapdepaudioprobeether_ioctlsyscallrnd_attachedtqphy_servicesppp_state_namepf_normalize_tcpoptunion_getattrip6_forwardingkdb_kbd_trapanon_swap_offhme_meminitarp_allocatedrasops_isgraypflogattachtslot_mem_mapslinear8_to_mulawifindex2ifnetcd9660_ioctlbridge_rtagein6_savemkludgein_pcbnotifyallbstp_tcn_timer_expiryfilt_audiowdetachmouse_copy_worduvm_pglistallocwsdisplay_addscreenincorehztslot_io_allocagten_setcolorwskbddoioctlprobesetdefrouter_resetunion_islockedstart_cryptocd9660_ihashinsfreefile_poolumapfs_vnodeop_entriesbe_cacheckaliasdl10019_mediachangeagten_caamd7930_round_blocksizegetquotattyretypestartuphook_listsvr4_sys_fstatvfssrmmu_vcache_flush_regionrt_timer_queue_changecpu_attachssreadsd_switchfdchwintrsun4_vcache_flush_pagepninek_cdsdclosevop_generic_kqfiltersvr4_sys_creat64pffasttimoinitsiginfosys_getuiddb_set_cmdcgtwelve_mmapuvm_unlock_fpageqberesetexec_setup_stackgetfppager_map_wanted_locknfs_clientduao_createdb_free_watchpointspfr_clean_node_maskffs_realloccgnifvlanptcselectwskbd_load_keymapcs4231_round_blocksizeqe_rintcd9660_bufatoffaudioclosegroupmemberuvmspace_initether_sprintfsttyttymsdosfs_unlocksoftdep_move_dependenciesselwaitppp_bsd_compressktrnameiicmp6_mtudisc_callbacksmodule_ms1sys_forknfs_readdirsppp_ipcp_tlfvop_setextattr_descpfkeyv2_dump_walkerip_setmoptionspf_hash__qdivrempil_to_vmeldcontrolbspec_opencgfourteen_mmapswcr_sessionsfilt_bpfreaddb_watchpoint_freewsdisplay_emulinputuvm_fault_wirepcmcia_ccr_readsi_freenfs_niothreadsnptyvm_nphyssegshmget_allocate_segmentsvr4_netattachproc_filtopsuvm_lock_fpageqelf32_os_pt_notefiledescopensys_vforkvop_reclaim_vp_offsetsuvm_pager_initCopybufferwinChkNamest_decide_modedvd_read_copyrightdmaprintvmi_list_slockpool_draindb_history_prevsppp_ipcp_TOsvr4_sys_msgsystrap_typesun4_cache_enablesync_vnodeop_psys_mkdirdl10019_media_finiuao_reference_lockedufs_fhtovpcrypto_donewskbd_translaterttrashbridge_brlconfmblowatrasops_rmaskgetnewvnodeufs_inactivepromcnprobend6_mmaxtriesamd7930_start_outputbe_tcvr_read_bit2layer_fsyncsys_socketnwindowsSHA512_Lastdead_vnodeop_opv_descncr5380_wait_req_timoxdc_rqtopbsunos_sysentvop_generic_bwriteep_mii_clrbitsvr4_sys_stat64cgeight_show_screenufsspec_writedead_vnodeop_entrieslxtphy_cahme_tintiso_disklabelspoofpcmcia_cafifo_badopfdfreeepmbufemptywsemul_sun_scrollupipcomp_zeroizesppp_get_ip_addrstty_countsvr4_sys_faclie_setupramdmaattachfindnodemkdirlisthddeflate_globalraw_disconnectipsp_pending_acquireipsec_ipcomp_default_levelaudio_selectticket_altqs_inactivesvr4_delete_socketbrelvpauth_hash_hmac_sha2_512_96msdosfs_mountfszstty_attachpfr_match_addrvigra_getcmapwi_stopip6_sprintfsync_fsyncvop_setattr_vp_offsetssetstatclockratecd9660_strategyuserconf_parseip6_keepfaithsys_msgrcvqec_resetext2fs_alloccheck_inode_unwrittenusercryptocompat_43_sys_getrlimitdb_eregsst_loadfdcopyrmc_get_weightlkmopenemul_findfdesc_getattrsystrace_msg_ugidqeintrb_to_qled_blinkred_getstatsxd_cdudp_sendspacenfs_mknodSHA1Updatevfs_rootmountalloccd9660_openuvmcnt_dumpnfsrv_wakenfsdpf_frag_tree_RB_REMOVE_COLORxboxmatchip6_mforwardsoftdep_setup_allocindir_metabsdi_sihme_mii_writecmaskext2fs_blkprefmsgmapsdb_pool_print_cmdbstp_stopdb_delete_lineellist_get_mindlsvr4_to_bsd_speedzsops_nullrpc_auth_unixVOP_ISLOCKEDshm_committedsys_kqueueccdgetdisklabelcgfour_burnerauiopSHA512_Transformuao_referencesunos_sys_execvein6_addrscopesunos_sys_lstatled_cycledb_searchmaxlockdepthpppcloseraw_usrreqsystrace_closepolicyksymsopenoclk_set_secsnblkdevunion_initscancttyinput__stack_smash_handlerpf_frag_tree_RB_FINDesp_dma_isintrunion_leasebiodoneah_inputdb_set_breakpointcrp_req_queue_tailmyetheraddrcrp_ret_queuegettdbkernfs_statfsmulaw_to_ulinear16_be_mtsukopenmaxslpext2fs_makeinodeswap_bytes_change_sign16_lest_read_block_limitsviking_mmu_enableufsread_filtopsufs_symlinkcd_scsibus_set_modein_pcbnotifyufs_mkdirmbppioctlgetidprom.mulcgtwomatchin_iawithaddrsystracef_select__anddi3cs4231_setup_outputtbrt_missmsgdofilereadkqueue_selectVOP_BMAPip_dooptionsvn_lockpf_change_icmprip6_ctlinputxd_castty_modem_controlpmap_extract4_4c_mulpar_err_regstpattach_commonwsemul_vt100_handle_csiqe_readsbdropaltq_assertzx_accessopsmkdir_poolxyc_entoacttcp_debugpmap_protect4_4cqecattachsplassert_checknextraloclayerfs_checkexpcgsix_show_screenzs_abortsetusesppp_ioctlsys_setegidblf_keynoswap_bytes_mtspf_osfp_find_exactzx_matchfifo_readfdesc_readlinkrn_matcham7990_setladrfcd9660_symlinknfs_progppplogcharautoconf_verbosein6_setpeeraddrunp_externalizesys_munlockallsvr4_sys_mmapuvm_faultrandomioctlxyc_rqinitpppwritesoreceivesystrace_newpolicytctrl_intrpool_getuextralocdb_show_radix_noderootfspf_frent_plsunos_sys_setrlimitfpu_initpf_calc_mssrip6_outputsoftdep_freefileinflateportal_vnodeop_entriesscsibus_cdndflushipsec_last_addedpmap_kenter_pa4_4ccompose_tab_cmprn_insertfilt_kqdetachkernel_segtable_storesbppioctldb_flush_linepfsyncstartpf_osfp_findipsec_exp_bytesipcomp_sysctlbufqueuesconfig_deferm_tag_initif_attachfpu_sqrtgre_lookupsttyioctldqsynctcp_sack_adjustm_reclaimnameiext2fs_readdirip6_ctloutputpv_syncflags4_4cpfr_clr_tstatsmfs_reclaimversionwihap_initzs_breaktslot_slot_enablevpagelzs_dummykqueue_initxysizeuvm_pagezeronfs_readrpcin6_setsockaddrigmp_leavegroupsvr4_sys_getdents64masterpaddrmountlistcgfourteen_scrlistbstp_initializationuserconf_histbufcgtwo_getcmapnfs_mknodrpcwihap_mgmt_inputtunreadconfig_deactivateVOP_REVOKEscsi_probe_bussesclallocipsec_esp_trans_default_levelbiowaitzstty_cafilt_ufsreadxdwriteunixswsccsstp4020_chip_mem_freedb_stop_at_pcpfr_attach_tablewinuf_invalidcompat_25_sys_omsyncsvr4_sys_lstat64tqphy_casw_2_leftoverwsdisplaymmapccpuncr53c9x_readregsobio_cduvm_map_replaceunion_selectrmc_newclasssvr4_to_bsd_sigzskbd_rawaudiocs_canfsrv3_procsboothowtofdinitarc4randomtcp_delack_ticksttopenether_ipmulticast_minconfig_rootsearchrip6_sendspacescsidebug_lunsuao_dropswapenxioesp_attachslowtraprnd_event_headwsdisplay_switchtoconsolein6_maxmtupfopenSHA1InitRMD160TransforminflateInit2sys_setreuidie_cauvm_map_findspacesystraceioctlwsevent_initcryptoopenpfr_ktable_cntuserasymcryptono_asyncflt_regsptcread_filtopssvr4_jerq_ioctlsdsizefdstrategysys_pwritevesp_dma_intrkqueue_scansys_semgetvop_print_descpf_find_rulesettcp_closeepioctlnfsnodehashpfr_ina_commitsd_patternsX_db_search_symbolmatchbynamescsi_initmsdosfs_advlockdl10019_mediastatusswcr_idwdog_registerdb_varspfr_kentry_plst_switchch_switchm_padfallocbufferszskbd_consopsctx_alloclxtphy_cd_udivdvma_basesppp_lcp_tlupromvecdatp9100_ras_copyrowscgfour_free_screendb_breakpoint_freepfctlinputphys_mapuvm_anon_removeufs_lockhme_mcresetsys_accessnsphy_statusgif_ioctluserconf_initintrnameskillpg1p9000_ioctlierinttvtwo_alloc_screenmouse_removesunkbd5_keymapdatacpumatch_sun4cnfs_getreqext2fs_mountrootxboxprintregyearcompat_43_sys_sendmsgpf_find_statesetrunnablepool_do_putclock_cdnfs_closedb_check_interruptsd_crazymapwi_set_ssidnd6_prefix_onlinkgre_ioctlsppp_ipcp_initosversionelf32_read_fromau_get_lr_valueprocfs_getattrwi_read_datafilesys_syncertvtohzip6_mroutervmi_listnewfreefragudp6_usrreqratecheckin_rtchangevfs_syncwaitcansignalunion_startmsdosfs_check_exportsystrace_locklf_setlocknbigpipewsfont_map_unicharnfsv3_procidin_controllmaxuvm_pagecopypfr_clr_astatssw_optionssysctl_quadsys_readexec_process_vmcmdsvndclearpf_nfrentslevelsoftcs4231_closecompat_10_sys_semsysmbstatttyinfodb_flush_lexp9100_mmapzs_putcnfs_savenickauthttyinmfs_checkexpqe_cagetnulldevextent_destroydb_lpip6_forward_srcrtnfs_writebpenc_xform_rijndael128fdesc_rootaltq_detachgetcttsetwaterwhichqsdb_last_addrmouse_copy_startcgfourmatchmsgbufenabledbsd_to_svr4_sigsetfilt_ptcrdetachunp_disconnectzsopenufsfifo_writesys_listensys_mountcgsix_ioctlfifo_nfsv2nodeop_ppgsignalpf_get_sportfirstcshm_delete_mappinglinear16_to_ulinear8_bedb_read_bytespf_poolmasktcp_rndiss_inittdb_deletecgthreematchrasops32_initunion_copyfileaudio_silence_copyoutuvm_page_rehashvop_getattr_vp_offsetspfsync_sendoutvop_islocked_vp_offsetsksymsattachne_pcmcia_enableqe_ifmedia_stspf_state_tree_RB_INSERTffs_fsyncfdesc_opencgeight_free_screennfs_sillyrenameau_portofagten_ioctlrasops8_putchar12wsdisplay_consinetdomainwsfont_findkernfs_getattrcbq_pfattachmemcpysunos_sys_statfspmap_is_modified4mkthread_exitcgfourteen_stdscreensi_getdisk_constructvfs_unbusywsdisplay_paramip_nhopsrip_usrreqpfkeyv2_cleanupspec_writeaudiostartrdqhashipsec_esp_network_default_leveldb_map_equalnbpgin_broadcastfd_getfilencr53c9x_free_ecbptcwritesdioctlrpc_msgdeniedutsnamefdcstateexit2__hex2asciiwsmux_isset_displaygetcpuinfosbusresetip6_mloopbackext2fs_cgupdaterandomselectdb_aout_sym_initzx_scrlistcurpriorityiommu_attachpppasyncctlpufs_lookuptvtwo_ioctlscanjet_ctl_writeufs_bmapdoasyncfreeip6_mrouter_detachsync_vnodeop_opv_descdegetkthread_createp9100_ras_erasecolssi_findtunclosedb_elf_sym_initam7990_copyfrombuf_contigsvr4_sys_waitcd_scsibus_get_modeffs_fifoop_entrieslogclosecgtwelve_screenlistsppp_increasing_timeoutnbufpcmcia_submatchSHA256_Updatepfr_skip_tablevop_setextattr_vp_offsetsufs_strategybounds_check_with_labelether_input_mbufbstp_disable_change_detectionif_qflusharc4_timeoutext2fs_checkpathzx_copyrectbstp_initialize_portsocantrcvmoreepreadeepromdevclsfile_filtopsst_cdch_cdpf_tbladdr_setupmsdosfs_renamesysctl_proc_argsqeinitzskbd_putcdes1_zerokeypipe_wfiltops__lshldi3reginvalturbosparc_cache_enableturbosparc_get_syncfltlematchsd_scsibus_mode_sensezstty_cdpmap_activatebmtphy_resetvop_create_vp_offsetsbstp_port_state_selectionconfig_make_softcncr53c9x_msgoutunp_discardexec_aout_makecmdsip6_outputfd_camagma_hardcgthree_mmapip6_mrouter_getswap_syscall_lockufs_kqfilterscsi_autoconfcheckdirsexecswmulaw_to_slinear16_beqeattachSHA256_Update_intnsphyter_cdkdvma_mapinin6_are_prefix_equalin6_controlleapyearsys_sigsuspendcd9660_unmountcs4231_intrtcp_seq_subtractsvr4_sys_statvfsswcr_authcomputetrapsignalcurproczscloserushjobwskernel_fgunion_vnodeop_pdb_single_step_cmdnd_defrouterblf_decfdcloseexecprocfs_unmountlimcopysunkbd5_keydesc_itwi_do_hostencryptnfs_vptofhtcp_timer_rexmtpcmcia_io_mapvmebus_sccrypto_pool_initializeduvm_swap_markdecryptrt_timer_initnd6_useloopbacklayer_unlockxyc_carip6statmulaw_to_ulinear16_le_mtstcp_debxstp_sbus_cacd_casys_truncateesigcodescsi_xfer_poolsysctl_wdognfs_boot_getfhsvr4_sys_pread64mttywritecgfourteen_getcmapsi_dma_intr_timocache_alias_distsppp_pap_opensoacceptcdgetdisklabelvop_bmap_vp_offsetssvr4_sys_ioctldb_call_depthlayer_printdb_printfbootstrapufs_createmgx_putcmapnd6_optionscd9660_seekpv_link4mnd6_llinfo_settimercgsix_mmapmsdosfs_unmountelf32_load_psectionSHA512_Finalunion_abortopprocfs_stat_genslinputunion_unmount_count_vnodelayer_checkvpmtty_cdcpumatch_turbosparcdb_add_symbol_tablemgx_free_screenm_tag_nextch_getelemstatusmax_softdepsmsdosfs_writecompat_43_sys_getdirentriesexec_script_makecmdsignore_bogus_trapsfilt_pipedetachcd9660_rootdb_unaryne_pcmcia_get_enaddrss_switchselrecordrip_outputstp4020_chip_intr_disestablishsppp_strnlenstp4020printext2fs_accessmld6_fasttimeoSHA384_Endkthread_qimaxxdc_piodriverkernfs_writepf_dynaddr_removecg3_videoctrlvop_unlock_vp_offsetsstioctlchioctluserconf_pdevuvm_object_printitmustek_get_statustcp_sack_partialackp9100_alloc_screenzstty_rxsoftmbpoolxdcintrst_write_filemarkstcp_canceltimerstqphymatchrip_recvspaceroute_initccdreaddb_store_countsd_scsibus_flushipsp_spd_inplink_rtrequestuvm_vmspace_poolsunos_sys_getrlimitmfs_rootbasespec_lookupfdesc_inactivestackgap_initzx_screenlistnfsbootdevnamefifowrite_filtopssysctl_vnodend6_sysctlnmi_hardipsec_common_inputpf_tbladdr_copyoutvn_openpf_frag_tree_RB_NEXTnfssvc_sockheadsppp_pap_TOmachclk_usepccpf_route6.udivuao_detachmallocsbppselectamap_pp_adjrefep_pcmcia_matchrpc_versesp_inputin_pcbrtentrynfs_iodwantbstp_forward_delay_timer_expirysvr4_sys_timescpumatch_vikingknote_dequeueamd7930matchtcp_outflagskqueue_statsbus_testdmanfs_boot_initpppdealloccd9660_rrip_analyzeoclock_cdkernfs_startnfs_vfsopsienab_bis_4msunos_sys_fstatfsip6_v6onlysys_preadvms1_mmu_enabledb_tok_stringnfsv3_typesys_recvmsgpipe_statskipjack_setkeyvn_writevop_mkdir_vp_offsetsVOP_LINKpcmcia_megahertz_xjem1144_func0icmp_inputuvm_km_free_poolpage1vcountms1_cache_enablevm_page_zero_enableinodedep_hashppptioctlin6_delmultistathzpf_test_state_udpenc_xform_cast5wdog_ctl_cbhfsc_add_queuebsd_to_svr4_sigactionah4_input_cbpfr_ktablehead_RB_INSERTmem_access_faultwskbd_cnattachktrcansetvirtual_endlayer_inactiveledmamatchsys_getloginbuckstring_initipsec_hdrszunion_reclaimicmp6_rediracceptext2fs_vnodeop_opv_descms1_cache_flush_alldetruncdb_elf_symbol_valuesnswitchexitcgthree_cacopyoutpfindesp_caip_ctloutputp9100matchwsevent_readenc_xform_arc4pf_routearp_ifinitdb_write_variableufs_dirbadsleepcd9660_readdirvfs_unmountallpf_match_portccdattachrasops1_putchar16copyrightvigra_mmapsdattachvop_whiteout_desctcp_timer_keepportal_inactivewsemul_vt100_cnattachtcp_mss_updatesvr4_to_bsd_sigactione2fs_cg_bswapdb_proc_print_cmddb_show_all_procspower_cdvunmapbufip6_sourcecheck_intervalfb_cookieroute_outputrti_deletevop_kqfilter_descsys_geteuidhostzeroisbroadcastprocfs_readdirchange_sign16_swap_bytes_bedb_output_positionicmpmaskreplmsdosfs_mknodcd9660_specop_pzs_read_regip6_defmcasthlimsys_munmapsttymatchfilt_solistenvsnprintfmgx_getcmapwsemuldisplaydevprintsrmmu_cache_flusharplookupunion_inactiveamd7930_halt_outputuvm_map_pageablekernfs_pathconftvtwo_cdchainallocpf_change_a6sun4_cache_flushifmedia_baudrateedataxyc_startuvm_pagelookupfree_allocindirsoshutdownuserconf_hist_cmdnfs_writerpctcp_rndiss_reseeduserconf_listproc_cansugidcd9660_rrip_getsymnamedb_command_tabletctrl_ext_statuseswsemul_vt100_scrolldownwsdisplay_getc_dummybpf_iflistPaste_availip6intrqnd6_rs_inputsystraceselectssstrategypmap_is_referenced_psoabortlinear16_to_linear8_bememerr4mmemerr4_4czx_cross_loadwidcast_encryptunp_inoxy_calogkqfiltersw_cdsvr4_sys_setegidtcx_mmapuvm_tree_RB_INSERTdb_extent_print_cmduprintfsppp_set_ip_addruvm_page_printitamd7930_start_inputmainbus_casoftdep_flushworklistsys_issetugidinitclockscd9660_mmapwsdisplayselectsd_reassign_blockszsstart_txif_detachttcompatsetlflagssetup_allocindir_phase2isp_controlsvr4_sys_auditsysnd6_cache_lladdrcatqsession_poolifqmaxlenipsec_get_acquireext2fs_specop_opv_descunp_connectuvm_pagermapinif_detached_startpool_serialopennodevfs_mountedondb_expressionpmap_deactivatefc_lookupsemu_alloclinear8_to_linear16_be_mtspfr_destroy_kentryep_mii_readbitcgtwo_cdfifo_selectif_downndqbfilt_rndreadallocsysconsdev_prommodule_swiftVOP_GETATTRsvr4_termios_to_termioticket_altqs_activenfs_reclaimwihap_deauth_reqpgt_page_allocnfs_advelf32_check_headerbt_setcolortcp6_usrreqmmu_has_holedb_historymodule_cypressnfs_loadattrcachelehwinitnfsm_rpcheadnfsrv_readdirtcp_rndiss_cntpmap_unwireipaddrip6_auto_linklocalbridgeintr_framecompat_43_sys_getdtablesizeuvm_pageunwiream7990_intrwsmuxdoioctlauth_hash_hmac_md5_96tcx_capfr_kentry_byidxsvr4_sys_pwrite64v8mulip6_mrtprotozx_setcolorcdattachuserconf_devicenonidempotentin_localaddrsys_sigaltstacknfsrv_fsinfozs_majornfsrv_symlinkDES_versionsl_uncompress_tcpsoisdisconnectingrasops24_makestampBlowfish_initstateauth_hash_key_sha1wi_media_changesttyclosenfs_vgetnull_decryptrttimer_queue_headptsreadbridge_filterruledp8390_enablertredirectuvm_map_printitdb_read_variablepfr_destroy_kentriesdb_regsdb_stack_dumpstty_compute_baudcd_scsibus_setchanttymodemdb_lbuf_endwsdisplay_defaultscreensi7kqueue_poolvntblinitstp4020_chip_socket_disableallcftables.divcgfour_caax88190_mii_bitbang_opssvr4_stream_ioctlpmap_prefernfsrttonVOP_REALLOCBLKSregion_lrunfsrv_accesssys_setresgidsdebugsvr4_esigcodecgfour_screenlistmsdosfs_sync_vnodesplassert_failtty_initwsdisplay_clearonclosesdzerorefindir_truncpriq_add_altqudp6_recvspaceuvm_km_freesys_killp9100_ras_copycolszswritestart_nfsiouserconf_numberpfr_update_statsagten_getcmaprt_setmetricssys_getegidst_spaceam7990_getvndgetdisklabelhas_iocachepfr_create_kentryst_quirk_patternsdirchkipip_outputpipeclosealaw_to_slinear16_le_mtsext2fs_fifoop_entriesVOP_REMOVEsvr4_to_bsd_termiosconsinitwi_alloc_nicmemext2fs_dirremoveipsp_aux_matchuvm_vnp_uncachesysctl__stringxyopenbus_untmpffs_clusteracctnfs_timerconfig_detachsvr4_sys_pauseifaof_ifpforaddreeprom_updatecryptop_poolrt_timer_queue_destroydma_cdsunos_sys_accessrequest_cleanupwi_cdsd_cdnfs_createnfs_sndlockportal_setattricmp_mtudiscipport_hifirstautonullfs_vfsopssys_fstathmestopslclosecgfourteen_ioctlenc_xform_3desdb_symformat_aoutuserconf_enablegetpropintdb_endlpcryptodevallowsoftsa6_anysys_getprioritytcx_cdhmeinitsparc_db_command_tablenfs_bioreadsysctl_diskinituvm_km_vallochandle_allocindir_partdonetunselectstp4020_chip_io_allocunion_vn_closeprocfs_inactivesys_unmountiommu_sctbtioctlnfsrv_getattrelf32_probespf_fragcachein6ifa_ifpwithaddramd7930attachvgonelbridgeintrbwtwomatchsofreelayerfs_quotactlctrl_eventunion_mkwhiteoutzx_free_screendb_del_symbol_tabledb_add_exprmbpp_attachpmap_removenfs_statfsicmp6_fasttimoext2fs_removesi_vme_dma_startbpf_setfuserconf_historyktrsettracevnodexymatchuvm_page_unbusyipsp_skipcrypto_unmarksppp_print_stringtk_noutext2fs_mountcgfourteen_putcmapmif6tablepmap_collectBlowfish_expand0statecgsix_accessopsdb_symformat_elfcpu_sysctlcd9660_vnodeop_pcd9660_deftstampwskbddocloseaudio_rintip_randomidcd1400_compute_baudtbopennosuidcoredumptslot_event_descrukphyattachcddumpbstp_send_config_bpdudb_search_cmdwsdisplay_noemul_casbppattachcs4231_trigger_inputtcp_disconnectvop_open_vp_offsetsuvmspace_execcbq_remove_altqsunos_sys_getdentswsmux_createdeallocate_dependenciessys_mmapbootnd6_is_addr_neighborblf_ecb_encryptwsemul_vt100_output_normalunp_rightshostnameaudio_cddb_print_llinfowsdisplay_emulbellsadb_exts_allowed_inme_allocfdstartext2fs_bmapuvmexpenc_xform_blfbtcham_attachesp_dma_resetsppp_ipcp_opt_namepmap_changeprot_pufs_diremptyesp_output_cbreinsertfinishdupcs4231_query_devinfost_crazymapukphy_serviceqsphy_resetmemregattachdeflate_decompresspool_destroylogwakeupdl10019_mii_readregshutdownhook_listep_pcmcia_lookupip_dosourceroutesoread_filtopsbdevsw_lookupdisk_changewsemul_vt100_resetopamap_lookupsdoreallocblksstp_cdbstp_designated_portred_destroysvr4_readdir64_callbacklerdcsrbpfread_filtopsunion_whiteoutsoinitamd7930_getdevzsc_intr_softcpumatch_unknownVOP_MKNODuvmnd6_ifdetachin6_ifaddrroute_protonullfs_vnodeopv_descsext2fs_truncatecd_play_tracksip6_maxfragpacketsdb_errorax88190_media_finizskbd_rbuf_lowatsppp_cp_inputzskbd_device_lookuphexatoittydebuglminscsi_probe_bussys_fpathconfpf_get_mssdvma_mapoutarpt_prunecnopensoconnect2knote_pooltslot_io_freescsi_test_unit_readyfdattachrmc_modclasszs_hwiflownmbclustkrp_ret_queue_tailunion_updatevpintr_sbus2ipl_4cvop_reallocblks_vp_offsetssominconnpf_osfp_listep_pcmcia_get_enaddrpmap_enk4msegm_freelistledmaintrpcmcia_matchnchashtbluvm_vnp_syncmclpool_allocatorcgeight_cawsmux_set_displaypfr_unroute_kentrysvr4_sys_execvewihap_assoc_reqinodedep_poolarpt_downunion_openportal_rootwsmoused_wakeuppfr_ina_beginstate_regsbpf_tapdb_lookupSHA256_Finalrasops15_putchar12wsmousedmii_phy_autonfs_mountrootmax_datalensvr4_sys_getrlimitmsdosfs_initkernfs_printvop_readdir_descesp_cdext2fs_writestp4020_statintrlf_clearlockch_exchangenfs_udpsockdb_lastsymip_srcrouteip6_accept_rtadvpf_test_othersys_setregidpcmcia_cdSHA512_Endccdlocklemediachangeportal_statfsvinvalbufmii_bitbang_writereglo_microtimebestartsunos_sys_mmapnfs_mkdirsys_ftruncateah6_input_cbsoftdep_fsyncm_splitisp_donencr53c9x_attachkrp_req_queue_tailtcp_timer_initdb_tab_stop_widthdb_putncharsoclk_get_dtnd6_maxnudhinttcp6_inputsosetopttcp_msscs4231_attachcache_purgebeqintbpf_mcopyax88190_mediachangepcmcia_3cxem556_func0SHA384_Finalp9000_ras_initauth_hash_hmac_sha1_96kern_targetspcmcia_intr_disestablishfork1am7990_ioctldb_activetslot_slot_disablevfs_hang_addrlistst_cach_camrt6statdead_writemagma_caufs_dirrewriteinsmntquettreadtk_canccdb_write_bytesext2fs_blkfreeudp_outputfind_last_setcd9660_vnodeop_entriestcp_rndiss_msbsys_chmodccdsizespifstcintr_rxprelist_removeffs_vgetinitprocbt2pmtsystraceread__umoddi3pfkey_buildprotoswnfssvc_nfsdlayerfs_fhtovpmbpp_cdtvtwo_screenlistgmt_to_dtsppp_lcp_RCN_rejcgtwelveattachip6_log_intervalnull_encryptwihap_auth_reqvigra_show_screenuvm_page_physdumpVOP_SELECTccdbufferpf_insert_statenfs_readlinkrpcX_db_sym_initmbpp_cavt100_initchartablesext2fs_checkoverlapsolisten_filtopsin6_update_ifamyleintrstat_inode_bitmapep_mii_sendbitsvop_bmap_desc_udivreplacebwtwo_accessopssuser_ucredaltq_remove_queueqecprinttcp_sack_optionmulaw_to_alawsd_shutdownwi_shutdownmem_noext2fs_buf_allocdp8390_startsoftdep_disk_write_completesystrace_seteuidipcomp_input_cbdb_prom_cmdcs4231_trigger_outputwihap_sta_deleteep_pcmcia_detachstwritepfkeyv2_get_proto_algpfkeyv2_releaseRMD160Update_intrevarprequestkernel_mapbwtwo_screenlistzskbd_rbuf_hiwatdumpdevppp_dequeuebwtwoattachsppp_lcp_upcd9660_lockuvm_unloananonietintchange_sign16_swap_bytes_le_mtsvfs_mount_foreach_vnodekqueue_kqfiltersoftdep_typenameskernfs_vfreeamd7930_get_propsimport_lifetimeip6_mrouter_donepriq_remove_queuewi_mgmt_xmitaudio_opencgtwelve_ioctlzeroin6_addrmemreg_castrncasecmp__guardin_ifaddrsunkbd_keymapdatand6_optionunion_readlinksppp_chap_initwin2unixfnmax_hdresp_dma_setupnum_inodedepffs_readinet_ntoa4m_freetslot_cdzs_cavop_default_desccbq_add_queuene_pcmcia_dl10019_get_enaddrlayerfs_sysctlscsi_inqmatchfdesc_poolvop_strategy_vp_offsetspool_page_allocbstp_become_designated_portfilt_pipewritein_pcblookupm_tag_delete_chainsvr4_sys_signalpool_head_slockipe4_initbzeropromcnputctickfixintervalmii_bitbang_syncpmap_phys_addressufs_closeprocfs_validfilefixjobcprocfs_accesstctrl_process_responsedb_show_all_cmdsscsi_execute_xssparc_noopin6_addmultistat_ino_limit_pushrn_newpairvop_setattr_descdb_find_breakpoint_heremsginfopppfcssunkbd5_keydesc_ptsys_obreak__udivdi3blf_setkeyxdc_tickdesirednfsrvcachepf_routablesttystopkernfs_mountsystrace_msg_emulmemregmatchcpu_classbwtwo_stdscreenlastddateromgetcursoraddrzs_set_modeslemediastatusin6mask0swap_key_cleanupbpf_validateunion_mknodvaccessieinituao_set_swslotmbinitchange_sign8hypersparc_mmu_enablewskbd_default_bell_datasbpp_caxdc_submit_iorqsunkbd5_keydesc_sfamap_allocVOP_LOCKMD5Finalstty_casbppopencgsix_resetwskbd_matchsd_scsibus_opscp_timencr5380_initcgfourteenmatchsbus_attachcd9660_vget_internalsystracef_readlinear16_to_linear8_ledb_page_print_cmdpf_osfp_initializewi_intrcypress_cache_flush_allipsec_acquire_poollkmioctlvgetzs_conschanvndthrottleamd7930_set_portwinChksumfreeclusterchainmld6_inithardmemerr4mprocfs_checkiopermsunkbd_keydesc_sgdisk_initsvr4_sys_systeminfobeintrnfs_nameicd9660_fifoop_opv_descrip6_ctloutputnfs_getattrcachenetiond6_na_outputext2fs_fhtovpext2fs_createpool_page_free_nointrhmeintrnfsrv_createwi_sync_medianfs_realignvfs_opv_init_explicitnsphy_caseminfobmtphyattachsysctl_dopoolcd9660_fifoop_pumap_bypassep_detachpmtu_expirecrypto_getreqtcp_respondsys_readvamap_cow_nowroundrobinuvm_map_createvfs_opv_initissignalhypersparc_pure_vcache_flushCopybuffer_sizenetclsktrinitheadercdevvpsvr4_find_socketmbppreadch_get_quirksigmp_joingroupinflateIncomppfr_pool_getbeeintuiomoveled_cdmsdosfs_startdeviocdb_loop_countmfs_rootsizebpf_reset_dslinear16_to_mulaw_lend6_dad_stopcs4231_readuseloopbackuvm_waitnfsfifo_closenexecsststartbetintpmap_referenceprocess_worklist_itemsys_bindax88190_mii_statchgclockattachloioctltty_detachdma_gofindrootSHA512_Datafpu_cleanuppmap_bootstrapipsec_auth_default_levelblf_cbc_encryptcputypsys_mquerybigadjkmeminit_nkmempagesnfs_sysctlipsec_policy_poolspec_vnodeop_entrieswi_pcmcia_detachfdsizeshm_last_freeunion_copyupcnselectfillinusemaprecvitipsec_common_ctlinputtdb_rehashep_media_changeipcomp_outputfilt_sowritecnpollcuvm_kernaccsys_linkadd_to_worklistlog_opensi_optionsnumnfsrvcachegettdbbyaddrfragtbl124portal_vnodeop_puserconf_totdevvop_inactive_vp_offsetsrt_ifmsgrt_tablesqec_putrealitexpireunix2dostimeipstatsrmmu_get_syncfltnfs_initscsibus_cacompat_43_sys_truncatecrfreecnputcin6_gif_inputxyc_perroripsp_delete_acquireip6_lasthdrdl10022_mii_bitbang_opsviking_cache_enablescsi_change_defnfs_bmappool_sethiwatwsemul_vt100_output_c0c1sbus_printmicrotimeppp_deflate_drafttree_lan_extsysctl_sysvsemncr5380_wait_phase_timostp4020_chip_mem_allocuvm_swap_getaudiosetinfoepmbuffillext2fs_reloadif_detach_rtdeletecs4231_get_portnfsrv_getstreamcsefindelf32_copyargsisocharpf_frag_treeuvm_km_alloc1cdopentcp_usrclosedqec_cansphyter_caiommu_removeskipjack_backwardsphysmemsunkbd5_keydesc_depagedep_lookupwskbd_holdscreeninferiorpfr_ktablehead_RB_INSERT_COLORxy_cdclusterallocext2fs_fifoop_pcryptof_readxformswltsleepwskbd_attachin_pcbbindunion_mkshadowisp_sbus_cap9100_screenlistnfs_node_poolrtalloc2endtsleepwihap_check_txuvm_pageratopsigactssharesadb_exts_allowed_outdb_set_watchpointbe_tx_harvestnfsrvw_sortbpfattachif_detach_queuesitimerdecrvnddumpether_outputshmexitmbppopenexport_authauth_hash_md5crypto_kdoneunion_rmdirnfs_removem_copym0vm_physmemprocfs_allocvpprocfs_initSHA256_Transformiso_shipdirrnd_timeouticmpmaskpipe_ioctlwskbd_enablecd9660_mountrootnetlckbpf_allocbufsmsgbufmappedtctrl_write_datagetphysbufcdsizedb_symbol_valuessppp_lcp_check_and_closedb_evarssppp_ipcp_openufsfifo_closewakeupsoftdep_slowdowncgeight_accessopscompat_43_sys_sethostidiommu_cdtvtwomatchtcprexmtthreshprocfs_vnodeop_pagten_stdscreensetquotastat_countprt_getifaslstartdb_malloc_print_cmdenosyscompat_43_sys_creatlockmgrbstp_tickisp_uninitgetdevunituvm_vnodeopsvfsconfbe_tcvr_initsrmmu_vcache_flush_contextVOP_OPENwsdisplay_console_inittedSHA384_Initpninek_casvr4_term_ioctlvigra_ioctlconsdev_ttybuckstringsvr4_sys_gettimeofdayscsi_interpret_sensepfkey_unregistersunkbd_layoutsext2fs_flushfilesmsdosfs_vnodeop_paltq_attachdes_ecb3_encryptunion_revokepower_capromveclxtphyattachufs_readlinkdoscheckpathnfsv2_vnodeop_opv_descpcbmapunion_rootaudio_readnd6_option_initmfs_initminirootuvm_km_alloc_poolpage1ricoh_is410_swprocess_set_pcin6_init_prefix_ltimessoftdep_change_directoryentry_offsetesp_outputprocfs_vnodeop_entriesnchstatsmsgbufpcd9660_fhtovpsys_setgiduserconf_common_attrswapconffd_dev_to_typefilt_ufswritetcx_scrlistrt6_flushttselectuvm_mlk_callbstp_config_bpdu_generationpgt_page_freemmrwffs_bufatoffah_input_cbstp4020_chip_io_mapfdcattachcpumatch_hypersparcunion_removeuvm_errno2vmerrorsubkey_table_gencompat_43_sys_getsocknamedohooksmustek_compute_sizesnfs_quotactlpriq_add_queuerasops24_erasecolsif_detached_ioctllocnampstat_ino_limit_hitumap_lookuppfr_initializebridge_rttrimvop_close_descstat_blk_limit_hitbstp_enable_porttun_outputuserconf_showip_mtudisc_timeout_qpf_remove_if_empty_rulesetffs_fhtovpgetvnodefilt_ufsvnodecrypto_get_driveridamd7930_deviceprocfs_openpool_setlowatkmembaserip6_inituvm_aiobuf_poolisofncmppcmcia_card_detachipsec_add_policysysctl_emulsttyopencgeight_scrlistsys_sigprocmaskdb_commandnfs_renamerpcsys_shmctlpf_get_poole2fs_sb_bswapin6_if_upfilt_pipereadskip_spc_rightcompat_43_sys_gethostidsoreservepidtakendb_formatpfr_ktable_plmfs_priwsmux_displayioctlpf_test6vmeintruvm_mmapxdr_string_decodepf_osfp_matchufs_quotactlpf_tree_plcgfour_cdviking_get_syncflttcp_newrenosparc_interrupt44cdma_enintraroundin6_pcbnotifyncr5380_scsi_cmdtcx_show_screencrypto_threadst_check_eodgetdevvphme_cddefrouter_selectamap_unrefext2fs_statfsbstp_set_bridge_prioritycompat_43_sys_sigveccrdupamap_wiperangecuio_copybacktickdeltaemul_svr4isodirinocfrootschrtoblklease_checkscsiprintuserconf_pdevnamminphysacctchkfreqah_output_cbfdesc_unmountpmap_rmk4msw_3_leftovercgfour_ioctlcd9660_specop_opv_descrtalloc_noclonepf_main_rulesetether_addmultinfsrv_rmdirsunos_readdir_callbacksvr4_sys_memcntlvop_mknod_descfdcstartxyc_ticktimetochipip6qffs_vptofhvfs_isbusyifunitcd1400_read_regdvma_endbstp_hello_timer_expirybawritetputcharintstacksi_debugcompat_09_sys_setdomainnamewskbd_detachcsedeletecs4231_set_speedffs_fragacct_umulreplace_endsunos_sys_mknodumap_printsi_obio_intr_oncgthree_stdscreentreesanity_labelsys_fchowndb_breakpoint_cmdwzeronfs_strategyvwaitforiobootpathbe_ifmedia_updmii_phy_tickcs4231_writecd_read_subchannelextendfilelortrequesticmp6_inputprocfs_doctlxyc_ioctlcmdwsemul_vt100_outputuserconf_addnfs_opencreatedefb_setsizesbreleasedb_history_sizepf_cksum_fixupmsdosfs_islockedlayerfs_startpflogoutputmax_linkhdrwsdisplayioctlalaw_to_ulinear16_lecryptof_statsysctl_rtablemsdosfs_reclaimvop_mknod_vp_offsetspmap_is_referenced4_4czs_defspeeduserconf_hist_eoctslot_matchext2fs_getattripsec_adjust_mtusbdroprecorduvm_coredumpwi_write_dataip6_sysctlmfs_mountrootsavacctpsusersvr4_sys_fstatsemtotvn_syncer_add_to_worklistvme_camemalliestartbstp_make_forwardingtk_ninsysfilt_opsclusterfreezx_stdscreenrootdevaudio_fill_silencepf_normalize_tcp_initpf_print_stateufs_ihash_slockm_tag_firstpmap_count_ptesmixer_closecdmatchmustek_trigger_scannerffs_checkoverlappfr_clr_tablespriv_regsdumpsysicmptstampreplif_detached_watchdogext2fs_fsyncnfs_tickskernfs_lookupdoforcesys_fsyncpfr_get_astatsfree_allocdirectuserconf_add_readifconfunion_freevpamap_wipeoutuser_configcast_setkeydb_map_currenthme_mediastatustcp_outputtcp_rndiss_nextnsphyattachwsdisplay_emul_attachpfdatatopacketfdesc_readupdate_ledsext2fs_updatebpp_camgx_accessopsscanjet_ctl_readuvm_swap_initcryptnfs_accesstcp_timer_2mslpf_osfp_entry_pltbr_setne2000_writememffs_reload_vnodepf_tag_packetmsdosfs_setattrVOP_RMDIRwdog_tickledb_delete_breakpointpool_allocator_freefilt_proceopnotsuppfifo_lookupxdopenffs_reallocblksnfs_removeitrootvprandomcloseunion_vfsopstimerblurbbstp_record_config_informationpcmcia_intr_establishuserconf_maxlocnamespool_reclaimxdc_cdvflushpfr_reset_feedbackcddetacharptimernfsrv_dorecruaddm_copymallocdirect_poolam7990_initmouse_copy_extend_chardb_free_breakpointssa_hw_ifif_uppfr_del_addrswsfont_getflgchkdquotlesetauinfsnodehashtblcpumodcache_alias_bitsslopenne2000_ring_copycgsix_ras_erasecolsVOP_BWRITErt_timer_queue_createmsdosfs_ioctltdb_soft_timeoutsys_openseginvalrasops_pmaskinet6domainfdesc_setattrpgdeletesvr4_sys_hrtsystregionpf_matchsunos_sys_openuvm_pageidlezeroemulinstrdb_symtabs_divreplace_endraw_attach_umuldb_boot_sync_cmdnfree_msgmapsether_ip6multicast_maxpipe_poolxyreadhme_mii_statchguao_initagten_mmapunion_closevop_abortop_descfpu_executeifa_ifwithroutepmap_changeprot4mpipeinitspec_kqfilteragten_free_screendvma_malloc_spacepmap_page_protect_pnfs_renametcp_notifycd9660_tstamp_conv7hme_carandomattachqec_translatesys_sstkdb_print_positionnfs_lookupdb_radixgetblkmouse_pastenfs_readsppp_flushdead_vnodeop_pdl10019_stop_cardmouse_copy_endmaxsmapaltq_inputmfs_vfsopssoconnectwskbd_repeatnfs_writeswap_encrypt_initializedcryptof_selectnobufferscompat_43_sys_sethostnameromhalt__lshrdi3rtrequest1db_find_watchpoint_umulreplacektremulpf_pool_limitsxdc_xdresetnfsd_waitingtcp_identtcp_rst_ppslimrtrequestcgtwo_alloc_screenifinitcompat_10_sys_msgsyscd_load_tocunpst_recvspaceshminfoquotaoff_vnoderpc_callzlib_versionne_pcmcia_attachlebufmatchfree_inodedepraw_inputcd9660_reclaimtcx_accessopsnfs_nhinitfilt_logrdetachpfattachnd6_ifattachunpdg_recvspacepipe_closelogselectaudio_drainstp4020_chip_mem_unmapcd9660_inactivedesireddquotsoftdep_mountmsdosfs_rmdirmsdosfs_fsynccfdataportal_printffsbetickufs_checkpathesp_enablesppp_paramsspifppcintrpfxlist_onlink_checkdb_elf_lookupipsp_print_tdbzsstartinittodrm_tag_findxydkdriverblf_encadler32umap_reverse_findidvputtcbhashsizecd9660_setattrdk_establishcache_printufs_quota_initz_freekqread_filtopspf_pooladdr_plvndlockaudio_closepcmcia_check_cis_quirkscryptowritebioopssltioctlpf_cache_treepf_dynaddr_copyoutipprintfsmsdosfs_statfslboltpipe_initsi_vme_dma_eoprasops24_eraserowsssclosesyncerprocpfaltq_runningpcmcia_card_gettypesemseqsufs_ihashinsin_setpeeraddrwindow_inflatedb_readlinemgx_alloc_screenwsdisplay_delscreenzx_putcmapether_ifdetachSHA384_Datatcx_promvop_fsync_vp_offsetsuserconf_histcurrndstatsxdgetdisklabelst_touch_tapenfs_bwritemsdosfs_inactivehmeioctlpanicstrwsdisplay_kbdinputaudioioctlext2fs_sync_vnodeprocfs_dofpregspppintrunpdg_sendspacesession0viscpyzskbd_get_ledssystrace_answermem_pagexyc_cdespstatsppp_ipcp_tlssw_1_leftoversys_msgsndsbus_translatecopyinpmap_kremove4_4cep_pcmcia_prodcgthree_scrlistsppp_up_eventcd9660_defattraltq_addrtalloc1rmc_dequeue_nextqestopuao_swhash_elt_poolufs_ihashgetdes_set_odd_parityencode_comp_tne2000_read_hdrsigacts0ncr53c9x_dequeuefindblkmajorpager_mapgif_softcntohlwsemul_sun_controlbmsafemap_lookupsorflushvigra_burnerttioctlarpintrqttycharsslpquevprintfsi_vme_intr_offtdb_hashstatssyncdelaysparc_led_blinkffs_mountext2fs_specop_entriesicmp6errppslimSHA512_Update_intlayer_bypassobio_scanpool_inactive_timelinear8_to_linear16_bedp8390_mediachangeencattachconfig_process_deferred_childrenwsdisplaywritekvm_setcachepool_cache_reclaimin6_setmaxmtupf_state_tree_RB_REMOVEmsdosfs_rootpf_qname_to_qidmii_bitbang_sendbitsesp_write_regtqphyattachtslot_attachunion_writeprocfs_ioctlm_tag_getnfsrv_commitsb_lockpfr_add_tablesfdesc_mountcrypto_unregisterpf_state_tree_RB_INSERT_COLORsuid_clearvigra_alloc_screenacctresumettwritechange_sign16_lesvr4_sys_sigsuspendcompat_43_sys_recvfromswapdev_vpdp8390_resetvlan_set_promiscrasops1_putchar8wsemul_sun_attachbootpath_storeah_initdead_readufs_pathconffile_pooldb_boot_reboot_cmdvop_symlink_vp_offsetsunputcendeeprom_matchpcmcia_verbosewskbd_isset_displayVOP_CREATEprobe_switchxywritefbwscons_console_initpf_expire_toacctsuspendvop_readlink_descuvm_map_referencespec_ebadfsvr4_sys_lstatvigramatchnd6_recalc_reachtm_intervalpagetables_startin_ifinitfifo_closewi_pcmcia_activaterasops15_makestampin_pcbhashlookuphypersparc_cache_enableipcomp4_inputbwtwo_ioctlnfsrv_initcd9660_vnodeop_opv_descVOP_ABORTOPbpp_cdsw_camfs_vnodeop_pchange_sign16_swap_bytes_leswap_encryptcgeight_ioctlwsemul_sun_resetopqeresetsys_acceptnsphyter_statusuvm_map_entry_kmem_poolccdclosewi_inquirenfsrv_setattrtcp_rst_ppslim_countmagma_softsys_futimesccdinitsdgetdisklabelunion_newsizewi_do_hostdecryptinternal_commandsunkbd5_keydesc_nlxyc_rqtopbmgx_setcolorcgtwo_scrlistsunkbd5_keydesc_frin_losingfddumpsppp_ipcp_tluledma_resetsunkbd_keydesc_ukVOP_SYMLINKcompat_43_sys_sigblockgeteblkmmu_pageinwsscreen_detachred_addqscsibusmatchcrypto_kregistervn_ioctlufsspec_readdb_show_calloutprocfs_readlinkpipespacetslot_mem_unmapip6_sendredirectsvfs_getuserstrshmforkcgtwelve_promcgfourteen_free_screencast_decryptkernfs_vnodeop_opv_descddb_sysctlukphy_cakernfs_badopitimerfixip_stripoptionsspifstcintr_rxexceptionsunos_sys_ustatep_vortex_probemedialayerfs_vptofhnd6_timer_chne_pcmcia_ax88190_set_iobasep9100attachnfs_mountpvpooltcp_ctlinputether_multiaddrstart_cleanerffs_blkfreeexit1sppp_lcp_tlfbdevvpiewatchdogfreefrag_poolifa_ifwithdstaddrsvr4_sys_waitsyssemu_poolpf_state_expirestslot_cadb_watchpoint_allockernel_regtable_storein6_nigrouprasops1_copycolsauth_hash_sha1uihashpf_frag_tree_RB_REMOVEtcp_keepintvlvop_reallocblks_descvop_remove_desccdwriteufswrite_filtopsttybgconfig_searchhandle_workitem_freefragwihap_sta_finduvm_km_valloc_prefer_waitunion_removed_upperprocfs_pathconfkernfs_linkqeioctlffs_allocsegm_lrurompropdb_prevbe_mcresetsvr4_stream_ti_ioctlsi_obio_dma_eopipsec_exp_first_useplimit_poolip6_defhlimcd_scsibus_load_unloadgre_outputbstp_timer_stopunp_connect2systrace_findpf_testlayer_accesspool_prime_pagern_walktreetcx_burnerstclosechcloseproc_waitingsys_chownuvm_pagewirevop_lease_vp_offsetsunion_printin6_joingroupsys_munlocksunos_sys_mctluvm_anfreedofilereadvipip_sysctlvn_statfilepfr_detach_tablezskbd_resetip6_mrouter_settablefullbewatchdogtcp_maxidlepppallocmclpoolbsd_to_svr4_sigaltstackststrategycttyioctlmbpp_mstohzffs_vnodeop_pprocess_write_fpregssys_lstatfilt_rndwritenfs_clearcommitpppopeniso_uiodiripe4_inputimport_addresscttyopenamd7930_query_devinfocd_atapibus_opsspifattachinet6ctlerrmapfifo_vnoperatesunos_sys_sysconfdisknamesdumploRMD160Updatemsdosfs_mountp9000_loadcmap_immediatezstty_unitipsp_kernnullcnpollcexport_credentialstctrl_setup_brightnessp9000matchuvm_km_initxddumpffs_sbupdatencr5380_pio_outudp_sysctlax88190_mii_bitbang_readpg_flushcachesystracef_ioctlsadb_exts_required_outvmmapbsydb_aout_search_symbolxyc_startbufuserconf_histlendb_list_breakpointsnfs_getcacheblksppp_inputvop_mkdir_descledma_carpc_msgacceptedsunos_sys_mountcgfour_accessopsncr53c9x_resetcgsix_ras_copycolsvmspace0svr4_sigcodecgfourteen_screenliststmatchchmatchscsi_decode_sensettywaitscanjet_specialuvm_map_setupprocfs_validfpregsnfsspec_readnullfs_mountetextp9100_ras_initzsttyifa_ifwithnetmemchrwi_cmdqsphy_statusfdesc_printcomp_algo_lzslayer_bmapncr53c9x_scsi_resetfpu_shrvt100_selectattributeSHA384_Updateproc_pooludp6_inputttcompatsys_writeswap_key_deletemap_forwmergedb_get_valuebstp_received_config_bpdusb_maxemul_flags_translatecnstopwsdisplay_maxscreenidxextent_print_allihashtblnfsrv_writegathersys_dup2nfs_asynciosppp_pickdb_inst_countdb_read_linewsdisplay_switch1pmap_kremove_psys_readlinkbstp_disable_port__ashrdi3scsibuszerorefunion_vn_createwsdisplay_burnip6_auto_flowlabelmfs_initpfkeyv2_expireeeprom_cdfdesc_badoplf_splitifafreeVOP_STRATEGYtzsunos_sys_statrip_sendspacealtq_getqstatsamap_addtcp_freeqcgsixmatchdvd_authsppp_pap_scrtdb_firstusetcxattachcdreadrasops15_initspec_inactivedp8390_stopsvr4_sys_shmsysSHA512_Initsys_sendtospifstcintr_mxicmperrppslimgeneric_filtopsknote_dropzx_copycolsin6_selectsrclebufprintiommu_enterzskbd_initshmget_existingin6_pcbsetportnfsrv_nullalldevsdp8390_rintsunos_sys_auditsysicmp_do_errorvmcmd_map_readvnmbpp_startamap_extendsigpropvmapbufvndencryptdehashtblsocketopsdeviombpp_sendtcx_intrX_db_sym_numargszs_maskintrnd6_maxndoptip6_iduvm_map_clip_startrawcbtablespec_readimport_authunp_marklayer_reclaimdes_key_schedicmp_mtudisc_timeoutzs_loadchannelregsskip_char_rightttyread_filtopsuvm_maptslot_event_threadmodule_ms2drain_outputvop_lookup_descdb_map_addrfb_pfour_get_videogetinoquotafifo_ebadfscanjet_trigger_scannerscsi_do_ioctlwtab_alloccd_resettimedeltapf_altqs_inactivegreattachX_db_forallstty_cdsvr4_sys_sigpendingsystrace_detachudpstatpf_test_state_tcpsetrootzscninitcd_read_toccgtwelve_resetcdioctlsystrace_policyifmedia_addacctpskipjack_zerokeysvr4_sys_breakmttyclosesppp_pap_initsppp_chap_inputlogopensppp_phase_networkbreadnxboxattachpf_osfp_pltcbtable__xordi3cgtwo_show_screenfrag6_draindosdiremptypfr_walktreeigmp_slowtimoifpromiscrtl80x9_mediachangeidleinitiate_write_inodeblocksys_getsocknamecd9660_lookupnfs_getauthvop_fsync_descep_mii_writeregvigra_screenlistmask_rnheadnfsd_head_flagumap_renamesi_headfdesc_writebridgeattachuvm_swpkeyscreatedufs_rootptyttylesetutptcp_sysctlVOP_SETATTRsigactsinitsunos_sys_creatvfs_findnameexec_elf32_fixuppf_dynaddr_setuprt_newaddrmsgvop_generic_lockuvmfault_anongethandle_allocdirect_partdoneconsttyuvm_pagealloc_stratpf_test_udppv_changepte4_4cfdclosetvtwo_accessopsusermountext2fs_dirrewrite__ucmpdi2crp_ret_queue_tailbridge_ioctlvn_closefilevfs_free_netcredpool_cache_do_invalidateip_mtudiscmld6_start_listeningcgsix_alloc_screenufs_whiteoutpidhashtblwsemul_sun_opstcp_drainsvr4_sys_putmsgsi_dma_pollm_pullupsvr4_sys_preadbpendtsleepenterpgrppagedep_in_progressnull_zerokeycrypto_freesessionMPFailisp_resetcnbellpause_timerpf_find_anchorm_copydataintrhandzskbd_txsoftprocfs_vnodeop_opv_descwsscreen_attach_syncpmap_zero_page_ppf_rule_set_qidxdc_rqinituvm_cnt_headcpu_cafilt_signalsigactsfreestp4020_delayttymallocwi_write_recordsd_scsibus_get_optparmswsdisplaykqfiltersunkbd_keydesc_itmmioctldb_nextsendsigsunkbd_keydesc_debpf_ifnameeintstackcs4231_halt_inputvfs_busylkm_listmouse_copy_extend_afterfilt_ufsdetachvlan_ether_delmultilf_getlockieresetsolistenwskbd_compose_valueip_ecn_ingressmsdosfs_bmapfifo_bmaprip_ctloutputsvr4_to_bsd_sigaltstackffs_vtblsystrace_findpidtvtwo_stdscreenipmobile_sysctluserconf_morekqueue_ioctlportal_reclaimsys_wait4rip6_recvspaceamap_share_protectfs_sysctlfilt_sordetachpsignalwsdisplay_console_confnfs_getattrlayer_node_findsi_dma_freeamap_pp_establiship_mobile_allowcgsixattachzscnprobeuvm_anon_initffs_reclaimfdesc_initbmtphy_cadqfreelisthmeresetzs_set_speedsysctl_sysvipcqzeropmap_virtual_spacesvr4_sys_fchroottcp_quenchnumemptybufspfr_route_kentrybwtwo_cdupdatepribmtphy_serviceptcwakeupp9000_ras_eraserowskernfs_vfsopsulinear8_to_linear16_be_mtswskbd_cnbellnfs_printruntimettcompatgetflagsvt100_decmodefbwscons_setcolormapqe_eintuvm_doswapencryptpf_default_rulewi_seekfilt_soreadzeropagenfsrvw_coalesceipsec_def_encpool_logsizeip4_input6pfr_ktable_comparepdevinit__iordi3dmamatchtslot_intr_establishnsphytermatchinetctlerrmapffs_specop_opv_descresetpriorityau_set_portenoioctlwsemul_sun_output_lowcharscgthree_accessopssigacts_poolexecsigsmachclk_freqzs_modempfkeyv2_getconfig_initgif_outputencstarticmp6_redirect_inputkrpc_portmappmap_enu4_4cst_interpret_sensesppp_down_eventmixer_ioctlepresetpfr_ktablehead_RB_NEXTscsistrategynd6_ra_inputin6addr_loopbackttypendvprintin6addr_linklocal_allroutersuvm_swap_freepagesreserve_spisvr4_sys_accessqsphymatchin_revarpinputstrlcpycompat_43_sys_sigsetmasknemulsX_db_symbol_valuesphys_availmustek_set_paramsext2fs_advlockknote_fdclosetslot_io_mapvop_lease_descsppp_keepalivepipe_rfiltopspfr_maskin6_cksumsunos_sys_execvstrncmppf_state_plvfs_opv_numopsdes1_decryptvfs_shutdowngetsocksvr4_sys_timemouse_hidein_interfacesxdmatchllinfo_nd6uvm_iopreemptzstty_stsoftmfs_printunixdomaindb_next_free_breakpointeeprom_uioprocfs_docpuinfouvm_tree_RB_REMOVEzx_putcharscsibusattachetheripstatsystrace_replaceaudiowritesysctl_sysvshmcs4231_getdevulminwihap_data_inputmsginitdb_last_symtabtvtwo_scrlistproc0paddrrn_addmaskrombootbstp_set_port_prioritysunos_sys_wait4bpf_bufsizeselscannfsrv_noop_randseedsig_filtopspmap_kenter_pa4mwskbdopenttclospmap_protect4mcs4231_matchpfkeyv2_acquireipsec_soft_allocationssparc_led_tobridge_addrulesppp_lcp_opt_namest_mount_tapenet_sysctlvop_getextattr_vp_offsetssystracef_writewskbd_do_ioctldead_ioctlpppasyncrelinqfill_eprocsunkbd5_keydesc_dksysctl_iflistep_read_eepromrasops_alloc_mattrvwakeupsystracef_kqfilterssattachsunos_sys_sigvecsl_compress_tcpunion_strategyvgonetcp6_ctlinputdb_stack_trace_cmdcypress_get_asyncfltsbus_cacgthree_setcolorufsspec_closene2000devstcxmatchnd6_prefix_offlinkuvm_anon_dropswapdl10019_mii_bitbang_readwi_detachigmp_inputvop_ioctl_vp_offsetskmemusagenfsm_mbuftouioswcr_sesnumlf_getblockxddkdriverwsemul_sun_console_emuldatatcp_rttdfltcleanerprocbwtwo_scrlistcs4231_round_buffersizegetcacheinfo_obpsbappendstreamm_tag_copy_chainpmap_copy_page_punion_check_pfdformatsppp_ipcp_RCRsowrite_filtopsstrncpycseadddb_disasmsdreadicmp6errratelimsys_opipelinear16_to_ulinear8_leep_statchgupdatefatsvfs_getvfsffs_sync_vnodencr53c9x_sensepv_link4_4cproc_stopzx_cross_waitprocfs_closedb_history_lastsysctl_lockax88190_mii_writeregwihap_disassoc_reqsi_obio_dma_stopnpmemarraudioread_filtopshtonluvm_km_kmemallocsvr4_sys_pgrpsysp9000_intrin6_mask2lenvndioctlrmc_initsvr4_sys_mknodmrt6_ioctltcp_dooptionsdos2unixtimesys_sigactionzscnputcdeupdatpow_w__negdi2in6_purgeaddrtunioctlcpu_modelsystraceclosesvr4_sys_getmsgtbreaduvm_tree_RB_FINDkernfs_unmountcttyreadcd9660_unlocksppp_to_eventuserconf_cmdswsdisplaycloserpc_replylkmclosedb_aout_forallmbppwritengreschedclockbpfioctlconfig_attachstty_paramipsp_addressdl10019_init_cardep_pcmcia_enablebmtphy_statusmbpp_rwtdb_timeoutsysctl_filesys_semopdisk_unbusysvr4_sys_xstatsoisconnectedsystrace_msg_resultamap_clean_worksin_gif_inputdefheightcs4231_deviceetherip_sysctlVOP_PATHCONFdk_mountrootdb_run_modestatfs_to_ostatfswsscreen_detach_syncauth_hash_key_md5_remreplace_endmfs_strategyppp_restartvattr_nullsys_getsockopthme_tcvr_bb_readbmustek_specialrasops24_putchar16frag6_nfragpacketstdb_initvlan_unconfigkernfs_xwritedb_linewildcardlehwresetin6_restoremkludgeuvm_anon_lockloanpgvfs_sysctlpmap_statshypersparc_cache_flush_allcpu_matchVOP_READLINKfoundfpufdesc_vnodeop_opv_descdb_ed_stylesvr4_sys_utimesufs_seekshm_find_segment_by_shmidmii_submatchktrpsiguvmexp_printwsdisplay_unset_cons_kbdmsdosfs_pathconfxdc_errortimeout_wheelbpf_m_xhalffdioctlaverunnablecd9660_getattragtenattachttyfreettysleepdp8390_initlayerfs_initunp_disposechquirksscsi_inquireufs_getattrBlowfish_encipherVOP_GETEXTATTRvfs_exportlebuffer_cdsvr4_sock_ioctlfsrtonameuvm_km_pgremovesoftdep_disk_io_initiationex_region_plpfr_ktablehead_RB_REMOVEpf_anchorsfscalenewallocindirbridge_hashwsemul_sun_translatezsenqueue_txip_optcopypf_altqssunkbd_keydesc_befrmclpool_allocvfs_registerpmap_rmu4_4csys_dupulinear8_to_alawmcllowatmii_printunion_symlinkbpfilterattachpmap_cache_enablesd_atapibus_opsenc_xform_skipjacktimeout_todoswcr_initdb_lccd1400_write_regrasops8_putchar8cpumatch_mswsemul_vt100_scrollupsppp_cisco_inputpmap_clear_reference4mprocfs_doregspanicsppp_ipcp_tldmsdosfs_lockseltruewsdisplay_console_devicebstp_topology_change_acknowledgedbpf_m_xwordepwatchdogautoconf_nzssoftdep_initializeipsp_skipcrypto_markbridgectlunp_shutdownstackgap_alloccpu_confwi_resetext2fs_sysctlmark_ecngif_startcluster_callbackkthread_run_deferred_queueintr_fasttrapvop_lock_vp_offsetspf_tagslastdaycheck_execdb_max_linetcp_initpcmcia_attachdeferred_config_queuedp8390_getmcafipport_lastautonbridgesvr4_setcontextwsmux_detach_scmtty_attachnum_on_worklistcd9660_fifoop_entriespppgetmdb_last_commandsunos_exec_aout_makecmdswinSlotCntvn_kqfiltersunos_sys_vhangupext2fs_syncproc_waiting_timeoutcryptoreadep_mii_readregstp4020_create_event_threadwcopycrypto_registercache_purgevfsmsqid_n2opostsigsys_pathconfrasops24_putcharin_addmultisppp_lcp_RCN_nakmaxrasops_reconfigbridge_ifdetachmmu_3lsppp_outputipsp_acquire_sascsi_probedevpmap_page_protect4_4cesp_devtcp_templatenfs_commitnbpfiltermsdosfs_readdb_object_print_cmdam7990_zerobuf_contigtctrl_cdbstp_transmit_configzstty_softintsunkbd_keydesc_nlesp6_inputbcopyprocfs_validregswdog_autoncr5380_wait_nrq_timoaltq_lookupkqueue_wakeupip6_unknown_opttcp_reasssys_getfhext2fs_vgetrt_timer_timerfb_burnerSHA1Update_intcuio_applydefrouter_addreqin6_clearscopesppp_nullfifo_vnodeop_entrieswi_read_recordp9000attachpmap_pa_existsespdma_resetaudio_free_ringne2000_readmemffs_setblockipsec_expire_acquirewsscreen_switchwaitspec_selectinflateResetmemcmpwskbd_init_keymap_uremmsdosfs_createcd9660_startdb_output_linekernfs_rootauxreg_cdpool_allocator_kmemdb_examinecfroots_sizedb_end_linetickadjvop_rmdir_vp_offsetspfsync_get_mbufpf_init_rulesetpf_rule_plsbreservevrecyclembpp_timeouthandle_workitem_freefilein_pcbnotifymissextent_printaudio_careserve_dumppagesblf_ecb_decryptcrcopydb_symformatsys_revokestp4020_map_windowip6_setpktoptionsstat_direct_blk_ptrssysctl_stringsys_rebootcompat_43_sys_lseeksvr4_sys_killunion_unmountpfsync_timeoutbufpooldl10019_mii_bitbang_writeswitchexitsunos_sys_otimesfdopenMCFailcpu_forkcompat_43_sys_getpagesizeaudioopenpfr_add_addrsdb_print_ifattylistflush_inodedep_depsuvm_vslockcast5_setkeyxformswNXFORMSWdeflateResetpf_osfp_validate__bin2bcdttyoutputmodule_vikingpmap_kremove4mcd9660_tstamp_conv17wskbd_cap9000_alloc_screenlxtphy_statustqphy_cdsemundo_clearcryptodev_cbep_pcmcia_enable1pcmcia_scan_cismbpp_hztomsfdcmatchclockintrrn_mkfreelistsvr4_sys_open64vop_bwrite_descvndreadVOP_READpfclosein6ifa_ifpforlinklocalufs_ioctlffs_freefilelastdtimenfs_sndunlocksys_setuidtimeroksi_obio_dma_setupcgtwo_free_screenscanjet_attachstart_updatecgfourteen_caufs_quota_free_blocks2senditbridge_spansppp_lcp_tldcluster_writecompat_43_sys_waitrnd_event_tailcgfour_stdscreenwsemul_sun_selectattributeuvm_setpagesizenfsrv_zapsockipsec_update_policyfpu_ftodtcp_xmit_timerst_rewindin6_recoverscopesunos_emul_pathsvr4_netopenmustek_attachmfs_badopnfs_nullskipjack_encrypttty_attachp9000_ras_erasecolsnsphy_serviceunion_advlockfirstchildcompat_43_sys_fstatpf_cache_plpmap_enter4mtimer_cdch_positionbridge_ifenqueuetickmclpool_warnmsgdb_termpflog_packetmem_access_fault4mmmclosescsi_preventnumfreepagescd9660_accessmttyttybe_tcvr_read_bit1ffs_statfsxdr_inaddr_encodepmap_rmu4mzsnull_rxintrijndael_set_keyudp_recvspaceproc_root_targetsmttyopenuserconf_histszsys_getrlimitbpf_attachdicmp6_ctloutputsppp_qflushbridge_rtfindufs_dirremovenumvndcinitif_attachsetuppipe_writevop_symlink_descstat_sync_limit_hitsbappendrmc_queue_packetsi_vme_dma_stopcgthree_screenlistpfr_remove_kentriesm_copybackcgeight_alloc_screennextgennumberipcomp_enableuvm_swap_puticmpbmcastechogre_allowfifo_advlockesp_zeroizeevcnt_attachSHA512_Updatedb_continue_cmdsoftdep_errorstp4020_event_threadprocess_write_regsconfig_scantun_ioctlwi_get_nwkeynuidhash_maxfilt_ptcwdetacham7990_shutdownbpfselectzx_burnersppp_cp_type_namefdfinishprom_inSrc_nameripsrcshminitiso_nchstatsnfsm_srvwccxyc_chainscsidebug_targetsnlineswkqueue_initializeddb_restart_at_pcdb_sstep_printpf_test_icmpether_ifattachfdcstatustunwriteinflateSyncsvr4_sys_sigactionxyioctlbridge_rtlookupsignal_initnsphyter_serviceptyioctlxyc_cmdffs_updatedb_print_formatstatus_ifpzx_copyrowsnfs_checkexpdp8390_getmagma_cdzs_to_tiocmclear_inodedepsunix2dosfnspec_advlockfragtblraw_sendspacepfsyncifnulloppf_find_fragmentam7990_meminitsttyreadp9000_ras_do_cursorpfr_copyout_addrkernfs_inactiveintrcntsunkbd5_keydesc_sgip6_ecn_ingresssystrace_insert_processsackhl_poolencioctlsppp_dotted_quadextralocunsleepX_db_lookupkernel_segmap_storeget_buffer_statusblf_encrypttdb_allocipintrsppp_ipcp_closedes3_encryptmaxdmapaltq_removepfkeyv2_flush_walkerext2fs_symlinkdb_skip_to_eolinverse_charip6_savecontrolbridge_blocknonipau_check_portsq_to_bpfkeyv2_initsoftdep_process_worklistmountrootpf_tbladdr_removewsemul_sun_output_normalnfsrv_setcreddb_inputchardb_boot_cmdsip_initreaddeprocess_read_fpregscd9660_rrip_getnameufs_check_exportdes_encryptsysctl_rdintpf_cent_pllodirtypagesfindwin95sys_nanosleepVOP_WRITEtcp_update_sack_listunion_setattrcompat_43_sys_getkerninfoip6_flow_seqputtdbuvm_loansppp_ipcp_upfdesc_ioctlifa_ifwithaddrpf_match_uidstty_startsunkbd5_keydesc_ukxbox_fix_rangesvr4_sys_getdentsp9100_free_screenstat_indir_blk_ptrsdb_write_cmdcgthree_alloc_screenwsmoused_releasehme_readsys_getfsstatbpfopencdstrategyrasops32_putcharbstp_set_path_costnfsrvhashtblvlan_configkmemstatsnd6_slowtimo_chuvm_km_valloc_alignenc_xform_nullipsp_reffreedb_max_widthmntvnode_slockfilt_audiordetachstreadnv2tov_typenfsd_headmouse_copy_selectionwsdisplay_noemul_attachipsec_policy_headsppp_pap_tluVOP_RENAMEoclk_set_dtcdclosecast5_zerokeysys_fchdircgtwelve_cafbwscons_initsunos_sys_exportfsbppopenalleventsrandompidportal_getattrfilt_ttyrdetachsys_ktracearp_inuseinet6swrouteswdosdirtemplateslattachmainbus_cdspec_nfsv2nodeop_entriesdb_uvmexp_print_cmdspifstcintr_txlayer_locksys_mincorene2000_test_memipcomp4_input_cbunion_dircacherasops8_putcharlastsecondswdog_timeoutaudioactivateffs_vnodeop_entrieswskbdselecttcp_maxpersistidlesvr4_readdir_callbackspec_ioctlnewblk_lookupufs_initsync_vnodeop_entriesproc_reparentpf_osfp_getbstp_designated_for_some_portuvm_exitcompat_43_sys_sendfc_bmapcallspr_rmpagepfr_ktablehead_RB_FINDffs_initbridge_filtersppp_chap_tluzx_cadvmamap_extentnfssvc_sockhead_flagcluster_wbuildvigra_castpmatchuvm_initvigra_cdsys_ioctlnfs_renameitsys_xfspioctlsunkbd_keydesc_svif_free_sadlktrsyscalldb_dotquotaon_vnodetslot_io_unmapfilt_bpfrdetachwsdisplay_emul_cast_loadquirksicmp6_initrasops15_putchar16filt_ttywriteaudioamd_cdin_setsockaddrptcclosetslot_resetpmap_is_modified4_4csunkbd_keydesc_dkzs_write_csrunion_createkernfs_openrandom_stateeintrcntnfs_advlockbpf_moveinacct_procostypevndbuf_poollastpiduvm_page_physloadaudiogetinfodb_aout_sym_numargsptswriteipintrqprocfs_mountepintripcpermccd_softcsoftdep_workitem_pendingvlan_ioctlmaxproctslot_functionszskbd_cnpollcip_slowtimopmap_clear_modify4msi_obio_intr_offpagedep_hashtblnfs_setattrbstp_hold_timer_expiryip6_nexthdr__bss_startzskbd_bellstopqsync_vnodespifmatchbeattachpv_syncflags4mcgsix_screenlistpf_get_ruleset_numberauxio_regshm_nusedrpc_mismatchrijndael128_encryptVOP_KQFILTERpf_calc_skip_stepssys_msyncvop_rmdir_descallocdirect_mergedeflate_compresswskbdreadsbappendrecordsd_capcmcia_function_disablepf_change_apsoftdep_fsync_mountdevinitmsgbufconfig_activatememsetsema_initcuio_copydataptsstopufs_getlbnspmap_clear_modify_pprocfs_reclaimphysiopcmcia_3cxem556_func0_cfe0nfs_realign_testin6_selecthlimdb_symbol_is_ambiguousaudiocs_cdxyc_resetmii_phy_delete_medianfs_cltpsockcrypto_kdispatchicmp_mtudisc_clonesppp_print_byteskernfs_vnodeop_entriescgsix_caclass_cmpsodisconnectsys_setgroupsmainpmap_rmk_pnfs_vfs_initprocess_sstepbppioctlmgx_screenlistisp_attachkill_user_windowspf_remove_fragmentrasops_init_devcmapfdesc_vnodeop_pipsec_acquire_headktrgeniopfr_clstats_ktablepfr_insert_ktablesip_flushdp8390_configrasops_mapcharnfsspec_closeuvm_unmap_removetickdelayzsreadfd_typesdb_hangmanicmp_erroruvm_swap_markbaddes_set_keykqueueopsaudio_pintpf_addrcpyoldmon_w_tracevholdqestartdb_help_cmdsbppmatchsystrace_wakeupm_adjalaw_to_ulinear8loadfpstatemld6_stop_listeningppsratechecksys_ptracescsi_free_xskmemlimitcompat_43_sys_setrlimitncr5380_cmd_timeoutamap_copyunion_fsyncdvma_mapin_spacedevinsysctl_kmemlocksirsystrace_unlocklf_findoverlapcs4231_set_portovbcopysvr4_sys_statlf_wakelockdoclusterrazdb_sym_numargsvmel_cadumpconfwi_rxeofskipjack_forwardspipe_selectsys_shmatpf_match_addrfilt_rndwdetachwsdisplay_cons_kbd_pollcdead_badopoclockattachsparc_interrupt4mcalcrusys_unlinkblf_cbc_decryptdb_cmd_listrt_setgateipc_n2opf_dynaddr_updatesetpte4mdqrefsema_gettcp_ack_on_pushkernfs_reclaimzsaddrext2fs_rmdirsysctl_intkqueue_closewsdisplaystopstrlcatpfr_clr_addrsifnet_addrsunion_statfsulinear8_to_mulawau_set_gainifv_softcdisk_unlockpf_test_tcpep_roadrunner_mii_enableufs_ihashrempf_map_addrzskbd_enablecttywriteoclk_get_secssvr4_elf_probesdmatchpt_softcpagetables_endproc0ccdopenufs_renamesppp_lcp_inittslot_printext2gennumbersvr4_sys_mmap64cryptoselectsoo_readhme_reset_rxtbattachbreadaufs_openwsmuxdoclosebstp_set_port_statepfr_ffaddrm_catidle_uzsstoprtinitprocfs_freevpncr53c9x_variant_namestqphy_statuszskbd_stsoftcluster_collectbufsepbusyeepromcpcbuvm_swap_inittcp_nowttystatsdb_trace_until_matching_cmdproc_printitdes1_setkeyunp_gcsys_clock_gettimecsefreeip6_hdrnestlimitunion_unlockpool_catchup_uremreplaceswift_hotfixfrag6_initbuf_replacevnodemsdosfs_vnodeop_opv_descnullfs_vnodeop_opv_desclba2msftimeout_set__subdi3tctrl_read_datawsdisplay_resetprocfs_docmdlinelayer_islockedntohsgetptep4mcgfour_scrlistinet_ntoadb_boot_poweroff_cmdcgsix_ras_eraserowsext2fs_mkdirext2fs_direntermii_pollstatpfkey_registerst_erasefdesc_lookupdupfdopenchange_sign16_benfsrvlruheadifmedia_list_addpidhashvfs_mountrootpfr_lookup_addrbe_cdsppp_lcp_TOuvm_totalbtcham_caencdebugpfr_table_countsvr4_sys_fpathconfzx_eraserowscs4231_halt_outputdb_unread_charcgtwelvematchdl10019_mii_bitbang_opstimestat_worklist_pushvme_cdstart_initelf32_olf_check_headerbe_tcvr_write_bitsvr4_sys_sigprocmaskkernfs_allocvppmap_copy_page4mtcp_mssdfltbt_putcmapuvm_swap_freetcp_rndiss_sboxsbus_establishcgsix_setcolorzx_attachzs_iflushrnd_wseldb_look_charin_pcbdetachmsdosfs_vfsopsienab_bic_4mcd_sizettycheckoutqpmap_zero_page4_4cicmp6_mtudisc_callback_registerdb_set_variablene_pcmcia_detachrnd_event_spacecn_tabin6_ifdetachdb_search_symbolvndstartip_forwardppp_compressorszx_resetextent_createxdstrategybstp_timer_startbpf_freeddisklistswap_bytes_change_sign16_beallocindir_poolsys_fstatfssvr4_trappmap_clear_reference4_4cidpromm_injectdb_aout_lookuptvtwoattachbusprintnd6_setdefaultifaceffs_isfreeblockccdioctluvm_map_lookup_entryhztoBlowfish_expandstatevop_pathconf_descm_pullup2emul_sunoszscngetcdead_strategymtty_matchprocfs_domemktrcswspec_fsyncpriq_pfattachip6_optlenportal_unmountuvm_map_deallocateicmp_reflectp9000_burnerpmap_dumpsizemii_phy_activatesunkbd5_keydesc_noext2fs_reclaimsvr4_add_socketffs_ballocsys_getgroupssvr4_stream_getmakememarrpfkeyv2_createip6_raw_ctloutputsoftdep_setup_allocdirectkernel_textufs_startxyc_errorcs4231_set_paramsumap_getattrlkminitbwtwo_show_screenkernfs_get_rrootdevkinfo_vdebugnsphy_resetzstty_stintufs_bmaparrayfragtbl8nfsv2_typepfioctluvn_sync_locksysctl_initpcmcia_function_enablecgeightmatchpf_mv_poolxyc_piodriverufs_quota_alloc_blocks2fc_fileextendsexport_lifetimefilt_sigattachcgsix_free_screenVOP_FSYNCtslot_intr_disestablishmgx_mmapffs_sysctlipport_hilastautoarpinit_donespec_closecd9660_closectx_freezskbd_ioctlncr5380_pio_insys_shutdowncngetcam7990_resetesp_dma_stopprom_vstartgetcacheinfo_sun4crnd_statesm_gethdrsunkbd5_keydesc_svvmeintszs_shutdownbridge_inputconfig_rootfoundzstty_diagzs_getcputcunion_linksysctl_rdstructtrapregion_lockedschedcpusematprintf_closesbappendcontrolwsdisplay_screenstatenfs_lookitupwihap_sta_timeoutsi_cdesp_switchsoftdep_flushfilespf_frag_tree_RB_INSERT_COLORipv4_inputm_getclrpool_headcompat_43_sys_quotaptsopenax88190_mediastatusncr53c9x_watchfpu_mulncr53c9x_msginvigra_intripforwardingif_indexdb_lexaudio_calc_blksizebufhashtblarc4random_statefpu_addprtactiveaudio_mmapksym_upcaseufs_makeinoderasops_copyrowsip6_process_hopoptsufsfifo_readunion_accesssystrace_lckwsdisplay_set_cons_kbdpfkeyv2_sendmessagefifo_writefilt_ttyreadsys_getpgidcache_lookupaudio_clearkfsheadred_allocin6_purgeifdb_aout_line_at_pcfree_msghdrsdb_boot_crash_cmdsystrace_forkumapfs_vnodeopv_descsle_cdnewdirremrijndael_encryptdp8390_intrstackdumpp9000_show_screenbwtwo_burnerrasops_do_cursorfbnodepv_unlink4mwsemul_vt100_handle_dcsin6_ifawithifpncr53c9x_donesunos_sys_sigreturnpf_altq_pldumpsizewskbd_set_console_displaypppoutputccdstrategytunattachpppstartextent_freeuvm_aiodone_daemontslot_queue_eventaddupc_tasksched_synctslot_slot_intrsc_err1pcmcia_print_cisnewblk_hashtdb_add_inpsetsigvecmountnfssys_sendmsgbridge_rtdaddrsppp_isemptyvn_marktextam7990_readstrcmppf_print_hostwskbd_rem_muxsys_quotactlvop_close_vp_offsetsep_vortex_mediawdog_initrndread_filtopsbstp_enable_change_detectionisp_asynctcp_mtudisc_increaseunion_vnodeop_entriesulmaxin6_pcbconnectdehashpmap_page_protect4msystrace_msg_policyfreeout_fdchook_disestablishbpf_catchpacketstrayintrffs_isblocksystr_proc_pldb_stack_trace_printmgx_burnercgfourattachcgthree_ioctluvm_swap_allocpagesuvm_aobj_poolpfr_insert_kentriesmouse_copy_extenddb_examine_cmdicmp6_reflectsetrunqueueudv_attachsettimertable_initpppdumpbkernfs_inithfsc_remove_queuedp8390_detachfdesc_allocvpvop_access_descqe_tintmii_phy_auto_timeoutnetisrdb_clear_breakpointsxdc_perrorcgeight_stdscreenttyrubpfsyncattachrevarpwhoamivop_generic_islockedauth_hash_hmac_sha2_256_96mgx_cdbufcachepercentwsscreen_attachmfs_ioctlm_pulldowncttyselectagten_show_screendayyrpmap_initufs_rmdircryptodevkey_cbminip6_initconfig_detach_childrenrawcb_timeout_locktcpcb_poolz_errmsgpf_addr_wrap_neqmgx_ioctlsppp_chap_openmii_bitbang_readregBlowfish_stream2wordcgsix_scrlistswallow_zsintrsipip_allowsys_pollalaw_to_slinear16_beuvm_map_clip_endufs_makedirentrypf_normalize_tcp_statefulmodule_sun4ckcur_mulreplacenfsrv_getcachekernfs_setattrcbq_getqstatshme_putvnode_hold_listpmap_enter4_4clastdosdatefdhashtbltadpole_powerdownssopenufs_linksys_mkfifodb_cmd_searchcgeight_screenlistifa_ifwithafhandle_written_mkdirpcmcia_parse_cis_tuplezskbd_set_ledstimerreg_4min6_leavegroupsoo_selectiminsddumpsppp_cp_sendsys_chflagsstp4020_chip_mem_mapbestoppfsyncoutputdelaysdstartpower_regch_get_paramsskipjack_decryptddb_regsbstp_received_tcn_bpduvt100_outputpf_fragqueuesoft01intrpmap_clear_reference_pext2fs_vnodeop_pzskbd_accessopsuvm_pageoutncr53c9x_timeoutpffindtypepdevnamesp9000_ras_copycolszshwiflowinodedep_in_progressqsyncwi_setmultififo_opencd9660_vptofhwi_attachmii_phy_downuvmspace_forkraw_initsemundo_adjustknote_enqueueswap_bytesvigraattachmodule_turbosparcudpcksumtcp_sendspacedl10019_mii_writeregisp_startdb_maxoffmmuregionsffs_oldfscompatnfs_rmdirrijndael_decryptin6_matchlenstat_dir_entrysys_madvisetadpole_get_videopfr_tst_addrstctrl_matchscsibusdetachxdr_string_encodesystrace_setegiddisk_attachwskbd_displayioctldb_cmd_loop_donexdattacharptfreevlan_ether_addmultisppp_pap_inputipq_lockeddb_show_arptabbstp_root_bridgefifo_vnodeop_pvop_write_descep_isa_probemediavop_read_vp_offsetsmfs_startdead_printmii_media_tablewscol_whiteswap_bytes_mtstcp_rndiss_encryptxycloseflush_pagedep_depsttyprintfccdinterleavesigcodeespdmaintrdb_elf_search_symbolipip_inputpfkeyv2_parsemessagedb_delete_watchpointne2000_detectbuf_undirtysysctl_tstringrmc_dropalldma_setupnfs_unmountnfsrttmsqidsdb_watchpoints_insertednfs_fsinfofilt_ttywdetachxdsizeuvm_tree_RB_INSERT_COLORvop_unlock_descpool_allocator_nointrsys_sysarchBlowfish_deciphermustek_readrrootdevigmp_initpmap_zero_page4mcgsix_ras_initmii_phy_add_mediatvtwo_free_screenqec_fix_rangeputphysbufnfsv2_vnodeop_entriesvop_remove_vp_offsetsMD5Initqsclockregcryptodesc_poolbwtwo_mmapffs_vfsopssysctl_mallocwihap_ioctlfpu_ftoifrag6_slowtimouvm_map_hintcgtwo_putcmapwant_reschedppp_deflatemsdosfs_mkdirkthread_create_deferredrasops8_initnfs_xdrneg1nullfs_vnodeop_entriesxycmatchzx_do_cursorlayer_lookupmbpp_recvexport_keymtty_modem_controlscsibusactivatezsparamnd6_timertcp_do_ecnportal_symlinkvop_open_descmsghdrssemexitqsphy_servicezx_fillrect__cmpdi2svr4_sys_ulimitcd_patternszstty_rbuf_hiwatraw_detachaudiodetachnfsrv3_accesscompat_43_sys_stataudio_writexdc_ioctlcmdlebufattachmulaw_to_ulinear16_lensensorsdomainnamelenmgx_cacd1400_write_ccrtslot_mem_freenfs_sendip_rtaddrfiledesc_initcgtwelve_alloc_screenvrelewi_set_pmcallromprtrealloccheck_consolehme_mii_readamap_freebstp_ifupdstatusin6_domifattachwsdisplay_cnputcpfr_ktablehead_RB_REMOVE_COLORswreadumapfs_vnodeop_pcgfour_setcolornd6_prefix_lookupcddonesync_inactivespec_printlocleanpages.uremtimermatchext2fs_lookupmsdosfs_opendvma_cachealignext2fs_linkvop_generic_revokecpu_switchfifo_printfilt_sigdetachtcp_do_sacklayerfs_donevigra_setcolorext2fs_renameesp6_input_cbipsec_def_authunion_renamemii_activatettywflushcd9660_rrip_offsetwskbd_default_keyrepeat_dataclosefvop_rename_descsoftdep_sync_metadatapmap_releaseagten_loadcmapmii_ticknfs_mount_disklessngifip6_dad_countuvm_pager_dropclusternfs_fhtovpfilt_generic_detachprocfs_symlinkpool_print1exec_aout_prep_omagicsppp_auth_sendpcmcia_card_deactivatenfsrv_fhtovpdb_breakpoint_listwi_pcmcia_matchunion_readdirksymsread.remcd_get_parmsnd6_ifptomacsppp_chap_TOamap_unaddshmseqscd9660_printshmsegsnfilesepstatusindirdep_poolipcompstatcd9660_islocked__bcd2bincgtwoattachsvr4_sys_setrlimitin6if_do_dadagten_alloc_screenrevarpwhoarewecryptodev_keypipe_kqfilterext2fs_openportal_vnodeop_opv_descacct_threadscanjet_readsoftdep_setup_directory_addmsdosfs_vnodeop_entriescgtwelve_accessopsmulaw_to_slinear8st_mode_sensefreeblks_poolstopprofclockdb_hangstat_blk_limit_pushbstp_etheraddrnullioctlcryptof_closeipsp_ref_matchportal_linkisohashparsediskncr53c9x_schedbstp_timer_expiredntunp9100_intralaw_to_slinear8wi_set_debugbstp_transmit_tcnbreadamap_lookupnetaddr_matchnfsm_srvpostopattrpf_osfp_addrt_timer_remove_allwskbddevprintksymsclosesbpp_cdsunkbd5_keydesc_essoftdep_setup_allocindir_pagewsdisplay_closescreenexport_identitysvr4_sys_creattctrl_catcp_usrreqdb_playscompat_10_sys_shmsysuvm_swap_needdecryptmfs_vnodeop_entriesnfs_getnickauthsd_interpret_senseudp_usrreqrmc_delay_actionifmedia_initext2fs_vfsopsext2fs_inactivedead_bmapdb_guessespf_send_icmpesp4_input_cbbpf_dtabsoo_kqfilterne_pcmcia_disablefpu_explodefifo_pathconfcpu_startuptvtwo_mmapquotaonpfr_setflags_ktablettcompatsetflagsamap_refcompat_43_sys_lstatpfr_get_tablesam7990_putfilt_fifordetachdb_command_loopxbox_cafilt_fiforeadfdexpandtickssrandommsdosfs_closehme_eintncr5380_intrpf_addr_plext2fs_setattrxdr_inaddr_decodehfsc_remove_altqlayer_getattrsysctl_clockratevn_rdwrnd6_need_cacheip6intrsys_msgctlsync_crashsystrace_msg_askprocfs_badopsvr4_sys_sysarchpf_state_tree_RB_NEXTuvm_pagedeactivatevop_write_vp_offsetssunos_sys_quotactlufs_unlockep_pcmcia_activatesvr4_sendsigtcp_ctloutputmono_timeukphy_statusMD5Updateblktochrvop_create_descpf_purge_expired_statesifmedia_setpcmcia_function_initpmap_createuvm_map_extractnfs_readdirrpcnfs_msgnd6_prelist_addpf_get_translationufs_removelayer_bwritecd9660_readlinkboottimeaudioamd_cacgthree_intrwsdisplay_set_console_kbdVOP_ADVLOCKdb_watchpoint_cmdqe_cdzx_erasecolsfrag6_inputsunos_sys_fchrootunpst_sendspacenfsrv_mknodptcreadpf_osfp_fingerprintrasops8_makestamptcp_rscalettwakeupuvmspace_freepmap_enk4_4cext2fs_inode_poolipsec_common_input_cbpfr_del_tablesswbufffs_ino_poolmulaw_to_ulinear16_bevmes_camii_phy_statusmsgpfkey_initwsdisplay_internal_ioctlVOP_PRINTfdsharenfsrv_removebufinverse_regioncdstartpf_pabufsnapshotbstp_topology_change_timer_expiryclockfreqsppp_pap_tldfilt_generic_readwriteuserconf_disablevlan_ether_purgemultiunion_ioctlvrefspechash_slockiematchlewrcsripforward_rtbsd_to_svr4_speeddb_elf_forallvt100_ansimoderasops_lmaskfifo_nfsv2nodeop_opv_descdb_set_temp_breakpointticket_pabufsys_nosysallproccdevswpf_tag2tagnamezskbd_cngetcnfsm_uiotombufstp4020_chip_intr_establishfb_pfour_set_videone2000_attachfree_diraddsys_mlockallvndsizegallant12x22pmap_rmk4_4cwskbdcloseuvm_sysctlwskernel_bgstatintrgetsnepstopsrmmu_get_asyncfltsys_fchflagsdisksortrt_timer_countpowerhook_disestablish__builtin_saveregscryptodev_opfilt_audiowritefpu_stofhme_rintukphymatchuvm_pager_putmfs_mountzs_cdmmumodhypersparc_get_syncfltip6_ecn_egressin6_gif_outputin_canforwardvlan_inputrasops_unpack_attrremove_selectionwsdisplay_shutdownhooksrmmu_cache_flush_allvop_select_vp_offsetsxycattachsrmmu_vcache_flush_segmentwi_pcmcia_attachrasops_copycolspmap_destroynfsfifo_writehme_mediachangepowerhook_listam7990_configetherbroadcastaddrlayer_node_allocprocfs_getcpuinfstrsunos_sys_unmountfdcpseudointrkernfs_freevpvfs_getnewfsidvndunlockudp6_ctlinputsemid_n2oitimerroundwdog_shutdownuk_cascsi_print_sensemmopenwskbd_update_layoutffs_inode_freeSHA384_Update_intpf_normalize_tcprtioctlipsec_acquire_pool_initializedzx_cdwsdisplay_noemul_matcheptxstatprofprocsip6_inputtbr_getpf_purge_timeoutpagemoveroute_srcspeedup_synceraudio_blk_msigmp_sendpktesp4_inputpfkey_senduppriq_remove_altqcgeight_cdsunos_sys_fcntlifmedia_baudrate_descriptionsv_putcsystrace_msg_childipcomp_attachm_getptrviking_cache_flushufsvnode_filtopsunion_newlowerccdmakedisklabelpf_send_tcpreadbuffersqecmatchuvm_fault_unwiresppp_cp_change_stateuserconf_common_attr_valext2fs_vnodeop_entriesipseczeroessys_getitimerhme_tcvr_bb_writebdonicefdesc_targetsmerge_inode_listsetherip_inputcpu_configureip6_freemoptionszscnpollcptcopenaudio_alloc_ringmodule_sun4ne_pcmcia_matchwsdisplay_common_attachuvm_swpkeysdeletedzs_attachrn_refinesmfs_statfshmac_opad_buffersockargswsdisplay_getactivescreenvmes_scanvop_generic_abortopstattachchattachsetregshandle_written_filepagepfr_prepare_networkepsetmedianfs_rcvunlocksobindvmcmd_map_zerodb_read_charzstty_matchnfs_asyncdaemonvfsinitarcbroadcastaddrcnclosetimer_canfsm_adjdb_tok_numberrasops24_initsddonereplacemultcp_do_rfc1323ip_fragsfilt_fifowdetachsvr4_sys_lxstatmii_phy_setmedialo0ifphostidpool_chkaudio_ioctluvm_pagermapoutcheckreplaywindow32ipqmaxlenktrsysretnam2blkext2fs_vptofhnfs_linkdefwidthtadpole_set_videounion_diruncacheip_maxqueuesysctl_ttyamd7930_halt_inputamd7930_set_paramsin_socktrimdeadproc_slocksys___semctlmmusegmentssys_mprotectrtallocwi_initsunkbd_keydesc_usnfsrv_updatecachemsdosfs_reallocblksvop_readlink_vp_offsetswi_pcmcia_cazs_def_cflagbridge_rtflushdequeue_randomnesssyncer_maxdelaypf_normalize_initwsdisplay_getscreencs4231_allocdeadprocstart_reaperfdesc_pathconfuvmspace_unsharesys_fcntlisp_prtukioctlunion_lockpf_change_areq_clear_removevfs_free_addrlistsys_setrlimitsys_sigpendingsvr4_termio_to_termiosuvm_map_cleanicmp_redirtimeoutccdiodonesppp_chap_scrttyclosepool_allocator_drainulinear8_to_linear16_ledisk_resetstatmfs_inactivemtty_paramcgtwo_stdscreenicmp6_nodeinfocomp_algo_deflatemaxvfsconftimeout_addcpu_cdep_pcmcia_disable1ip6_forwarddb_fncallme_freenumcachenfsrv_linklkm_nofuncintr_establishcpu_initclockswskbdioctlmii_downkinfo_vgetfailedbrelseext2fs_unmountpsratiosdminphysbe_ifmedia_stssppp_close_eventaudiokqfilterwsdisplay_switch3sppp_dequeuettyoutipc_o2nDebuggerdevice_lookupinodedep_hashtblnfsrv_statfssystraceopencdminphysnumcleanpagesschedhzrip6_inputlkmdispatchp9000_ras_copyrowsfd_motor_offuvm_tree_RB_MINMAXtcp_totbackoffuserconf_baseSHA256_Initlooutputwsemul_sun_outputrijndael128_zerokeysoisdisconnectedcpu_coredumpdvd_read_disckeyuvm_aio_aiodonecrp_req_queuesystrace_attachsvr4_sys_sysconfigss_set_windowcrypto_freereqclrbitsdb_boot_dump_cmdvndshutdownstp4020_chip_socket_enablevop_select_descpcmcia_card_intrmii_phy_statusnfs_repheadzs_hwflagsfdwritedl10019_mii_resetle_cascsidebug_levelcrypto_newsessiondevcttykernfs_accesskrp_ret_queuep9100_accessopsbwtwo_free_screengre_sysctlsoclosemfs_bmapnfsrv_pathconfwakeup_nsys_connectmgx_stdscreenbuf_daemonsys_nfssvcintr_sbus2ipl_4mp9000_scrlistvmeintr_establishskpcsvr4_sys_contextunion_vnodeop_opv_descdb_leroute6_inputcgfourteen_burnervlan_startcompat_43_sys_mmapvop_read_desccnreadzstty_rbuf_lowatcluster_newbufsys_socketpairbwtwo_cafdcretryudp6_sendspacedead_selectdounmountuvm_swap_allocwskbd_pickfreealaw_to_ulinear16_bess_identify_scannerdb_elf_line_at_pchmeattachpool_cache_destroyprom_vendchkdqchgttspeedtabulinear8_to_linear16_le_mtsledma_cdkqueue_readzx_mmapcd_scsibus_setvolpool_page_alloc_nointrcgfourteen_cdpmap_copy_page4_4ccd9660_mountkernfs_epochst_mode_selectnfsrv_renameuserconf_maxdevlxtphymatchpv_sizeah_zeroizewskbd_activatewsdisplay_cons_pollmodepfr_sin6wi_media_statuswsemul_sun_output_controlnd6_purgeshm_pooldb_mult_exprtcp_keepidleif_attachheadnextcdb_listbreak_cmdiszerodevcgtwo_cacpu_spinupauth_hash_hmac_ripemd_160_96vop_advlock_vp_offsetsscanjet_set_paramssys_fhstatsparc_ist_unmountnullmodemwihap_sta_deauthmemreg_cdsunos_sys_ptraceif_attachdomain1raw_recvspaceccdunlockdiskerrwi_startptyattachcd_cdwsdisplay_screentype_pickcompat_09_sys_getdomainnamewsdisplay_addscreen_printdb_machine_commands_installsunos_sys_ioctlsun4_vcache_flush_regionsys_preadne_pcmcia_activateuk_switchmgx_loadcmapkmem_mapcd9660_check_exportagtenmatchqsphyattachcpumatch_sun4soqinsquediskstatsauxregbiscdes_ecb_encryptswap_key_prepareudp_inputieattachnchrtoblktblvigra_loadcmap_immediateihashrn_search_mresettodrpmap_protect_pufs_readdirsys_flockarc4random_initializedspifsoftintrmrh_listuvm_unloanpagelkpvspec_badopcgtwelve_cdmbppclosemsdosfs_linknode_has_propertymustek_minphyshfsc_add_altqpfr_ktablehead_RB_MINMAXigmpstatsppp_proto_namerwindow_savevn_initialize_syncerdpf_check_proto_cksumufs_selectcd9660_quotactlpmap_dumpmmuicmp_sendwrite_user_windowsrasops1_erasecolshme_reset_txunion_allocvpvop_bwrite_vp_offsetsbsdi_stringsopenpromclosekrpc_callsowakeupinsidecgfourteen_resetsystrace_make_msgpfr_nulltabledb_putstringsvr4_fil_ioctltcp_clean_sackreportdb_strcpy_edatamttyreadmouse_copy_linesigactsunsharetimeout_hardclock_updatespppattachrijndael128_decryptpf_match_translationttkqfilterstpattachwaittimem_tag_deletecd9660_ihashremepinitip_fragmentsys_statfsSHA1Finalrawin6pcbtablescanjet_compute_sizespool_cache_invalidateslinear8_to_alawp9100_burnerkprintfdevice_unrefcgfourteen_setcolorscsi_startvnode_poolin_cksumdeflateInit2vnode_free_listfdcioptcp_savetikernfs_readdiruvm_pagereallocncr53c9x_reselectbsd_to_svr4_termiosuvm_fault_unwire_lockedpmap_extract4mipsp_process_doneaudioprintpool_printit_endgetpropdes_check_keysogetoptsoftdep_freequeueuvm_unmaparc4maybeinitp9100_ras_do_cursorfdprintzs_write_datadb_deletewatch_cmdsoftdep_load_inodeblockwsemul_vt100_attacharp_intimerpollscandomaininitvflushbufip6_forward_rtslioctlsppp_lcp_openwskbd_get_mapentryinitiate_write_filepagevndclosenfsrv_slpderefsbcreatecontrolsys_mlockpf_cachequeueinitfpstatefpu_xtofdvd_read_structzs_get_chan_addrpowerdownportal_vfsopscompat_43_sys_getpeernamencr5380_abortvdevgonehtonswrite_all_windowssunkbd_keydesc_sfdb_show_callout_bucketbucketkqueue_writesys_syncnfs_readdirplusrpcaudio_selwakeuppf_addr_incfddkdriveripsp_process_packetsunos_sys_rebootie_mapnfs_pathconfmb_mappgt_allocatorfpu_newnannfsstatsenodevffs_mountfsin_delayed_cksumsrmmu_pcache_flush_linein6_is_addr_deprecatednfs_rcvlocktslot_intrwsemul_vt100_edzsioctlpf_ip2keyicmperrppslim_lastrtstatttvtimeoutncr53c9x_intrspeclisthbdwritencr5380_reset_scsibusvndattachsppp_open_eventVOP_INACTIVEswap_decryptnullfs_unmountpfsync_setmtuwsemul_vt100_translatesoftdep_deallocate_dependenciessunkbd_keydesctabfd_do_ejectwihap_sta_is_assocprocfs_lookupkputcharlayerfs_statfssys_getsiddb_trace_until_call_cmdRMD160Initss_gen_quirkscompat_43_sys_sigstackrasops15_putchar8fileheadvndsetcrednextvnodeidtadpole_get_brightnesssys_swapctlpfsync_pack_staterasops1_do_cursorbd_reqsvr4_sys_pwritest_patternsch_patternsspifstcintrin_selectsrcmsgscpu_exitwskbd_muxopsfdgetdisklabelhmestartunp_attachch_moveimport_credentialssys_renamernd_rselcgfour_show_screenpfr_get_addrspnozz_cafrag6_nfragsip6_log_timepf_flush_fragmentsxdcattachcd1400_enable_transmitterufs_ihashinitunp_deferuvm_km_valloc_waitsys_sigreturnms1_cache_flushsys_shmgetlebuffer_castp4020_queue_eventsbflushpf_update_anchor_rulesipsec_require_pfsswapdevwsdisplayttyrominterpretsysctl_intrcntvn_readfilt_ptcreadah_massage_headerspfs_vlockbwriteleavepgrpqsphy_cdcd_scsibus_set_pa_immedagten_accessopsuvmpageropsuvm_page_initstatminaudioselectwihap_sta_alloccast5_decrypttadpole_set_brightnesspf_match_tagsi_vme_intr_onwsfont_locktcp_timer_funcsipqent_poolbufq_default_addif_attachdomainpfr_set_tflagsaltq_pfattachswap_keyicmp_ratelimitdb_aout_symbol_valuesinvalhashsegm_lockedieintripe4_attachax88190_mii_readregtdb_soft_firstusepfr_clstats_kentriessosendsema_pooldosetrlimittree_ext_gwyrn_initxycintrlayer_openbufq_default_getloopattachdp8390_watchdogukcloselkmexistsnfs_hashlockzs_matchled_scRMD160Finaldb_listwatch_cmdnfsm_reqhsl_softcchainlengthprocess_read_regsau_get_gainesp_dma_gopagedep_poolrn_lookupuvm_map_reserveallocate_copybuffernum_dirremvlan_input_taguserconf_show_attrsys_execvetcx_stdscreenencoutputfdallocwsdisplayreadstp4020_chip_io_freemmu_reservemon4_4cscsi_done_remqueespmatchnfsspec_writechkvnlockhw_sysctldb_siftingdb_look_tokenconsintrnumvnodescryptof_ioctluvm_pagefreecompat_43_sys_acceptpf_frag_tree_RB_INSERTie_cdcd_scsibus_opsportal_startcgsix_burnerext2fs_inode_allocswcr_encdecpmemarrwsdisplay_switch2zskbd_belldb_examine_formatin6_ifindex2scopeidin6_pcbbindcluster_rbuildreapercompat_09_sys_unamecoredumpfilt_kqueuemalloc_roundupnfsrv_readep_mii_syncled_caSHA256_Endpipe_readaudiostartpifioctlsys_utimesdb_symformatssun4_vcache_flush_contextlkmenodevpmap_is_referenced4mwscol_blacknd6_storelladdrsunkbd_keydesc_sv_nodeadrip_initsocreatesystracef_statcgeightattachureadcbppwriteufs_setattrrijndael128_setkeylogpridoclusterreadregion_freelisthandle_workitem_removecast5_encryptsys_exitsystracef_close_uremreplace_endpf_state_scrub_plnfs_decode_argsgrepmap_kenter_pa_pm_applymodule_unknownswcr_processcryptof_writepppasyncstartamd7930_trapsadb_exts_required_indb_watchpoint_listeeprom_givealtq_disablecd_playsys_clock_getrespmap_is_modified_pbridge_rtupdatespec_bmapttystats_initmustek_rewind_scannerne_cdpool_cache_destruct_object_remreplacesvr4_sys_utimefd_motor_onbstp_acknowledge_topology_changend6_umaxtriesfindzsienab_biccbq_add_altqnd6_debugfpu_itofstdumpzskbd_rbuf_size_divwindow_deflatedb_delete_temp_breakpointsunkbd5_keydesctabunion_bmapget_random_bytesmagma_attachSHA1Transformesymcrypto_invokeosreleasevndiodoneVOP_RECLAIMpf_empty_poolturbosparc_hotfixtctrl_setup_bitportipcomp6_inputgre_inputpflogioctlspec_nfsv2nodeop_phmematchpgrp0pf_state_tree_RB_FINDfilt_ptcwritewihap_timeoutuserconf_changecd_scsibus_getvolgetpropstringmakefstypedb_paniccddkdriveruvm_anon_addvigra_free_screenwsemul_sun_resetuserconf_helpufs_advlockSHA256_Dataicmp_initlayerfs_rootmouse_movereluvm_growcsecreatevfinddevam7990_tintfd_cdsavefpstateif_detached_initnfs_falsecgthree_free_screendopowerhooksah6_inputpf_test_state_icmpether_delmultivfs_op_initptckqfilterdb_history_currpppinputpf_match_gidrpc_auth_kerbexec_sigcode_mapsys_gettimeofdaynbootpathipsec_soft_timeoutipsec_policy_pool_initializedviking_pcache_flush_linevcleansystracewritecgtwo_mmaprasops8_putchar16splassert_ctlpf_free_fragmentcgthree_cdsys_getresuidsys_fhopendos2unixfnp9000_screenlistscsibussubmatchcgtwelve_show_screencdzerorefuvm_km_pgremove_intrsafeext2fs_sbupdatedefrtrlist_delsystrace_getcwdsys_fchmodvop_strategy_descmtty_startpmap_clear_modify4_4cuvm_unmap_detachvop_islocked_descamd7930_get_portuserconf_common_devsema_releasestartipe4_zeroizemclpool_releaseskip_spc_leftstp4020_iointrst_identify_drivevn_isdisksys_selectsvr4_sys_llseekcryptoattachvnode_free_list_slockxdreadmsdosfs_selectzombproclogreaddead_locktcp_issfc_largedistancezstty_rbuf_sizesrmmu_vcache_flush_pageclock_caregssys_setitimerisofntransnd_prefixclear_removewsemul_vt100_resetext2fs_specop_pvfs_unregisterseminitvndstrategyvt100_setnrcswap_key_createsppp_ipcp_RCN_nakselwakeupzstty_rxintffs_reloaddb_set_watchpointscnwritepfr_clstats_ktablescompat_43_sys_killpguipc_usrreqzstty_txsoftnd6_na_inputrtl80x9_mediastatusdb_next_free_watchpointvflush_vnodefilt_rndrdetachmulaw_to_slinear16_lescsi_scsi_cmdin_gif_outputah4_ctlinputrip6_usrreqin6mask96sloutputcoldah_outputdb_clear_watchpointsbutton_eventunp_scanexec_aout_prep_nmagicp9100_loadcmap_immediateunion_mkdirsbappendaddrsemutotesp4_ctlinputwsemul_sun_initufs_islockedcypress_get_syncfltffs_unmountfifo_inactivene2000_detachsvr4_sys_fstat64sys_pwriteisohashtblppp_timeoutsppp_ipcp_RCN_rejwihap_shutdownmmu_install_tablesuvmspace_allocrevarpinputcd_pausesoftdep_setup_directory_changehashinitttstarttunctloldpvecnfs_removerpcipsec_keep_invalidsystrace_debuguao_detach_lockednullfs_vnodeop_pmagma_matchsystrace_prepreplprocfs_printqec_cdsvr4_sys_execvsdopentcp_tracemii_phy_resetip_getmoptionsdp8390_mediastatuszx_alloc_screenin6mask32__moddi3disk_countpfr_mark_addrsnfsrvw_procrastinatedead_openmsgpooldb_list_watchpointsuserconf_attrbmtphymatchicmp6_redirect_outputroute_cbvop_revoke_vp_offsetsva_nullreadeppf_print_flagslxtphy_resettcp_slowtimoqematchcd_play_msfdqreletcp_newtcpcbcgsix_intrsys_fhstatfszssoftprocfs_vfsopself32_load_fileamd7930_commit_settingsbstp_ioctlsys_getpeernamepfkeyv2_sendccdintrhfsc_getqstatsfdc_debugchange_sign16_be_mtsportal_pathconfpfr_validate_tabledb_eqnamefdc_cascsi_strvisbpfwritedoingcachesys_getrusagep9000_accessopsrasops_initipcomp_output_cbcryptoioctllevelhardss_quirk_patternsnd6_prunesl_uncompress_tcp_corem_getbsd_to_svr4_sigffs_truncatemii_attachnfs_replyhfsc_pfattachttylclosemd_diskconfxdc_resetpool_allocator_alloctcx_ioctlchar_typeeeprom_vancr53c9x_debugpagedep_hashvn_closeamd7930_closeexport_addressin6_createmkludgediradd_inode_writtendoclusterwritesvr4_sys_rdebugwsdisplay_cfg_ioctlcachestatsffs_writebremfreefilt_sowdetachnd6_initip6_maxfragslimfreemachclk_per_tickpfr_set_addrssvr4_sys_alarmcompat_25_sys_getfsstatpfr_get_tstatssoftdep_setup_freeblocksdb_show_regspflogrtrequestetherip_outputportal_lookuppf_osfp_fingerprint_hdruvm_km_free_wakeuprootvnodeifmedia_ioctlzs_read_csricmperrpps_countuserconf_modify__one_cmpldi2atapi_mode_selectnewblk_poolcd9660_ihashgetnfsrv_writemii_phy_detachbstp_root_selectionwskbd_add_muxunion_readprocfs_statfsmbtypes__muldi3cgsix_cddb_qualify_ambiguous_namesip_mtudisc_timeoutprocfs_rootvfs_opv_init_defaultrandomopenin6addr_linklocal_allnodesbufinitsvr4_getcontextskip_char_leftcpu_exec_aout_makecmdsscsi_quirk_patternsuserconf_linessunos_sys_sigpendingnfs_truedeflateInitlimit0ep_mii_setbittcp_sack_outputuniqdosnamedb_recovertvtwo_capmap_writetextext2fs_mknodvttoif_tabdb_delete_cmdfifo_nfsv2nodeop_entriesbgetvppgrp_poolpf_get_tagtcx_resettbconfucred_poolvmel_scanswift_get_syncfltnfs_startdes3_setkeyarp_maxtriesnslcd9660_bmapax88190_mii_bitbang_writebstp_record_config_timeout_valuesacct_processportal_openufs_dirbadentrycgfourteen_show_screenrasops24_putchar8logioctlpfr_create_ktablestrlendb_machine_initrasops15_putcharcs4231_query_encodingvop_abortop_vp_offsetsnfsv2_vnodeop_ppfr_ktablesfifo_kqfilterwsfont_initwsdisplayparampool_page_freeespattachah4_inputcopystrbridge_broadcastfpu_ftoswdog_ctl_cb_argsys_pipesunos_sys_setpgrparp_rtrequestext2fs_reload_vnodesppp_lcp_RCRelf32_check_brandwi_cor_resetnfs_getset_niothreadsudp_initbstp_configuration_updatevmes_cdbt_getcmapproc_trampolinesys_rmdirdp8390_disablecompat_43_sys_gethostnamecd9660_vfsopsinflateInitallocbufsocantsendmoreproc_zapvop_revoke_descmainbus_modelpf_set_rt_ifpep_pcmcia_disablecdactivateether_inputuvm_vsunlockzsnull_txintlockstatusquotaoffarpioctlffs_fifoop_pkernel_pagtable_storep9000_mmappf_ncachekernfs_readfs_posix_sysctlaudio_init_ringbufferulinear8_to_linear16_beif_slowtimoep_pcmcia_cadb_load_countudbtablewi_setdefumap_mapidschange_sign16_le_mtsufs_printfb_unblankfatentryzskbd_cdzskbd_catslot_mem_allocvn_selecttctrl_attachfdctimeoutwi_update_statsncr53c9x_abort.umulmf6ctabledrop_earlysys_statdqgetin_baddynamiclineswmsdosfs_symlinksys_symlinkicmp6_sysctlsvr4_sys_vhangupcgfourteenattachclfreeconfig_found_smnfsrv_readdirplusalaw_to_slinear16_lerpc_autherrfdreleasedb_line_at_pcuvm_swapout_threadsknote_attachmax_keylensppp_lcp_tlstbinputdp8390_ioctlgre_wccpspec_nfsv2nodeop_opv_desc__assertdb_put_valuewsdisplay_emul_matchin6_prefixlen2maskesp_input_cbcompat_43_sys_recvmsgLfsbailpcmcia_megahertz_xjem1144_func0_cfe0cgtwelve_scrlistcn_devvpudp6_outputwi_get_debugxbox_cdmaxfilesuvm_pageactivatein6_addr2scopeidip6_sourcecheckvop_access_vp_offsetsffs_mountroottprintfuvm_map_pageable_allesp_initumapfs_vfsopsdofilewriteipqfdesc_symlinkdl10019_media_initmfs_doiomsdosfs_strategytimeout_deldma_resetwsemul_vt100_elspec_strategyxdc_startuvm_pglistfreenfs_attrtimeonfs_bufqpfsync_clear_statepv_changepte4max88190_media_inittvtwo_initcmapnextsiblingext2fs_readbstp_supersedes_port_infosl_compress_setupsoo_statstp4020_calc_speedwskbd_cnpollcpf_altqs_activepppreadrusage_pooldisk_detachsw_0_leftoversunkbd_keydesc_ptsi_obio_dma_startscsi_sizedb_deleteisp_initbeioctlcrypto_driverscompat_43_sys_ftruncateiftovt_tabtcp_backoffbold8x16sppp_pap_my_TOsys_chrootprocfs_bmapexport_salayerfs_vgetzssoftpendingicmp6_redirtimeoutbridge_initenc_xform_dessoisconnectingpf_test_state_otherwsdisplay_pollcvop_link_desc_divreplaceaobj_pagerpf_tagname2tagstopenchopenuvm_tree_RB_REMOVE_COLORpromcninitmld6_inputacct_startsvr4_sys_xmknodmbppselectcs4231_commit_settingsvop_link_vp_offsetsbwtwo_alloc_screendt_to_gmtsoftdep_worklist_busyip_pcboptsfc_purgevop_getextattr_descfb_pfour_idifmedia_delete_instancebe_readsoftdep_update_inodeblocksys_acctss_cazs_write_regccddumpep_media_statusdb_single_stepicmp6statqcopywsdisplaydevprintinflateEndlayerfs_syncpfr_commit_ktableccdwritewsevent_pollmap_backmergesys_profilvmcmd_map_pagedvnp9000_stdscreennfsm_disctin6_pcbhashlookupsystrace_exitwsdisplay_cdsvr4_sys_fcntlbpf_detachdVOP_UNLOCK_uvm_tree_sanityvop_readdir_vp_offsetsip_ecn_egressbridge_send_icmp_errether_ipmulticast_maxmouse_copy_extend_worduvm_init_limitsukphy_cdin_pcbconnectdevoutVOP_IOCTLwant_aststatvarsafeprinumccdaudio_init_playcgeight_mmapsys_rforklenocarrierdma_isintrp9100_stdscreenswift_cache_enableprocfs_linkunion_pathconfuao_swap_offmachineVOP_CLOSEuvm_anallocin_pcbdisconnectiommu_camgxattachcgeight_burneruvm_vnp_terminatepool_cache_putbridge_fragmentxdc_cmdz_allocwtab_destroysys_getpidnd6_defifindexunp_dropptscloseuvm_map_advicetcp_mtudiscsvr4_sys_opentimeout_startuppppattachsi_capf_normalize_ip6rn_addroutepf_find_or_create_rulesetsdactivatenfsrv_errmapread_dsfielddb_print_sadb_elf_sym_numargswsscrollbackchkiqchgbstp_message_age_timer_expiryshmsegdvd_read_manufactconfig_activate_childrenzsnull_softintkrp_req_queueremrunqueuexyc_xyresetsoo_closesystrace_redirecttcp_recvspaceah_sysctluvm_metersubnetsarelocalportal_readdirnfs_requestlinear8_to_linear16_le_mtsoldmon_w_cmdnd6_lookupviking_hotfixpager_map_wantedbridge_bifconfsys_getppidspif_cdmii_anarVOP_READDIRdomainsspif_caireplacesys___sysctlaudio_calcwaterledmatcheeprom_attachextent_alloc_subregionin4_cksumdb_putcharisp_intrneedbufferaltq_add_queuewsemul_pickin6_ifattachsoftdep_worklist_reqppppktinqewatchdogtcp_rst_ppslim_lastwsdisplaystartsi_vme_dma_setupahstatptcwrite_filtopstickfixfdesc_syncsvr4_sys_utssyscd9660_initccdstartipsec_soft_byteslayer_strategynselcollemul_elf32numdirtypagesm_tag_unlinkmountroot_hook_establishbufhashmulaw_to_ulinear8msdosfs_lookupspec_pathconfxdc_startbufhook_establishqe_ifmedia_updzstty_txinttcptv_keep_initaddrmasksys_chdirsvr4_sys_fstatvfs64sensorsktrsetchildrendb_unread_tokenext2fs_diremptymotion_eventssstartsppp_chap_tlduserconf_cntpflogifmouse_zaxisumapfs_unmountsppp_lcp_closeep_default_to_mediaext2fs_inode_freepcmcia_ccr_writedb_find_variableip6_rr_prunebematchsbcompressclk_wenabledirrem_poolmsf2lbacdevsw_lookuplogsoftcsys_adjtimewrite_dsfieldnd6_outputpfsyncioctlssminphysvop_kqfilter_vp_offsetsnative_to_svr4_errnoamap_splitrefktropscryptof_kqfilternclruheadvndwriterasops_alloc_cattruvm_aio_biodonern_initheadvop_generic_unlockesp_glueuvmspace_sharert_timer_addroute_usrreqdeextendu0sbus_matchrasops_erasecolsnfs_readlinktcp_dropsppp_detachicmpstatnv3tov_typefdreadm_prependvop_advlock_descnfsrv_readlinkcompat_25_sys_statfscd9660_pathconfax88190_stop_cardin_pcbrehashin_arpinputxdc_cascanjet_set_windowsbppcloseufs_accessin6_embedscopeif_alloc_sadlgetcacheinfo_sun4unix2winfnncr53c9x_get_ecbzx_show_screentcx_free_screengifattachfpu_divwsfont_unlockoclockmatchreassignbufcd9660_selectip_freemoptionsnetconms1_get_syncfltcgfourteen_accessopssohasoutofbandspec_vnoperatevop_ioctl_descddb_initswift_mmu_enablend6_dad_duplicatedsoftdep_change_linkcntfifo_vnodeop_opv_descmsdosfs_fhtovpnfs_inactivepim6_inputipsp_spd_lookupether_crc32_behandle_written_inodeblockpgfinddvma_freevop_lock_descbeinitrqinitsvr4_ustatrasops_cmapswcr_compdeccd9660_ihash_slockpf_test_fragmentrasops1_putcharip4_inputtcp_inputsysctl_dumpentrydkcksumpmap_mapwsdisplay_cnattachpfkeyv2_policynd6_gctimerncr53c9x_initcd_switchiptimerip_inputaudiowrite_filtops_mulreplace_endnd6_setmtupf_normalize_tcp_cleanupnfsrv_cleancachedb_last_non_spaceudp_ctlinputmii_detachpool_sethardlimitn6expireip_freefvnd_softcaltq_pfdetachkernel_regmap_storezsharddb_show_cmdsudbhashsizeicmp6_mtudisc_updatesun_nonamekmeminitnsphyterattachnd6_ns_inputdeflateEndprocfs_dostatusdevice_refffs_syncuvm_map_submapcnioctlnfsm_srvfattrvndopenufs_vinitvmel_cdeintrnamespool_primepgrphashtblsystraceattachsddkdriverktrwritesys_getpeereidinodedep_lookupifmedia_matchstatclockgetnewbufdvd_read_physicaluvm_mlk_hintsppp_lcp_scruserconf_argbufsunos_sys_unamess_patternsMD5Update_intm_tag_copyqe_mcresetst_readsbus_cda2intdb_value_of_nameprobegettvtwo_show_screenmsdosfs_getattrprocfs_setattrdb_find_breakpointcounterreg_4mm_devgetwritedisklabelgettdbbysrcmsdosfs_printkernel_pmap_storesttyattachwsemul_vt100_opsxyc_submit_iorqstartprofclockcs4231_freeleattachnsphymatchsys_getresgidprocinitrmc_update_class_utilmsdosfs_readdirdead_ebadfsun4_vcache_flush_segmentobio_cambpp_matchnfs_symlinkpf_frag_plopenpromioctlsoo_ioctlred_getqsvr4_sysentamd7930swintrnumdquotforkstatwi_card_identzx_ioctldl10019_mii_statchgnull_setkeyin6mask64db_lbuf_startqec_getsoftclockaudio_initbufsvigra_accessopsmfs_openportal_badopreaddir_with_callbackupdate_modifierdb_breakpoints_insertedswdevtblf_decryptdisk_lockah_attachieioctlsppp_chap_closesbwaitufs_reclaimpf_tag_unrefnswitchdiffsdwriteauxio_regvalprocfs_donoteshm_deallocate_segmentmemnamefpu_ftoxp9000_setcolorfilt_logreadsysctl_rdquaduvm_vnp_setsizevmcmdset_extendsys_lkmnosysip6_use_deprecatedimport_keynfs_setattrrpcuserconf_hist_intextent_alloc_regionsys_mknodraiseext2fs_mountfskill_vmcmdssvr4_ttold_ioctlesp_dma_isactiveufs_mknodsbinsertoobknotesunkbd5_keydesc_jplf_advlockfreeah_enabletcpdropoldhalfopenumapfs_vnodeop_opv_descwi_ioctlcgfourteen_alloc_screennfsrv_rcvfdesc_linkprotection_codespfr_insert_ktablesunos_sys_ostimeswstrategyuserconf_pnumget_sa_requirekernfs_symlinkscsibusprintrtl80x9_init_cardstp4020_attach_socketbstp_make_blockingsys_getpgrpccddevsdqhashtblaudio_defaulttvtwo_burnervigra_scrlistwsemul_vt100_console_emuldatasonewconnufs_direnternfs_reqqpffindprotozsops_kbdcluster_readuvm_swap_initcrypt_alltcp_saveti6wsemul_vt100_initnchrdevsppp_phase_namenfsrv_lookupshm_find_segment_by_keyqsphy_cashmmaxpgs L8`@#`5#" $@``T@3#5c@@"@H*/+/4"c  0  " /"  */" !`/" @㿐@l/!d*@#5 `*L@ 3**#3*15%5/*+4)4-*'45*7/94 ;5 L@qc@ $ c@Р"H@ M"H 2%c@@ LȀ 2@ڒ ܐ@@ː`#` b1   @'/? Ċ`Ī@` Ē`IJ@` @ 㿘? #@(1?+@ 1?㿘 #@(1+@ 1㿘@! " ܒ㿘 @>㿘4 ` @e/ "`p5  L@   $ 㿘4` ? "`/@c`p㿐%/@*p?45!'@5+@C 0@ p 2'5+5a@9 Pp+15#/`h!@ 3a 25!ܐ@'+a@% p!ܒ'p@6a 5 5 L 2 4#P㿘4P` 254"P "`"`"`"` "`"`" @`  "`L? 5 L ?4P 㿘  ; < 㿘 / @@<   @1"&  ?  㿘/ `4@|4c  $  44 `"5" JJ`  -2*@5 @ (*`J@ @ *`  4`(4"#J  *@J` )*@c 5`" ``*J@ -& @54 *:  c` d a  J@ s  J@   $ #bD @ # J@  @㿘@ː / `  @W`x$` $`%44# `( $ 4c€  #̒`$` $`$@ +@  02@ǐ $`&` 2!44/`P @#} +@ 0#/` @/`4 @ / "`l /` t $$ 㿘#4c`   ``*  `c   '@`2`0`,6 * '@ 㿘  & `& $& (   € " '@ 㿘 ` @+ 4# `( ( @0@ 㿘   2  @ $ ?4`$ *㿘4#` `0`4 㿘4#` `?`8 ? 㿘  ,`+@5 ?@ `?㿘 ,m`€s㿐4 ` #    #O!/ #?  `$ *`P `/`$*O O /O㿘㿐4# `      O ? X/O O /O㿐4#/  0T@㿘  㿘4#`t€㿘@/@@㿐4c    #X# p@X/ ` 4 8 8` 4   Ћ@+@ `` ::* * * * * *34c` `€ 0 + @@c|@㿘4#` !/`@+@NaP+@a` +' ah@ + @ap    ` N@J@2J`N` " 2 㿘4#` €+ 0!x@ 㿘!4 Xߖ ??"  X.㿘)4! ?N  @  4"##$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $` +@!+  " * @7 $`0 "$`4 " @*$` @ 2!&  %! +@! 㿘#4a  @ 4 "$a & 4$a㿘/ *`@ /+!@v!\ //         +!@_` `/ @ / 8 <?*  ` آ&@  ` / `@㿘?(4,14\&# H L` T ` X P d l$ p  t @4 .@㿘5 `@V 4 4 5@ s`L+@" G +"8 @    @ 8?@?# @!a% ?@?# @!a ?@?# @! a  ?@?# @ +0 `+ @ @"@ @㿐`+@"`@?@ %?# @! `  a `  `  @[`@`쀢 +@?  ?# ! ? ?# !!+` !+@!+,@`@2,@`@d"h`@`Z+` "h@W@ ` "`,@?`` A+`,@`"p,``,``,``@?``@`@5+@ @  -+,@ ,` ,` ,`  ?`@m+@+"x@``? ? 5"` +"@@8& @" ` @  ! ??#2   @. :d뀤 '@`,    6`,`  ̘D  "`,= x*@`,*` 5`L@  +@"0'@ E   2 `, "`,`@"'@`, @ 2`,+@"? P# 2H  C+"+"+" @i    d d @ "@  @@ @X @ E   :    +"@ @?"   @@ "  @" `,   @` %   5 d"   "  45`L@  +@#0`0, * @Z@5`L@ r +@# 05`L!+ "5`L!+#P5`L!+#h@ ] @0k`0@ `7E    @ " `("L@ 5 1+ ? )+#@#H+" @    d   @ @` ?$ @ @E  `0Ѡ (5+@#5` 4 4&` &`6`*@N6`,@? 5"` +'@@}# 㿐` @0@6ฐ`@@༠@* @ @@x` * d, `0 200@"x @* @ @ ?  "? 6"?% 0@㿘 `  .` 8@ ^&  @   @`&@``@@6``,`G D& h`?  ,` @@!  @0$@     d ,  0 2 0 2 %@` ,`@@,`& 㿐   <P @ 40*:  8  20 @8 0<D @L@ @  Ȁ)n 2; @#0$  " @N  d  *  0 @]$ $  $@&@&    b 8   @   " & 㿐`@Ր  <@`@-5 2& :@ "   2  @  " *@B<@@` ڐ2 ``@Ӑ 㻀@ Ц @ &`@@$`   `  @2 %\F!T@  0@@eg0   @ t,   $@  'a L@  @5<`/2L@`L@ /"`L@"y   נ  / ``4k `L@  /`,@P谒 \,@, W(  2LL@@ $H  E;@P%( 8@H"@ 0 K䰒 *@6`  d*  0` @'O / ' 'ݒ L@  @   0@ @@  Ё㿘 &     . @ "  @ 0  .  "  @ 0 @ @ ے а 㿐 @ є@&B<@@`@@ ``@0 2&     ":?"   ? @ : ` :?  2`"` "`:`0㿐`  8 `@@2.@``@.@+?) @ " " ""@@C <@  @ @ @ B <@   @(*`  pZ j5!1a"'А $  $ $ ''X@Ғ 2V?/a??"a4` $@!#`"#@ #\ @  !5+@=#;?#5 D`H@ D*`4`H' @2 `+@$#"?5'ܠ 5a"@~܀ ?5"5aP@t܀  ?5b@܀ ? ?  M5!Ԣ5a?@G 2B?@i@> 29?/a5?"a6 D"&#`a#@b#\ @   5 H"`L''@( ?@I ?#'@ ? ?㿘`&"@  &@ e 㿘 &   ? @&@ S.@&  @""#d d " e" f" g"#" ?  +d +e +f +gd"@# @ ` J@(8(8    `J/`? `2A ` `!J@(8(8  . ` J J#   J@;..2J`;2 , `J@; @Є 8 <` 㿐@ ( ( @ `  -``( ( +#@ڔ     2` * @h *`  * +` **` +   h  (@ qg@ @@ o`-`  ` րϰ    *` *   *  M `/  M /" M MJL *  2D     !*  *` * @*@  @  @ L  *  "M  !   L  *  2 M  : L  *    g2 @ ``  `-`( U(  gh 8  *   *` *   @ @@ ˀg@+ @    >>>&`>  * *`   * & +` * +   :>@ 0  @  @ 㿘  @ }&  㷐 R@ N`@4 @H``@C@2 *@ `  @ Y,  ( )􀢨$ 2@` ' 8'" w@ 9'@@ @ B <@&hhB <@2&     ":?"   ? @ : ` :?  $2`"`"`  :`0   㿘  ,  ". /.".+."&  "!"..^ 0Y W ?T 0Q @͠LK *L0E 0B 0pؒ  @ Ɛ@ \ 8 'p@ t    $ #`a#\b` @  ? 5 H "`L؀`5@ {  " L?㽠P  x@   'P $` $` $`  $$` ($` ,$`@ $` 8 @ Tt$`     h #`ab`$#\ @ ? 5 L x 0  &,& &&& D& &(&$@ "㺈 ` ($ a b????#\#`  @ ? 5 L `  dh@d .@  ?0  '  $  $  (  ,     $$L#`a $b (#\  @L ,? L `" H5" L?@T@0 +#@ 5 H"`L?㿘@Ӑ /5 "`L!5"!6 &` 2?5`P"`P0 "!"0" ?㷈5 P P` ,@   N  m `/2N N /" N a  0 ] @/ x  <$N O  N  /  .ؔ A.0 0P" 2;P@ @  $+  (@*;@&O`/ P@ x@ x  @  x N  P&`  @ x@ x㿘  "& @ x&  㿘' #5!4%,@    ? `L2  "D @ 0  ; B& > @ 2&     D  "; ?  ?  @ ;   `; ?  /0h( 4 2`:2` <"` @"`D :`0 㿐\@?<6   '?'?@?5H '?` '?`@"H"?'?Đ #`#` #`#`#\ #`c$ #@? 5` @``2,"@~ P5 H"`L?㿘!5$ L@H 5!H@ 2?`2 ?`,` $ L h@Z ??"@?25L5ȇ( 2  2 2 *?5!L #!L!L5("#!L" " " 㾐a"@2 o'Ô?'' "p #\#` ""   C   p'–0 !5 L@c?,@  H$ L8G8G8H8H8G8G8H8G8H8H8H8H8H8H8H8H8H8H8H8H8H8G8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8H8G8H8H8H8H8H8H8H8H8G8H8H8H8H8G`8Gl8Gx8G8G8G㿘`X1!Г*` €1,0 1,- 1,* 1,' 1,$ 1,!!1,! 1,!81,!P1,!p1,!1,!1, !1, !14,!@ @!44쀢@**@"㿘#44!4"a$a ,P'P'T'X@J$!a!耢 *`2*& ,@"J?  .@ 7Ɛ(   , 4 , 4 ` 44 `~4 `4 `4 `b,4 `4 #\"X .@W ,@"(? 52a a2  a @ 0/ ? @ /??"b0 $`㿘/ @m 5㿐@5!" L  5@2?@ 2?`(2?`&2?` 2 ? `@  ??x&$`$` $`$`$`$`<* @ *@@ &  ,`,` 4` $`  $`@4`  6 4 4 `'`'` '`'&$`,` '@4` 4 쀣?&$`$`$`  $` /"0    5`'"'ܐ@ܖ@ܘ( @?,"H@<x@ް {ހ( (  u?@p?2n?<@ 2g? 2c?6``<`]@l 2Y? &U?``  2M?` &@  4 & ` 2>?` "6`` %,@Ґ"h0? ,  $ $ ' '`'''4 @.  ?$$ $ $ $ $$ $ $ $ ` ??㿘\   )5 <+,`% L(?@ @b@,`4 2  L   $$@Ӧ` l J` Є * (Ж  (8. 53 ".?" 8" ?#  0 `(?`d((  `d(h(*  ?#㿘@㿘4" ,@  .  @e 0,@@ "@Z  0,@@w  0,@,@6 ` "@(* 8("@ Є (@ 㿐 "< N ,N`$* `.! ؒN*`? @ . ɒ?N*`# @ .   J `   `&     ,` ` `   ( `߀` ܗ(2 ?# : :* 㿘 3` 3` 3`  .+`+`+`+`3` c+` ??㿘b  @,   /a@%  "` ?` ?74/ :  0 *@ `  *@`*@`4*"" @ ` ?  2  㿘4b('H'L'P'T 'X @"b(@H,@ߐ">㿘,"㿘5# , @` @ , 㿘@@T㿘@| 㿘 < " ? 2  @15 D& L@V  $  L `$ <?$ 8 D$ ?$  @`$㿘אԐ* А* ̐?. ?$`8㿘/"8  , @     & &"   & L`?& & S`?   2?  ?B& 8     `* ??w?2? o  e  "  < Z   <  ?& 8㿘@Y?.`,@ P4",. `"  P @Ԑ,Ȑ?@ 8 `@v &`D&@c&`@0 @ݐ`@ P@Ð?㿘 5 "`L?5#. @ 4. ", @ D@y@v P@㿘4",.  8?? ?2$  ?$8$ L "88 @P  "@"$ $$$$ @$ 45 L`$<" $& @$$$<S < D!5$ L@ $ L $<D$@ #$8 H@q" $H H ?$88 @$$  @V $H8 2  < 2  2L H@D" $H&㾘 5 5#- @4@9",-  `L @?2+$`)'$`" ` 5f c5b @F ` 42$`@   @ ?L @`D P @,Ȑ?@̖ 8$@$`D$`@0` 4@ 1@ /@ f )`' a !ڒ: @5  Zd 4 `0 Z"`L??/@@ ? * `:```? /bD "bD"    /@?"  @@ @   @ *0   @ *`(㿘5. # @  @  5 $"`L2  " @      @ $5" L`5 " L?㿘5. #@ @  5 "  5  Z :@B: Z"`L? ?   ` 㿐5# @  `  ` 5 D"`L$@$`$` 'X 85@`` / "`J /`)$@&$`  l@  4# € ` ` l `" ` @5" L$@?㿐5. # @@  5 ,"`L" @ * 2`      5 "`L B< ' 5 "`L&?8f$8f8g08g8g8g8g8g8g8g8f8g8g8gl8g8g8g8f8g8g8g8g8gȝ㿘'H'L'P'T'X"Ē@ H㿘"Ē@8N@`N@`%` N@`|`! *` € @wL` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @/ N@ @& N@ @ N@ 0 x  @ N@ % w ls㿈,"Ф@ @,@͐  ?L?㿘/"H` 4"<, bJ@ #"<酐 /"@ /"L@  'h@@B`@ `   ,$"ƒ  . 7Ɛ(  , 4 , 4  ~4   44  4  4  4 hb44 j4 h"\$@#\ .J? hl'l,# ` `4` 4`  $4`㿘/l(㿐5-" L(2*?@ 2&?`(2"?`&2?`  @??/"/*@ L*`@ `  ??㿘@ /`(+`&'` # `t   `6`6`` ` 6``6``6`6` 6` 6`   .6`  `6` (6`@@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"&   ?: :  *2@ : J@   J@J`   J " @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &"  /)# # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # # #@&@# # # # # # # # # # # # #@+ 3`@@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &   `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@@ @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   & &  8{8|D8|8}8}h8}8~8~88~88\8848<㿘 ?`2"`0"`"`   "` @ 㿘 ? ` $ 2`0 " $@= $  (€ $ 㿘"M?N 12I?8 D?2 @? & "P& & ( $ 2 "p& $   (  )& "  `"   "`  ( ?"  `   "X *@o  "` ?㿘 㿘 "@?  "<? 7` ?? ` . ܓ*` € %  $ $  @  " `$  ",c0 2    ",cP " `  $ $    $`*   &@,ݒch`   &@&@  ސ? `$ $    * "` $" `˒  $ $    *` " $" `  $ $    *` " $"    $ $  @ ` " $ $ 0" ",c $ " @Β?   " F"" s @] `  5"@ "@  a? `$ $    * "` $" `N  $ $   *` " $" `9  $ $   *` " $" `$   $ $   " $@  ",c $  " " ??㿘    "$? ? @s 0  ? & 06 "* $@@  "@ 㿘 A?`2@0;  "@"` 20?  ,#  @`#@  ?( "$$$ "`˰ $$ "@?㿘 " ?   ?  @9㿘?c6  @`W R !6& @`@ `@`@ `@`@ `@`@ `@` @ ` @` @ ` @` @ `@`@ @β` @`@ђ#͒#񀦠,`88X8888 8|8088ܝ㿘" <&? 8`$`(€  2 ( @ (& 8& 0& & & 4   & <&`0㿘`  `( @ 2` *  `(% $ $`(`$€ 0`  `(  $ ($ ,$ 8$  `( `$€ $`(`$€h 0 4@`  "? ,"` + #ܓ*` €Ъ  *``` 4  `&  `-`0  `4 $@&إ4@@9耢 & & & @&``$  &`&@& 4?  &4-& &`4& & @&``$  &`&@& 4ڔ?  *```?#4* @- & &`& & @&``$  &`&@& 4?`&  m p ` & & @&``$  &`&@& 42D  ,   0 ( @ "?" 22 & 4@ 0 4 "@ ,? ,"   0 ( @ "?" 2 & & @&``$  &`&@& 4Y 8Ȕ "@`%@% &     &  *`` `?, & 4   ! -& 8&`& & @&``$  &`&@& 4? `  `( & & & @&``$  &`&@& 4? &4&   2  @, #  *```  *@ *`"  & 2  4    ,#* *`"  &  &   $ @ ?2 & `(`$€  && & @&``$  &`&@& 4 &&  4   ! @  /-"`` @, `a  *`@ ,   *`    $@ * "  & T4    @ `E  *`@ + 4$@  4 @ ! @$@ 4 2!  `$€`( &&`& & @&``$  &`&@& 4+?  ( ? + "@ &  4   ! @     $4  `#\#`&    !`''#d@rؠ ?2& `$`(€ && & @&``$  &`&@& 4@䀢 2& & & @&``$  &`&@& 4Δ?`$`(€ && & @&``$  &`&@& 4@  @/ 0 4@`  "? ,"   c&&& 4@1 4 0 0 4@& & @&``$  &`&@& 4 && & @&``$  &`&@& 4q & & @&``$  &`&@& 4c?& & @&``$  &`&@& 4U& & @&``$  &`&@& 4G& & @&``$  &`&@& 49& & @&``$  &`&@& 4+& & @&``$  &`&@& 4& & @&``$  &`&@& 4& & @&``$  &`&@& 4?@㿘S `( `$€ (`(`$€ $`(`$€㿘 (^ (@& 0& 4`?8888T8P888D88㿘 (    * * " " "㿘 0 4 @`  " ,"@` $#<*` €)` '& & @&``%@&@&`& 4 ` ``@` 0 4@ `  "@? ,": $@ ` `$` $`$@` /`  *   /b+`@ ` * @  @$ 4  $`$@  @ $` $`$@_   $@-$@ &`& & @&``%  &`&@& 4?` /`b  *   /"+`  ` ` `$`$ $` $`$@4 ` /`Q  *   /b+`@ ` * @  @$  4 $` $` A$@ @ $` * 8$`-$@ &`& & @&``%  &`&@& 4O?` /`   *   /"+`  `  $` $ $@4 `  (  ` ,"  *"$@27  ,  0 ( @ "?"2% & 4@* 0 4 "@ ,? ,"  0 ( @ "?""&  ( ,  (`? $`$@2D `  ,  0 ( @ ""22 ` & 4@ 0 4 "@ , ,"  0 ( @ ""2 ` & & @&``%  &`&@& 4 (i$@ & 4?`?@ 4 0 0 4@& & @&``%  &`&@& 4r $@& & @&``%  &`&@& 4b & & @&``%  &`&@& 4T?& & @&``%  &`&@& 4F& & @&``%  &`&@& 48& & @&``%  &`&@& 4*& & @&``%  &`&@& 4& @&``%  &`&@& 4& & @&``%  &`&@& 4?@㿘`(`$€㿘04@`  , /. ((```(@( @ @-А"` &@6 . &@`` 6@(``` (- @@"` &@V6` (@ &@(`@ `. &@'.6, * @(!?/ (?/ y?/ / ?/ i?/ / ?/ X @2 `. `(. @@@6` 3"` @ . `. @(@@ 2l```&@/6/ 6`` 8) &@" "@'@`'@"@"`"`"42 ` "`8) &@" "@'@`'@"@"`"`"4? &``6` 8) &@" "@'@`'@"@"`"`"4 㿘 4 0@`  ,"` " `"&`&` 8 <& <&`0ヤ ,@@ ' 4  (& 4 4`"   " `"&`&` 8 <& <&`0@&` & 0'H'X\H'L'P'T''''''''''''''''@(@`&@H X&#. @  .@"@ * 􀠠  (`@"@8 # (.@@  ,`(`@?&@ '48- @ ` 0@ `.@(h&@&H`@*@0h'H '0?'p  '(+ '$@??Hh.(+`', M+`$  0% ` d#,@   @&@ .`@8, . ``dp&@&#//! $0@8 '.@&@&X& 4#/,@  /@L   `/@`'LT (P/@ P(@`'0@ (?  ?..`& &   (@" @6@2@ .@@? ' .@+`0@?2[  H+ ` 2?㿀   ( ' #?#d#`#\#h    ??-# ' -@ 2 (-#0' ? ( $€㿀d !  ( `' R?-- !#\#`#d#h]! ?  ,??-#X-$ +-'#--\#`#d"#\#h>  ? 2 (??-# $ ?-#-#$ ? ( $€0 ( $€ //""/"@3"" . `Y G8. @0(` @(` @0(` @0(` @0(` @0(` @0(` @0(0` . @0(`8>> OpenBSD BOOT %s bsddevice[%s]: boot: open: %s: %s Booting %s @ 0x%x dvma_mapindvma_mapoutboot: client IP address: %s boot: client name: %s rootroot addr=%s path=%s promprom0Can't open device `%s' Can't open network device `%s' xmit: not a network device %x mac-address drop swap 6 cmoveielefdxyxdstsddevice_typeblocknetworkbytenode %x property %s length %d > %d Invalid controller number prom_iopen: "%s" error=%d prom_mapin: length=%dprom_mapin: invalid maptype %d2.2read header: %s ELFunknown executable format %d+%d+[%d+%d]=0x%x boot: short read read phdr: %s Can't find entry point. %s%lu+read text: %s +%luseek to section headers: %s read section headers: %d %s%ld [lseek symbols: %s read symbols: %s ] bootparamd: 'whoami' call failed bp_whoami: short reply, %d < %d CD001nfsread: short packet, %d < %ld nfs_open: must mount first. nfs_read: hit EOF unexpectantlycallrpc: error = %d recvrpc: reject, astat=%d, errno=%d getport: %sbad adaptor numberbad controller numberbad drive numberbad partitioncan't read disk labelunlabeledDevice not configuredOperation not permittedNo such file or directoryStale NFS file handleInappropriate file type or formatExec format errorInput/output errorInvalid argumentUnknown error: code %drarp: bad socket. %d No response for RARP request sendudp: bad write (%d != %d)readudp: huge packet, udp len %ld sendrecv: short write! (%d < %d) exit1.1.40123456789abcdef|/-\arpwhohas: overflowed arp_list! arp: no response for %sunknown compression methodinvalid window sizeincorrect header checkneed dictionaryincorrect data check     invalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid bit length repeatinvalid literal/length codeinvalid distance codeinvalid distance codeinvalid literal/length code inflate 1.1.4 Copyright 1995-2002 Mark Adler  #+3;CScspp !1Aa  0@` oversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeoversubscribed literal/length treeincomplete literal/length treeoversubscribed distance treeincomplete distance treeempty distance tree with lengthsw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-8% 8(8)8)8)8*D81|86h86878788p8>\8@8@8A8A8B88 88 888 88 (88H8@88808(8 8   8@` 0123456789abcdef/8׈?? `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O `PTsRp0 P ` @ PX S;x8 Qh( H PTUS+t4 Q d$ D P\ TS|< Rl,  L PRUS#r2 Q b" B PZ TCz: Rj*  J PVS3v6 Qf& F P ^ Tc~> Rn. N `QURq1 P a! A PY S;y9 Qi)  I PUPS+u5 Q e% E P] TS}= Rm-  M PSUS#s3 Q c# C P[ TC{; Rk+  K PWS3w7 Qg' G P _ Tc? Ro/ O PWS[QYUA]@PXT!\ R ZV`PWS[QYUa]`PXT1\0R Z V`88888X8X88888)858(B8M8ѠV8xa88p8u8X8Ѥ888\8`8И8@8@8088x88(8\8v48! 8P,8@587B8K8_Q86]8ehd 8k 8s 88D88G4 88HX8D(8888T8Bp8H8p 8@88p 81|, 8L28a(98Q4?88D8{@L 8D[8dc84n8oxt8+~8@8b8 88`8 8|8788ox 88S88 8H88hx8l88"8R(1 868-pA8hI 8R 8b8hq8}88  8D88d8]@888ud8(888 8P84 8 88.08{ =8>\F8$T8 _8s8@|8A8 8Bx8X808Vp8O8e8N8X8H8$8V 8=8  8b 8h8n%84+8B48A8U88]8Zb 8i8s8|88l8+t88 8P8)8L 88U 8H8K8y8U\8r8d8/L)8<8H8V 8b8)k8`r8w8kD8% 8 08Q 8A 88L86h8 8o8VP88.8h 8 88r8v4" 8L/8x>8/P8 Y8n8y8 8 8H 88*p888(8S(8\8l8 8 x8e 838U88l= 8 B8)L8Z8`8Pp8u8h8*D88P8o\8YX8Tx8q 888yt8t88 ( 8y 8T 8Z0 ! 8 /8( = 8 B8@ K8D ]8`h bgcc2_compiled.open_countnetif_promfilestore.9bootstore.10prom0_fakesaveechopv_putcharsun4_idprom.65dtabstringbuf.75promdev_inuseprom_mapinprom_mapinfoprom_mapinfo_cntprom_devmappromvecstore.88elf_execaout_execelf_seekputchardvma_allocprom0_iclose_remprom_ioctldomainnameloadfilecd9660_writenet_openalloccd9660_readprintfnameipprom_sihostnamelenrpc_fromaddrrpc_portstrerrorrpc_pmap_listsnprintfrpc_pmap_getcachehznodevether_sprintfnfs_readdirrarp_getipaddressnetdev_socknetif_debugcd9660_statcd9660_openerrnoocloseintoagetsinflatebp_server_addrversionnetif_open_udivbp_whoaminfs_closeolseekpgshiftswapipmemcpynbpgdevopencd9660_seekinflate_fast.udivrootipsendethercd9660_readdirrpc_xidinflate_flushtwiddle.divgetsecsndevsip_convertaddrmyipbp_getfilekprintnhostnameprom_bootdevicenfs_stat_typesdvma_mapoutrootpathobp_strategydebugprom_getetheroreadlseek_rttarp_numbzeroufs_closepgofsetinflateSyncPointcputypnfs_root_nodefile_system_cd9660promvecssymxdr_string_decodeinflateInit_nfs_opennet_mountrootprom0_recvinflate_blocks_freenfs_readnfs_writeprom0_strategy